Apolipoprotein L1-Specific Antibodies and Methods of Use
20230071609 · 2023-03-09
Assignee
Inventors
- Suzanna Jane Scales (South San Francisco, CA, US)
- Nidhi Gupta (Redwood City, CA, US)
- Andrew Scott Peterson (San Francisco, CA, US)
Cpc classification
C07K16/2875
CHEMISTRY; METALLURGY
G01N33/6872
PHYSICS
C07K2317/24
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
International classification
Abstract
This disclosure provides anti-apolipoprotein L1 (APOL1) antibodies, including anti-APOL1 antibodies that distinguish the GO and G1 forms from the G2 form of APOL1, distinguish APOL1 found on podocytes from that found on HDL particles in serum, and distinguish APOL1 from apolipoproteins L2, L3, L4 and L6 (APOL2, APOL3, APOL4 and APOL6), and methods of using the same.
Claims
1. An isolated antibody that specifically binds to apolipoprotein L1 (APOL1), wherein the antibody comprises: (a) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 3, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 4, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 5; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 6, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 7, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 8; (b) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 13, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 14, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 15; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 16, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 17, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 18; (c) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 23, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 24, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 25; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 26, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 28; (d) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 33, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 34, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 35; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 37, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 38; (e) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 43, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 44, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 45; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 46, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 47, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 48; (f) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 53, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 54, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 55; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 56, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 57, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 58; (g) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 63, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 64, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 65; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 66, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 68; (h) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 73, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 74, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 75; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 76, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 77, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 78; (i) heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 83, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 84, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 85; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 86, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 87, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 88; (j) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 93, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 94, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 95; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 96, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 97, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 98; (k) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 103, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 104, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 105; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 106, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 107, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 108; (l) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 113, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 114, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 115; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 116, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 117, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 118; (m) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 123, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 124, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 125; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 126, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 127, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 128; (n) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 133, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 134, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 135; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 136, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 137, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 138; (o) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 143, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 144, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 145; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 146, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 147, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 148; (p) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 153, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 154, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 155; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 156, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 157, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 158; (q) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 163, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 164, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 165; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 166, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 167, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 168; (r) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 173, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 174, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 175; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 176, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 177, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 178; (s) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 183, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 184, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 185; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 186, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 187, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 188; (t) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 193, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 194, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 195; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 196, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 197, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 198; or (u) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 203, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 204, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 205; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 206, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 207, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 208.
2. The antibody of claim 1, wherein the antibody: (a) comprises the CDRs of claim 1(a) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 9 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 10; (b) comprises the CDRs of claim 1(b) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 19 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 20; (c) comprises the CDRs of claim 1(c) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 29 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 30; (d) comprises the CDRs of claim 1(d) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 39 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 40; (e) comprises the CDRs of claim 1(e) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 49 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 50; (f) comprises the CDRs of claim 1(f) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 59 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 60; (g) comprises the CDRs of claim 1(g) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 69 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 70; (h) comprises the CDRs of claim 1(h) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 79 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 80; (i) comprises the CDRs of claim 1(i) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 89 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 90; (j) comprises the CDRs of claim 1(j) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 99 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 100; (k) comprises the CDRs of claim 1(k) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 109 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 110; (1) comprises the CDRs of claim 1(l) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 119 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 120; (m) comprises the CDRs of claim 1(m) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 129 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 130; (n) comprises the CDRs of claim 1(n) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 139 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 140; (o) comprises the CDRs of claim 1(o) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 149 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 150; (p) comprises the CDRs of claim 1(p) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 159 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 160; (q) comprises the CDRs of claim 1(q) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 169 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 170; (r) comprises the CDRs of claim 1(r) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 179 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 180; (s) comprises the CDRs of claim 1(s) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 189 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 190; (t) comprises the CDRs of claim 1(t) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 199 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 200; or (u) comprises the CDRs of claim 1(u) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 209 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 210.
3. The antibody of claim 1, wherein the antibody comprises: the CDRs of claim 1(a) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 9; the CDRs of claim 1(b) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 19; the CDRs of claim 1(c) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 29; the CDRs of claim 1(d) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 39; the CDRs of claim 1(e) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 49; the CDRs of claim 1(f) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 59; the CDRs of claim 1(g) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 69; the CDRs of claim 1(h) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 79; the CDRs of claim 1(i) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 89; the CDRs of claim 1(j) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 99; the CDRs of claim 1(k) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 109; the CDRs of claim 1(l) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 119; the CDRs of claim 1(m) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 129; the CDRs of claim 1(n) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 139; the CDRs of claim 1(o) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 149; the CDRs of claim 1(p) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 159; the CDRs of claim 1(q) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 169; the CDRs of claim 1(r) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 179; the CDRs of claim 1(s) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 189; the CDRs of claim 1(t) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 199; or the CDRs of claim 1(u) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 209.
4. The antibody of claim 1, wherein the antibody comprises: the CDRs of claim 1(a) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 10; the CDRs of claim 1(b) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 20; the CDRs of claim 1(c) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 30; the CDRs of claim 1(d) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 40; the CDRs of claim 1(e) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 50; the CDRs of claim 1(f) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 60; the CDRs of claim 1(g) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 70; the CDRs of claim 1(h) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 80; the CDRs of claim 1(i) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 90; the CDRs of claim 1(j) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 100; the CDRs of claim 1(k) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 110; the CDRs of claim 1(l) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 120; the CDRs of claim 1(m) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 130; the CDRs of claim 1(n) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 140; the CDRs of claim 1(o) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 150; the CDRs of claim 1(p) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 160; the CDRs of claim 1(q) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 170; the CDRs of claim 1(r) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 180; the CDRs of claim 1(s) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 190; the CDRs of claim 1(t) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 200; or the CDRs of claim 1(u) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 210.
5. The antibody of claim 1, wherein the antibody comprises: a VH comprising the amino acid sequence of SEQ ID NO: 9 and a VL comprising the amino acid sequence of SEQ ID NO: 10; a VH comprising the amino acid sequence of SEQ ID NO: 19 and a VL comprising the amino acid sequence of SEQ ID NO: 20; a VH comprising the amino acid sequence of SEQ ID NO: 29 and a VL comprising the amino acid sequence of SEQ ID NO: 30; a VH comprising the amino acid sequence of SEQ ID NO: 39 and a VL comprising the amino acid sequence of SEQ ID NO: 40; a VH comprising the amino acid sequence of SEQ ID NO: 49 and a VL comprising the amino acid sequence of SEQ ID NO: 50; a VH comprising the amino acid sequence of SEQ ID NO: 59 and a VL comprising the amino acid sequence of SEQ ID NO: 60; a VH comprising the amino acid sequence of SEQ ID NO: 69 and a VL comprising the amino acid sequence of SEQ ID NO: 70; a VH comprising the amino acid sequence of SEQ ID NO: 79 and a VL comprising the amino acid sequence of SEQ ID NO: 80; a VH comprising the amino acid sequence of SEQ ID NO: 89 and a VL comprising the amino acid sequence of SEQ ID NO: 90; a VH comprising the amino acid sequence of SEQ ID NO: 99 and a VL comprising the amino acid sequence of SEQ ID NO: 100; a VH comprising the amino acid sequence of SEQ ID NO: 109 and a VL comprising the amino acid sequence of SEQ ID NO: 110; a VH comprising the amino acid sequence of SEQ ID NO: 119 and a VL comprising the amino acid sequence of SEQ ID NO: 120; a VH comprising the amino acid sequence of SEQ ID NO: 129 and a VL comprising the amino acid sequence of SEQ ID NO: 130; a VH comprising the amino acid sequence of SEQ ID NO: 139 and a VL comprising the amino acid sequence of SEQ ID NO: 140; a VH comprising the amino acid sequence of SEQ ID NO: 149 and a VL comprising the amino acid sequence of SEQ ID NO: 150; a VH comprising the amino acid sequence of SEQ ID NO: 159 and a VL comprising the amino acid sequence of SEQ ID NO: 160; a VH comprising the amino acid sequence of SEQ ID NO: 169 and a VL comprising the amino acid sequence of SEQ ID NO: 170; a VH comprising the amino acid sequence of SEQ ID NO: 179 and a VL comprising the amino acid sequence of SEQ ID NO: 180; a VH comprising the amino acid sequence of SEQ ID NO: 189 and a VL comprising the amino acid sequence of SEQ ID NO: 190; a VH comprising the amino acid sequence of SEQ ID NO: 199 and a VL comprising the amino acid sequence of SEQ ID NO: 200; or a VH comprising the amino acid sequence of SEQ ID NO: 209 and a VL comprising the amino acid sequence of SEQ ID NO: 210.
6. The antibody of claim 1, wherein the antibody comprises: the CDRs of claim 1(a) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 11 and/or a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 12; the CDRs of claim 1(b) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 21 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 22; the CDRs of claim 1(c) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 31 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 32; the CDRs of claim 1(d) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 41 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 42; the CDRs of claim 1(e) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 51 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 52; the CDRs of claim 1(f) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 61 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 62; the CDRs of claim 1(g) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 71 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 72; the CDRs of claim 1(h) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 81 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 82; the CDRs of claim 1(i) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 91 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 92; the CDRs of claim 1(j) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 101 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 102; the CDRs of claim 1(k) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 111 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 112; the CDRs of claim 1(l) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 121 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 122; the CDRs of claim 1(m) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 131 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 132; the CDRs of claim 1(n) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 141 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 142; the CDRs of claim 1(o) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 151 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 152; the CDRs of claim 1(p) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 161 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 162; the CDRs of claim 1(q) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 171 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 172; the CDRs of claim 1(r) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 181 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 182; the CDRs of claim 1(s) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 191 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 192; the CDRs of claim 1(t) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 201 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 202; or the CDRs of claim 1(u) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 211 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 212.
7. The antibody of claim 1, wherein the antibody comprises: a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 11 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 12; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 21 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 22; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 31 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 32; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 41 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 42; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 51 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 52; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 61 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 62; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 71 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 72; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 81 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 82; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 91 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 92; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 101 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 102; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 111 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 112; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 121 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 122; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 131 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 132; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 141 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 142; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 151 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 152; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 161 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 162; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 171 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 172; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 181 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 182; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 191 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 192; a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 201 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 202; or a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 211 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 212.
8. An isolated antibody that specifically binds to apolipoprotein L1 (APOL1), wherein the antibody: a) specifically binds to a region of APOL1 corresponding to amino acids 61-103 of APOL1 G0 (SEQ ID NO: 2); and/or b) specifically binds to a region of APOL1 corresponding to amino acids 111-150 of APOL1 G0 (SEQ ID NO: 2); wherein the antibody preferentially recognizes APOL1 expressed on podocytes over APOL1 found in serum; and further wherein the antibody comprises: (a) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 173, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 174, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 175; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 176, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 177, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 178; or (b) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 183, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 184, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 185; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 186, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 187, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 188.
9. (canceled)
10. An isolated antibody that specifically binds to apolipoprotein L1 (APOL1), wherein the antibody: a) specifically binds to a region of APOL1 corresponding to amino acids 103-111 of APOL1 G0 (SEQ ID NO: 2); b) specifically binds to a region of APOL1 corresponding to amino acids 150-172 of APOL1 G0 (SEQ ID NO: 2); c) specifically binds to a region of APOL1 corresponding to amino acids 314-333 of APOL1 G0 (SEQ ID NO: 2); and/or d) specifically binds to a region of APOL1 corresponding to amino acids 376-398 of APOL1 G0 (SEQ ID NO: 2); wherein the antibody recognizes both APOL1 expressed on podocytes and APOL1 found in serum; and further wherein the antibody comprises: (a) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 3, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 4, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 5; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 6, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 7, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 8; (b) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 53, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 54, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 55; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 56, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 57, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 58; (c) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 63, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 64, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 65; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 66, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 68; (d) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 83, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 84, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 85; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 86, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 87, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 88; (e) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 73, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 74, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 75; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 76, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 77, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 78; (f) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 133, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 134, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 135; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 136, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 137, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 138; (g) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 143, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 144, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 145; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 146, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 147, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 148; or (1) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 123, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 124, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 125; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 126, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 127, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 128.
11.-16. (canceled)
17. The antibody of claim 1, wherein the antibody is humanized or chimeric.
18. The antibody of claim 1, which is an IgG antibody.
19. The antibody of claim 1, which is a full-length antibody or an antibody fragment, wherein the antibody fragment is chosen from Fv, single-chain Fv (scFv), Fab, Fab′, and (Fab′).sub.2.
20. (canceled)
21. The antibody of claim 1, which is a bispecific or multispecific antibody or wherein the antibody is conjugated covalently or noncovalently to at least one other molecule, wherein the at least one other molecule comprises a detection label and/or a pharmaceutical agent.
22.-23. (canceled)
24. An isolated nucleic acid, wherein the isolated nucleic acid encodes for encoding the antibody of claim 1, or the isolated nucleic acid is an isolated vector comprising one or more nucleic acids encoding the heavy chain and the light chain of the antibody of claim 1.
25. (canceled)
26. An isolated host cell comprising the nucleic acid of claim 24.
27. A method of producing an antibody that binds to APOL1 comprising culturing the host cell of claim 26 under conditions suitable for the expression of the antibody.
28. The method of claim 27, further comprising recovering the antibody from the host cell.
29. An antibody produced by the method of claim 28.
30. A method of detecting apolipoprotein L1 (APOL1) in a sample, comprising: providing a sample comprising at least one of APOL1, APOL2, APOL3, APOL4, or APOL6; contacting the sample with an anti-APOL1 antibody according to claim 1; and detecting the presence of the APOL1 protein in the sample based on recognition of the protein by the anti-APOL1 antibody; optionally, wherein the sample comprises human kidney cells, human podocyte cells, human endothelial cells, or optionally wherein the sample is a human serum or blood sample.
31.-35. (canceled)
36. A method of specifically detecting podocyte cells expressing apolipoprotein L1 (APOL1), comprising providing a sample comprising podocyte cells, contacting the sample with an anti-APOL1 antibody according to claim 1, and detecting binding of the antibody to the sample, wherein the antibody (a) preferentially binds to APOL1 found on podocyte cells over APOL1 found in serum, (b) the antibody does not significantly bind to APOL2, and/or (c) the antibody does not significantly bind to APOL6.
37. (canceled)
Description
BRIEF DESCRIPTION OF THE FIGURES
[0186]
[0187]
[0188]
[0189]
[0190]
[0191]
[0192]
[0193]
[0194]
[0195]
[0196]
[0197]
[0198]
[0199]
[0200]
[0201]
[0202]
[0203]
[0204]
[0205]
[0206]
[0207]
[0208]
[0209]
[0210]
[0211]
[0212]
[0213]
[0214]
[0215]
[0216]
[0217]
[0218]
[0219]
[0220]
[0221]
[0222]
[0223]
[0224]
[0225]
[0226]
[0227]
[0228]
[0229]
[0230]
[0231]
[0232]
[0233]
[0234]
[0235]
[0236]
[0237]
[0238]
[0239]
[0240]
[0241]
[0242]
[0243]
[0244]
[0245]
[0246]
[0247]
[0248]
[0249]
[0250]
[0251]
[0252]
[0253]
[0254]
[0255]
[0256]
[0257]
[0258]
[0259]
[0260]
[0261]
[0262]
[0263]
[0264]
[0265]
[0266]
[0267]
[0268]
[0269]
[0270]
[0271]
[0272]
[0273]
[0274]
[0275]
[0276]
[0277]
[0278]
[0279]
[0280]
[0281]
[0282]
[0283]
[0284]
[0285]
[0286]
[0287]
[0288]
[0289]
[0290]
[0291]
[0292]
[0293]
[0294]
[0295]
[0296]
[0297]
[0298]
[0299]
[0300]
[0301]
[0302]
[0303]
[0304]
[0305]
[0306]
[0307]
DETAILED DESCRIPTION
I. Definitions
[0308] Unless otherwise defined, scientific and technical terms used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.
[0309] In this application, the use of “or” means “and/or” unless stated otherwise. In the context of a multiple dependent claim, the use of “or” refers back to more than one preceding independent or dependent claim in the alternative only. Also, terms such as “element” or “component” encompass both elements and components comprising one unit and elements and components that comprise more than one subunit unless specifically stated otherwise.
[0310] Exemplary techniques used in connection with recombinant DNA, oligonucleotide synthesis, tissue culture and transformation (e.g., electroporation, lipofection), enzymatic reactions, and purification techniques are described, e.g., in Sambrook et al. Molecular Cloning: A Laboratory Manual (2nd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989)), among other places.
[0311] As utilized in accordance with the present disclosure, the following terms, unless otherwise indicated, shall be understood to have the following meanings:
[0312] The terms “APOL1” and “apolipoprotein L1,” as used herein, refer to any native human APOL1, including native isoforms and the G0, G1, and G2 variant forms, and forms with and without a signal sequence, unless otherwise indicated. The term encompasses “full-length”, unprocessed human APOL1 as well as any form of APOL1 that results from processing in the cell. The term also encompasses naturally occurring isoforms of human APOL1, which includes the vA, vB1, vB3, and vC isoforms, for example, whose accession numbers are provided in Tables 3 and 5 herein, as well as other single nucleotide polymorphisms not explicitly mentioned herein. The amino acid sequence of an exemplary human APOL1 protein in the G0 form, with and without the signal peptide (amino acids 1-27) is shown in SEQ ID NOs: 1 and 2. Other exemplary naturally occurring APOL1 G0 isoforms without the signal sequence are shown in SEQ ID Nos: 213-214. The G1 variant of APOL1 differs from the G0 form in that it contains S342G and I384M substitutions. An exemplary G1 sequence is provided in SEQ ID NO: 215. The G2 variant differs from the G0 form in that amino acids N388 and Y389 are deleted. An exemplary G2 sequence is found in SEQ ID NO: 216 herein.
[0313] In the present disclosure, if an amino acid residue or range of residues is provided without explicit reference to an APOL1 sequence, the reference sequence is meant to be that of SEQ ID NO: 2.
[0314] “Affinity” refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K.sub.D). Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary methods for measuring binding affinity are described in the following.
[0315] The term “antibody” herein refers to a molecule comprising at least complementarity-determining region (CDR) 1, CDR2, and CDR3 of a heavy chain and at least CDR1, CDR2, and CDR3 of a light chain, wherein the molecule is capable of binding to antigen. The term is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), full length antibodies, single-chain antibodies, and antibody fragments, so long as they exhibit the desired APOL1-specific binding activity.
[0316] An “isolated” antibody is one which has been separated from a component of its natural environment. In some aspects, an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC) methods. For a review of methods for assessment of antibody purity, see, e.g., Flatman et al., J. Chromatogr. B 848:79-87 (2007).
[0317] An “antigen” refers to the target of an antibody, i.e., the molecule to which the antibody specifically binds. The term “epitope” denotes the site on an antigen, either proteinaceous or non-proteinaceous, to which an antibody binds. Epitopes on a protein can be formed both from contiguous amino acid stretches (linear epitope) or comprise non-contiguous amino acids (conformational epitope), e.g., coming in spatial proximity due to the folding of the antigen, i.e. by the tertiary folding of a proteinaceous antigen. Linear epitopes are typically still bound by an antibody after exposure of the proteinaceous antigen to denaturing agents, whereas conformational epitopes are typically destroyed upon treatment with denaturing agents. An epitope comprises at least 3, at least 4, at least 5, at least 6, at least 7, or 8-10 amino acids in a unique spatial conformation.
[0318] An “anti-APOL1 antibody” or an “APOL1-antibody” or an “antibody that specifically binds APOL1” or an “antibody that binds to APOL1” and similar phrases mean an antibody that specifically binds to APOL1 as defined above. In this disclosure, “specifically binds” or “specific binding” and similar terms means that the binding affinity is sufficiently strong that the interaction between the members of the binding pair cannot be due to random molecular associations (i.e. “nonspecific binding”). Specific binding generally requires a dissociation constant (K6) of 1 μM or less. Specific binding often involves a K.sub.D of 10 nM or less.
[0319] The term “heavy chain” refers to a polypeptide comprising at least a heavy chain variable region, with or without a leader sequence. In some embodiments, a heavy chain comprises at least a portion of a heavy chain constant region. The term “full-length heavy chain” refers to a polypeptide comprising a heavy chain variable region and a heavy chain constant region, with or without a leader sequence.
[0320] The term “light chain” refers to a polypeptide comprising at least a light chain variable region, with or without a leader sequence. In some embodiments, a light chain comprises at least a portion of a light chain constant region. The term “full-length light chain” refers to a polypeptide comprising a light chain variable region and a light chain constant region, with or without a leader sequence.
[0321] The term “hypervariable region” or “HVR” as used herein refers to each of the regions of an antibody variable region which are hypervariable in sequence and which determine antigen binding specificity, for example “complementarity determining regions” (“CDRs”). Generally, antibodies comprise six CDRs: three in the VH (CDR-H1, CDR-H2, CDR-H3), and three in the VL (CDR-L1, CDR-L2, CDR-L3). Unless otherwise indicated, the CDRs are determined according to the sequence table herein. One of skill in the art will understand that the CDR designations can also be determined according to Chothia, supra, McCallum, supra, or any other scientifically accepted nomenclature system. Specifically:
[0322] (a) hypervariable loops occurring at amino acid residues 26-32 (L1), 50-52 (L2), 91-96 (L3), 26-32 (H1), 53-55 (H2), and 96-101 (H3) otherwise constitute Chothia CDRs (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987));
[0323] (b) CDRs occurring at amino acid residues 24-34 (L1), 50-56 (L2), 89-97 (L3), 31-35b (H1), 50-65 (H2), and 95-102 (H3) constitute Kabat CDRs (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)); and
[0324] (c) antigen contacts occurring at amino acid residues 27c-36 (L1), 46-55 (L2), 89-96 (L3), 30-35b (H1), 47-58 (H2), and 93-101 (H3) constitute MacCallum CDRs (MacCallum et al. J. Mol. Biol. 262: 732-745 (1996)). If sequences are not provided in the sequence table for CDRs of an antibody herein, and one of the three above types of CDRs is not otherwise stated “e.g. Chothia CDRs or Kabat CDRs,” then Kabat CDRs are intended.
[0325] “Framework” or “FR” refers to the residues of the variable region residues that are not part of the complementary determining regions (CDRs). The FR of a variable region generally consists of four FRs: FR1, FR2, FR3, and FR4. Accordingly, the CDR and FR sequences generally appear in the following sequence in VH (or VL): FR1-CDR-H1(CDR-L1)-FR2-CDR-H2(CDR-L2)-FR3-CDR-H3(CDR-L3)-FR4.
[0326] The term “variable region” or “variable domain” refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen. The variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three complementary determining regions (CDRs). See, e.g., Kindt et al. Kuby Immunology, 6.sup.th ed., W.H. Freeman and Co., page 91 (2007). A variable domain may comprise heavy chain (HC) CDR1-FR2-CDR2-FR3-CDR3 with or without all or a portion of FR1 and/or FR4; and light chain (LC) CDR1-FR2-CDR2-FR3-CDR3 with or without all or a portion of FR1 and/or FR4. That is, a variable domain may lack a portion of FR1 and/or FR4 so long as it retains antigen-binding activity. A single VH or VL domain may be sufficient to confer antigen-binding specificity. Furthermore, antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
[0327] The light chain and heavy chain “constant regions” of an antibody refer to additional sequence portions outside of the FRs and CDRs and variable regions. Certain antibody fragments may lack all or some of the constant regions. From N- to C-terminus, each heavy chain has a variable domain (VH), also called a variable heavy domain or a heavy chain variable region, followed by three constant heavy domains (CH1, CH2, and CH3). Similarly, from N- to C-terminus, each light chain has a variable domain (VL), also called a variable light domain or a light chain variable region, followed by a constant light (CL) domain.
[0328] The term “Fc region” herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. In one aspect, a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, antibodies produced by host cells may undergo post-translational cleavage of one or more, particularly one or two, amino acids from the C-terminus of the heavy chain. Therefore, an antibody produced by a host cell by expression of a specific nucleic acid molecule encoding a full-length heavy chain may include the full-length heavy chain, or it may include a cleaved variant of the full-length heavy chain. This may be the case where the final two C-terminal amino acids of the heavy chain are glycine (G446) and lysine (K447, numbering according to EU index). Therefore, the C-terminal lysine (Lys447), or the C-terminal glycine (Gly446) and lysine (Lys447), of the Fc region may or may not be present. Thus, a “full-length IgG1” for example, includes an IgG1 with Gly446 and Lys447, or without Lys447, or without both Gly446 and Lys447. Amino acid sequences of heavy chains including an Fc region are denoted herein without C-terminal glycine-lysine dipeptide if not indicated otherwise. In one aspect, a heavy chain including an Fc region as specified herein, comprised in an antibody according to the invention, may comprise Gly446 and Lys447 (numbering according to EU index). In one aspect, a heavy chain including an Fc region as specified herein, comprised in an antibody according to the invention, may comprise Gly446 (numbering according to EU index). Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991.
[0329] “Effector functions” refer to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: C1q binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor); and B cell activation.
[0330] The “class” of an antibody refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, IgA.sub.1, and IgA.sub.2. In certain aspects, the antibody is of the IgG.sub.1 isotype. In certain aspects, the antibody is of the IgG.sub.1 isotype with the P329G, L234A and L235A mutation to reduce Fc-region effector function. In other aspects, the antibody is of the IgG.sub.2 isotype. In certain aspects, the antibody is of the IgG.sub.4 isotype with the S228P mutation in the hinge region to improve stability of IgG.sub.4 antibody. In some aspects, the antibody may have a non-human IgG constant region, and may be, for example, a murine IgG.sub.2a antibody such as a murine IgG.sub.2a LALAPG antibody. The heavy chain constant domains that correspond to the different classes of immunoglobulins are called α, δ, ε, γ, and μ, respectively. The light chain of an antibody may be assigned to one of two types, called kappa (κ) and lambda (λ), based on the amino acid sequence of its constant domain.
[0331] An “antibody fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen (i.e. APOL1) to which the intact antibody binds. Examples of antibody fragments include but are not limited to Fv, Fab, Fab′, Fab′-SH, F(ab′).sub.2; diabodies; linear antibodies; single-chain antibody molecules (e.g., scFv, and scFab); single domain antibodies (dAbs); and multispecific antibodies formed from antibody fragments. For a review of certain antibody fragments, see Holliger and Hudson, Nature Biotechnology 23:1126-1136 (2005).
[0332] The terms “full length antibody”, “intact antibody”, and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or, in the case of an IgG antibody, having heavy chains that contain an Fc region as defined herein.
[0333] The term “chimeric” antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
[0334] A “humanized” antibody refers to a chimeric antibody comprising amino acid residues from non-human CDRs and amino acid residues from human FRs. In certain aspects, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDRs correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody. A humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody. A “humanized form” of an antibody, e.g., a non-human antibody, refers to an antibody that has undergone humanization.
[0335] The term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. Thus, the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
[0336] An “antibody conjugate” is an antibody conjugated to one or more heterologous molecule(s), including but not limited to a therapeutic agent.
[0337] “Percent (%) amino acid sequence identity” with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity for the purposes of the alignment. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, Clustal W, Megalign (DNASTAR) software or the FASTA program package. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. Alternatively, the percent identity values can be generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087 and is described in WO 2001/007611.
[0338] Unless otherwise indicated, for purposes herein, percent amino acid sequence identity values are generated using the ggsearch program of the FASTA package version 36.3.8c or later with a BLOSUM50 comparison matrix. The FASTA program package was authored by W. R. Pearson and D. J. Lipman (1988), “Improved Tools for Biological Sequence Analysis”, PNAS 85:2444-2448; W. R. Pearson (1996) “Effective protein sequence comparison” Meth. Enzymol. 266:227-258; and Pearson et. al. (1997) Genomics 46:24-36 and is publicly available from www.fasta.bioch.virginia.edu/fasta_www2/fasta_down.shtml or www. ebi.ac.uk/Tools/sss/fasta. Alternatively, a public server accessible at fasta.bioch.virginia.edu/fasta_www2/index.cgi can be used to compare the sequences, using the ggsearch (global protein:protein) program and default options (BLOSUM50; open: −10; ext: −2; Ktup=2) to ensure a global, rather than local, alignment is performed. Percent amino acid identity is given in the output alignment header.
[0339] The term “nucleic acid molecule” or “polynucleotide” includes any compound and/or substance that comprises a polymer of nucleotides. Each nucleotide is composed of a base, specifically a purine- or pyrimidine base (i.e. cytosine (C), guanine (G), adenine (A), thymine (T) or uracil (U)), a sugar (i.e. deoxyribose or ribose), and a phosphate group. Often, the nucleic acid molecule is described by the sequence of bases, whereby said bases represent the primary structure (linear structure) of a nucleic acid molecule. The sequence of bases is typically represented from 5′ to 3′. Herein, the term nucleic acid molecule encompasses deoxyribonucleic acid (DNA) including e.g., complementary DNA (cDNA) and genomic DNA, ribonucleic acid (RNA), in particular messenger RNA (mRNA), synthetic forms of DNA or RNA, and mixed polymers comprising two or more of these molecules. The nucleic acid molecule may be linear or circular. In addition, the term nucleic acid molecule includes both sense and antisense strands, as well as single stranded and double stranded forms. Moreover, the herein described nucleic acid molecule can contain naturally occurring or non-naturally occurring nucleotides. Examples of non-naturally occurring nucleotides include modified nucleotide bases with derivatized sugars or phosphate backbone linkages or chemically modified residues. Nucleic acid molecules also encompass DNA and RNA molecules which are suitable as a vector for direct expression of an antibody of the invention in vitro and/or in vivo, e.g., in a host or patient. Such DNA (e.g., cDNA) or RNA (e.g., mRNA) vectors, can be unmodified or modified. For example, mRNA can be chemically modified to enhance the stability of the RNA vector and/or expression of the encoded molecule so that mRNA can be injected into a subject to generate the antibody in vivo (see e.g., Stadler et al, Nature Medicine 2017, published online 12 Jun. 2017, doi:10.1038/nm.4356 or EP 2 101 823 B1).
[0340] An “isolated” nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
[0341] “Isolated nucleic acid encoding an anti-APOL1 antibody” refers to one or more nucleic acid molecules encoding anti-APOL1 antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
[0342] The term “vector”, as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as “expression vectors”.
[0343] The terms “host cell”, “host cell line”, and “host cell culture” are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
[0344] The term “leader sequence” refers to a sequence of amino acid residues located at the N terminus of a polypeptide that facilitates secretion of a polypeptide from a mammalian cell. A leader sequence may be cleaved upon export of the polypeptide from the mammalian cell, forming a mature protein. Leader sequences may be natural or synthetic, and they may be heterologous or homologous to the protein to which they are attached. Nonlimiting exemplary leader sequences also include leader sequences from heterologous proteins. In some embodiments, an antibody lacks a leader sequence. In some embodiments, an antibody comprises at least one leader sequence, which may be selected from native antibody leader sequences and heterologous leader sequences.
II. Compositions and Methods
A. Exemplary Anti-APOL1 Antibodies
[0345] In one aspect, the invention provides antibodies that specifically bind to APOL1. In some aspects, the antibodies bind specifically to particular portions of APOL1 that may be exposed on the surface of podocytes but that may be buried in APOL1 found in serum HDL particles. Such antibodies may be useful, for example, in distinguishing between APOL1 on the surface of podocytes from APOL1 found in serum, which is generally found on HDL particles, as described in the Examples herein. As described below in the Examples, the exposed and buried portions of APOL1 differ somewhat between podocyte-localized APOL1 and HDL-localized APOL1, allowing certain antibodies to distinguish between these forms due to differential binding affinities to each type.
[0346] The APOL1 protein contains various domains (see
[0347] Certain antibodies herein bind within the PFD (pore forming domain) portion of APOL1, for example, from amino acid 61 to amino acid 172 of APOL1-G0 (amino acids 61-172 of SEQ ID NO: 2). In some aspects, the antibodies bind to the region from amino acid 61 to amino acid 103 of the PFD region (amino acids 61-103 of SEQ ID NO: 2), or they may bind to the region from amino acid 111 to amino acid 150 of the PFD region, either of which may allow the antibodies to recognize APOL1 expressed on podocytes but not APOL1 that circulates as part of HDL particles. This is because those portions of APOL1 may be exposed in podocyte APOL1 but inaccessible in HDL APOL1. In some aspects, the antibodies bind to region from amino acid 103 to amino acid 111 of APOL1 or from amino acid 150 to amino acid 172, which may similarly allow the antibodies to recognize APOL1 expressed on podocytes as well as on HDL particles, as these portions are exposed in both types of APOL1. Such antibodies may also be useful in assays distinguishing podocyte from serum APOL1, for instance by serving as controls.
[0348] Some antibodies herein bind within the MAD (membrane-addressing domain) portion of APOL1 from amino acids 260 to 305 (see amino acids 260-305 of SEQ ID NO: 2). In certain aspects, the antibodies bind to the region from amino acid 260 to amino acid 314 of APOL1, which includes portions of the MAD and L (linker) regions of the protein, and which may allow the antibodies to recognize APOL1 found in HDL particles but not APOL1 expressed on podocyte cells.
[0349] Other antibodies bind in the L (linker) region of APOL1 between amino acids 314 and 333 (see amino acids 314-333 of SEQ ID NO: 2), which may allow the antibodies to recognize APOL1 on both podocytes and HDL particles. Similarly, some antibodies bind within the SRA-ID (serum resistance-associated interacting domain) portion of APOL1 from amino acid 376 to 398 (amino acids 376-398 of SEQ ID NO: 2), which may allow them to recognize APOL1 on both podocytes and HDL particles.
[0350] Binding of antibodies to podocytes may be tested, for example, by in situ hybridization, immuno-histo chemistry (IHC), immunoprecipitation, flow cytometry, or Western blotting. To differentiate binding between podocytes and HDL particles, one may test binding using APOL1 in its native state, for example by flow cytometry or immunoprecipitation. After fixation and/or permeabilization or denaturation on a denaturing western blot, different APOL1 epitopes become exposed.
[0351] Binding of antibodies to APOL1 in serum, i.e. on HDL particles, may be tested, for example, by the assay described in the Examples herein that reports ability of the antibodies to block trypanolysis. Accordingly, antibodies that recognize APOL1 on HDL particles may significantly block trypanolysis whereas antibodies that do not significantly recognize APOL1 on HDL particles may not significantly block trypanolysis in the assays described herein.
[0352] The trypanolysis assay used herein to text specificity of antibodies for serum APOL1 is as follows. Trypanosoma brucei brucei were obtained from ATCC and cultured in HMI-9 media containing IMDM (Genentech), heat-inactivated (56° C. for 30 min) FBS (Seradigm IXL9/06807/GEN), 1% serum plus (Sigma 14008C), HMI-9 (Genentech) and 1% hypoxanthine (Genentech). Trypanosome lysis was performed by treating 1×10.sup.5 Trypanosomes with serial dilutions of NHS or recombinant APOL1 for 16 h in a total of 100 μl. Live cell read out was done by the Alamar Blue assay as per the manufacturer's protocol, (Thermo Fisher, DAL1100). Briefly 10 μl of Alamar Blue was added to each well, incubated at 37° C. for 4 h. Red fluorescence, indicating live trypanosomes, was measured on a SpectraMax® fluorimeter powered by SoftMAX® PRO with excitation at 530 nm and emission 590 nm. For the antibody blocking assay, 1% normal human serum was preincubated with 1-10 μg/ml of anti-APOL1 antibody or media at room temperature for 20 minutes followed by addition of trypanosomes. After 16 h, the Alamar Blue assay was performed as above and background values for media only were subtracted and % blocking calculated by normalizing to no antibody control. Antibodies that significantly block trypanolysis, as tested in the assay, show at least 25% blocking activity.
[0353] The Examples herein describe a number of anti-APOL1 antibodies. The APOL1 binding properties of many of the antibodies are described in the Examples, and, where amino acid sequences of particular antibodies were also determined, those are provided in the Sequence Table that follows the Examples section. In the Examples below, the reference sequence used to generate antibodies herein corresponds to that of SEQ ID NO: 2, representing the “EMR” (E150, M228, R255) APOL1 variant form (the RefSeq). COS cell transient expression experiments herein were performed using the “KIK” variant (K150, 12281, K255), while iAPOL1-podocytes used herein expressed the African variant or “EIK” variant form (E150, 1228, K255). (See SEQ ID Nos: 213 and 214, respectively.) The antibodies herein were found to specifically recognize all three of these APOL1 forms.
[0354] For example, antibodies 5.17H8, 5.11H2, 3.6D12, 3.6H5, 3.6G11, 3.5A12, 3.6C2, 3.5C2, 3.2A7, 3.3A7, 3.2B11, 3.3B6, 3.7D6, and 4.17A5 specifically bind to the PFD region of APOL1. Of those antibodies, antibodies 5.17H8, 5.17H2 and 3.6C2 as well as 3.5C2, 3.6C2, 3.5A12, 3.2A7, 3.3A7, and 3.2B11 bind preferentially to podocytes compared to serum APOL1 on HDL particles. In contrast, antibodies 4.17A5 and 3.7D6, which also specifically bind to the PFD region bind to podocytes but may also significantly block trypanolysis, indicating that they recognize both APOL1 on podocytes and serum (i.e. HDL) APOL1. Antibodies 3.6D12, 3.6G11, 3.6H5, and 5.17D12 also recognize APOL1 in both podocytes and serum. As a further example, antibodies 4.6A9, 1.11G1, and 3.3A8 bind to the MAD region of the protein at amino acids 260 to 294 and strongly block trypanolysis while showing only low levels of podocyte binding, indicating that they preferentially recognize serum (i.e. HDL) APOL1. Similarly, antibodies 3.2C11, 3.7E8, and 3.7B5 bind to the MAD-L region at amino acids 294-314 and preferentially recognize serum APOL1 over podocyte APOL1. Antibodies 3.1C1, 3.1C7, 3.6E10, 3.6H10, and 3.4G10 bind to the L portion of the protein and recognize APOL1 on both podocytes and serum. Antibody 3.6H10 may preferentially recognize APOL1 on podocytes, however. Antibodies 4.11A10, 4.11H11, and 4.12E5 bind to the SRA-ID part of APOL1 and recognize both podocyte and serum APOL1.
[0355] Certain antibodies herein do not significantly bind to other members of the apolipoprotein ligand family, such as APOL2 and/or APOL3 as well as APOL4 and APOL6. Thus, in some aspects, the antibodies do not significantly bind to APOL2. In some aspects the antibodies show no detectable binding to APOL2 or APOL6 according to the detection methods described in the Examples below. In some aspects the antibodies show no detectable binding to APOL2 or APOL6 according to the detection methods described in the Examples below. In some aspects the antibodies show no detectable binding to APOL2 or APOL3 according to the detection methods described in the Examples below. In some aspects, antibodies show no detectable binding to any of APOL2, APOL3, APOL4, or APOL6. For instance, antibodies 5.17D12 and 3.7D6 specifically bind to APOL1 and show little to no binding to other apolipoprotein ligand family members such as APOL2, APOL3, APOL4 and APOL6. By contrast antibody 4.17A5 detects APOL4 as well as APOL1, but not APOL2, APOL3 or APOL6. In contrast, antibody 3.6D12, for example, binds to APOL1 as well as to APOL2 and APOL3. Each of 5.17D12, 4.17A5, and 3.7D6 also specifically recognizes all of the G0, G1, and G2 variants of APOL1.
[0356] In some aspects antibodies herein may distinguish between different forms of APOL1, namely the G0, G1, and G2 variants. For example, antibodies 4.11A10, 4.12E5 and 4.11A10 bind specifically to the G0 and G1 forms of APOL1 but do not significantly bind to the G2 form. Thus, those antibodies are able to distinguish G0 and G1 forms from the G2 form.
[0357] Accordingly, the different binding characteristics of the antibodies herein may be useful in some aspects for a variety of diagnostic assays and uses in which APOL1 on podocytes needs to be distinguished from APOL1 in serum (i.e. on HDL particles), in which APOL1 needs to be distinguished from APOL2 and/or APOL3 or from all of APOL2, APOL3, APOL4, and APOL6, and/or in which APOL1 G0 and G1 forms need to be distinguished from the G2 form.
[0358] Certain antibody clones described in the Examples below were sequenced, and the CDR, variable region, and heavy and light chain sequences of those antibodies are provided in the sub-sections that follow and in the Sequence Table below. In some aspects, antibodies of the disclosure include the following:
[0359] 1. An isolated antibody that specifically binds to apolipoprotein L1 (APOL1), wherein the antibody comprises:
[0360] (a) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 3, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 4, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 5; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 6, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 7, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 8;
[0361] (b) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 13, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 14, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 15; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 16, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 17, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 18;
[0362] (c) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 23, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 24, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 25; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 26, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 28;
[0363] (d) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 33, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 34, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 35; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 37, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 38;
[0364] (e) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 43, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 44, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 45; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 46, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 47, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 48;
[0365] (f) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 53, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 54, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 55; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 56, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 57, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 58;
[0366] (g) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 63, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 64, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 65; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 66, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 68;
[0367] (h) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 73, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 74, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 75; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 76, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 77, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 78;
[0368] (i) heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 83, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 84, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 85; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 86, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 87, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 88;
[0369] (j) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 93, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 94, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 95; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 96, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 97, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 98;
[0370] (k) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 103, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 104, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 105; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 106, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 107, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 108;
[0371] (l) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 113, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 114, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 115; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 116, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 117, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 118;
[0372] (m) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 123, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 124, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 125; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 126, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 127, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 128;
[0373] (n) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 133, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 134, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 135; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 136, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 137, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 138;
[0374] (o) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 143, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 144, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 145; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 146, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 147, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 148;
[0375] (p) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 153, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 154, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 155; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 156, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 157, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 158;
[0376] (q) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 163, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 164, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 165; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 166, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 167, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 168;
[0377] (r) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 173, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 174, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 175; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 176, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 177, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 178;
[0378] (s) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 183, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 184, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 185; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 186, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 187, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 188;
[0379] (t) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 193, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 194, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 195; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 196, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 197, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 198; or
[0380] (u) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 203, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 204, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 205; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 206, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 207, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 208.
[0381] 2. The antibody of embodiment 1, wherein the antibody comprises:
[0382] the CDRs of embodiment 1(a) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 9 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 10;
[0383] the CDRs of embodiment 1(b) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 19 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 20;
[0384] the CDRs of embodiment 1(c) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 29 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 30;
[0385] the CDRs of embodiment 1(d) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 39 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 40;
[0386] the CDRs of embodiment 1(e) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 49 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 50;
[0387] the CDRs of embodiment 1(f) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 59 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 60;
[0388] the CDRs of embodiment 1(g) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 69 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 70;
[0389] the CDRs of embodiment 1(h) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 79 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 80;
[0390] the CDRs of embodiment 1(i) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 89 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 90;
[0391] the CDRs of embodiment 1(j) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 99 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 100;
[0392] the CDRs of embodiment 1(k) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 109 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 110;
[0393] the CDRs of embodiment 1(l) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 119 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 120;
[0394] the CDRs of embodiment 1(m) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 129 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 130;
[0395] the CDRs of embodiment 1(n) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 139 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 140;
[0396] the CDRs of embodiment 1(o) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 149 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 150;
[0397] the CDRs of embodiment 1(p) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 159 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 160;
[0398] the CDRs of embodiment 1(q) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 169 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 170;
[0399] the CDRs of embodiment 1(r) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 179 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 180;
[0400] the CDRs of embodiment 1(s) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 189 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 190;
[0401] the CDRs of embodiment 1(t) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 199 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 200; or
[0402] the CDRs of embodiment 1(u) and further comprises a VH that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 209 and/or a VL that is at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 210.
[0403] 3. The antibody of embodiment 1 or 2, wherein the antibody comprises:
[0404] the CDRs of embodiment 1(a) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 9;
[0405] the CDRs of embodiment 1(b) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 19;
[0406] the CDRs of embodiment 1(c) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 29;
[0407] the CDRs of embodiment 1(d) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 39;
[0408] the CDRs of embodiment 1(e) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 49;
[0409] the CDRs of embodiment 1(f) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 59;
[0410] the CDRs of embodiment 1(g) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 69;
[0411] the CDRs of embodiment 1(h) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 79;
[0412] the CDRs of embodiment 1(i) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 89;
[0413] the CDRs of embodiment 1(j) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 99;
[0414] the CDRs of embodiment 1(k) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 109;
[0415] the CDRs of embodiment 1(l) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 119;
[0416] the CDRs of embodiment 1(m) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 129;
[0417] the CDRs of embodiment 1(n) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 139;
[0418] the CDRs of embodiment 1(o) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 149;
[0419] the CDRs of embodiment 1(p) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 159;
[0420] the CDRs of embodiment 1(q) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 169;
[0421] the CDRs of embodiment 1(r) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 179;
[0422] the CDRs of embodiment 1(s) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 189;
[0423] the CDRs of embodiment 1(t) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 199; or
[0424] the CDRs of embodiment 1(u) and further comprises a VH comprising the amino acid sequence of SEQ ID NO: 209.
[0425] 4. The antibody of embodiment 1 or 2, wherein the antibody comprises:
[0426] the CDRs of embodiment 1(a) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 10;
[0427] the CDRs of embodiment 1(b) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 20;
[0428] the CDRs of embodiment 1(c) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 30;
[0429] the CDRs of embodiment 1(d) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 40;
[0430] the CDRs of embodiment 1(e) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 50;
[0431] the CDRs of embodiment 1(f) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 60;
[0432] the CDRs of embodiment 1(g) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 70;
[0433] the CDRs of embodiment 1(h) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 80;
[0434] the CDRs of embodiment 1(i) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 90;
[0435] the CDRs of embodiment 1(j) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 100;
[0436] the CDRs of embodiment 1(k) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 110;
[0437] the CDRs of embodiment 1(l) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 120;
[0438] the CDRs of embodiment 1(m) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 130;
[0439] the CDRs of embodiment 1(n) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 140;
[0440] the CDRs of embodiment 1(o) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 150;
[0441] the CDRs of embodiment 1(p) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 160;
[0442] the CDRs of embodiment 1(q) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 170;
[0443] the CDRs of embodiment 1(r) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 180;
[0444] the CDRs of embodiment 1(s) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 190;
[0445] the CDRs of embodiment 1(t) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 200; or
[0446] the CDRs of embodiment 1(u) and further comprises a VL comprising the amino acid sequence of SEQ ID NO: 210.
[0447] 5. The antibody of embodiment 1 or 2, wherein the antibody comprises:
[0448] a VH comprising the amino acid sequence of SEQ ID NO: 9 and a VL comprising the amino acid sequence of SEQ ID NO: 10;
[0449] a VH comprising the amino acid sequence of SEQ ID NO: 19 and a VL comprising the amino acid sequence of SEQ ID NO: 20;
[0450] a VH comprising the amino acid sequence of SEQ ID NO: 29 and a VL comprising the amino acid sequence of SEQ ID NO: 30;
[0451] a VH comprising the amino acid sequence of SEQ ID NO: 39 and a VL comprising the amino acid sequence of SEQ ID NO: 40;
[0452] a VH comprising the amino acid sequence of SEQ ID NO: 49 and a VL comprising the amino acid sequence of SEQ ID NO: 50;
[0453] a VH comprising the amino acid sequence of SEQ ID NO: 59 and a VL comprising the amino acid sequence of SEQ ID NO: 60;
[0454] a VH comprising the amino acid sequence of SEQ ID NO: 69 and a VL comprising the amino acid sequence of SEQ ID NO: 70;
[0455] a VH comprising the amino acid sequence of SEQ ID NO: 79 and a VL comprising the amino acid sequence of SEQ ID NO: 80;
[0456] a VH comprising the amino acid sequence of SEQ ID NO: 89 and a VL comprising the amino acid sequence of SEQ ID NO: 90;
[0457] a VH comprising the amino acid sequence of SEQ ID NO: 99 and a VL comprising the amino acid sequence of SEQ ID NO: 100;
[0458] a VH comprising the amino acid sequence of SEQ ID NO: 109 and a VL comprising the amino acid sequence of SEQ ID NO: 110;
[0459] a VH comprising the amino acid sequence of SEQ ID NO: 119 and a VL comprising the amino acid sequence of SEQ ID NO: 120;
[0460] a VH comprising the amino acid sequence of SEQ ID NO: 129 and a VL comprising the amino acid sequence of SEQ ID NO: 130;
[0461] a VH comprising the amino acid sequence of SEQ ID NO: 139 and a VL comprising the amino acid sequence of SEQ ID NO: 140;
[0462] a VH comprising the amino acid sequence of SEQ ID NO: 149 and a VL comprising the amino acid sequence of SEQ ID NO: 150;
[0463] a VH comprising the amino acid sequence of SEQ ID NO: 159 and a VL comprising the amino acid sequence of SEQ ID NO: 160;
[0464] a VH comprising the amino acid sequence of SEQ ID NO: 169 and a VL comprising the amino acid sequence of SEQ ID NO: 170;
[0465] a VH comprising the amino acid sequence of SEQ ID NO: 179 and a VL comprising the amino acid sequence of SEQ ID NO: 180;
[0466] a VH comprising the amino acid sequence of SEQ ID NO: 189 and a VL comprising the amino acid sequence of SEQ ID NO: 190;
[0467] a VH comprising the amino acid sequence of SEQ ID NO: 199 and a VL comprising the amino acid sequence of SEQ ID NO: 200; or
[0468] a VH comprising the amino acid sequence of SEQ ID NO: 209 and a VL comprising the amino acid sequence of SEQ ID NO: 210.
[0469] 6. The antibody of any one of embodiments 1-5, wherein the antibody comprises:
[0470] the CDRs of embodiment 1(a) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 11 and/or a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 12;
[0471] the CDRs of embodiment 1(b) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 21 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 22;
[0472] the CDRs of embodiment 1(c) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 31 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 32;
[0473] the CDRs of embodiment 1(d) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 41 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 42;
[0474] the CDRs of embodiment 1(e) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 51 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 52;
[0475] the CDRs of embodiment 1(f) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 61 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 62;
[0476] the CDRs of embodiment 1(g) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 71 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 72;
[0477] the CDRs of embodiment 1(h) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 81 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 82;
[0478] the CDRs of embodiment 1(i) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 91 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 92;
[0479] the CDRs of embodiment 1(j) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 101 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 102;
[0480] the CDRs of embodiment 1(k) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 111 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 112;
[0481] the CDRs of embodiment 1(l) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 121 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 122;
[0482] the CDRs of embodiment 1(m) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 131 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 132;
[0483] the CDRs of embodiment 1(n) and further comprises a heavy chain (HC) comprising an the SEQ ID NO: 141 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 142;
[0484] the CDRs of embodiment 1(o) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 151 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 152;
[0485] the CDRs of embodiment 1(p) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 161 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 162;
[0486] the CDRs of embodiment 1(q) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 171 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 172;
[0487] the CDRs of embodiment 1(r) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 181 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 182;
[0488] the CDRs of embodiment 1(s) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 191 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 192;
[0489] the CDRs of embodiment 1(t) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 201 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 202; or
[0490] the CDRs of embodiment 1(u) and further comprises a heavy chain (HC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 211 and a light chain (LC) comprising an amino acid sequence at least 90%, at least 95%, at least 97%, or at least 99% identical to the SEQ ID NO: 212.
[0491] 7. The antibody of embodiment 1, wherein the antibody comprises:
[0492] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 11 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 12;
[0493] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 21 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 22;
[0494] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 31 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 32;
[0495] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 41 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 42;
[0496] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 51 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 52;
[0497] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 61 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 62;
[0498] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 71 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 72;
[0499] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 81 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 82;
[0500] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 91 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 92;
[0501] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 101 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 102;
[0502] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 111 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 112;
[0503] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 121 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 122;
[0504] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 131 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 132;
[0505] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 141 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 142;
[0506] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 151 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 152;
[0507] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 161 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 162;
[0508] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 171 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 172;
[0509] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 181 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 182;
[0510] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 191 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 192;
[0511] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 201 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 202; or
[0512] a heavy chain (HC) comprising the amino acid sequence of SEQ ID NO: 211 and a light chain (LC) comprising the amino acid sequence of SEQ ID NO: 212.
[0513] 8. An isolated antibody that specifically binds to apolipoprotein L1 (APOL1), wherein the antibody:
[0514] specifically binds to a region of APOL1 corresponding to amino acids 61-103 of APOL1 G0 (SEQ ID NO: 2); and/or
[0515] specifically binds to a region of APOL1 corresponding to amino acids 111-150 of APOL1 G0 (SEQ ID NO: 2); and further
[0516] wherein the antibody preferentially recognizes APOL1 expressed on podocytes over APOL1 found in serum.
[0517] 9. The antibody of embodiment 8, wherein the antibody comprises:
[0518] (a) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 173, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 174, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 175; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 176, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 177, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 178; or
[0519] (b) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 183, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 184, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 185; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 186, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 187, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 188.
[0520] 10. An isolated antibody that specifically binds to apolipoprotein L1 (APOL1), wherein the antibody:
[0521] specifically binds to a region of APOL1 corresponding to amino acids 103-111 of APOL1 G0 (SEQ ID NO: 2);
[0522] specifically binds to a region of APOL1 corresponding to amino acids 150-172 of APOL1 G0 (SEQ ID NO: 2);
[0523] specifically binds to a region of APOL1 corresponding to amino acids 314-333 of APOL1 G0 (SEQ ID NO: 2); and/or
[0524] specifically binds to a region of APOL1 corresponding to amino acids 376-398 of APOL1 G0 (SEQ ID NO: 2); and further
[0525] wherein the antibody recognizes both APOL1 expressed on podocytes and APOL1 found in serum.
[0526] 11. The isolated antibody of embodiment 10, wherein the antibody comprises:
[0527] (a) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 3, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 4, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 5; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 6, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 7, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 8;
[0528] (b) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 53, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 54, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 55; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 56, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 57, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 58;
[0529] (c) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 63, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 64, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 65; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 66, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 67, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 68;
[0530] (d) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 83, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 84, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 85; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 86, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 87, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 88;
[0531] (e) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 73, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 74, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 75; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 76, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 77, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 78;
[0532] (f) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 133, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 134, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 135; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 136, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 137, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 138;
[0533] (g) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 143, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 144, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 145; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 146, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 147, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 148; or
[0534] (h) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 123, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 124, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 125; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 126, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 127, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 128.
[0535] 12. An isolated antibody that specifically binds to apolipoprotein L1 (APOL1), wherein the antibody:
[0536] specifically binds to a region of APOL1 corresponding to amino acids 260-314 of APOL1 G0 (SEQ ID NO: 2); and further
[0537] wherein the antibody preferentially recognizes APOL1 found in serum over APOL1 expressed on podocytes.
[0538] 13. The antibody of embodiment 12, wherein the antibody comprises:
[0539] (a) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 33, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 34, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 35; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 36, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 37, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 38; or
[0540] (b) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 43, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 44, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 45; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 46, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 47, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 48.
[0541] 14. An isolated antibody that specifically binds to apolipoprotein L1 (APOL1), wherein the antibody preferentially binds to the G0 and G1 forms of APOL1 over the G2 form of APOL1.
[0542] 15. The antibody of embodiment 14, wherein the antibody comprises:
[0543] (a) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 143, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 144, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 145; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 146, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 147, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 148;
[0544] (b) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 123, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 124, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 125; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 126, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 127, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 128; or
[0545] (c) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 133, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 134, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 135; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 136, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 137, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 138;
[0546] 16. An isolated antibody that specifically binds to apolipoprotein L1 (APOL1) and that (a) does not significantly bind to apolipoprotein L2 or L3 (APOL2 or APOL3), and/or (b) does not significantly bind to apolipoprotein L2 or L6 (APOL2 or APOL6), wherein the antibody comprises:
[0547] (a) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 163, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 164, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 165; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 166, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 167, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 168;
[0548] (b) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 103, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 104, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 105; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 106, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 107, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 108; or
[0549] (c) a heavy chain variable region (VH) comprising a CDR-H1 comprising the amino acid sequence of SEQ ID NO: 23, a CDR-H2 comprising the amino acid sequence of SEQ ID NO: 24, and a CDR-H3 comprising the amino acid sequence of SEQ ID NO: 25; and a light chain variable region (VL) comprising a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 26, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 27, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 28.
[0550] 17. The antibody of any one of embodiments 1 to 5 or 8 to 16, wherein the antibody is humanized or chimeric.
[0551] 18. The antibody of any one of embodiments 1 to 5 or 8 to 16, which is an IgG antibody, such as an IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4.
[0552] 19. The antibody of any one of embodiments 1 to 18, which is a full length antibody.
[0553] 20. The antibody of any one of embodiments 1 to 5 or 8 to 16, which is an antibody fragment, such as an Fv, single-chain Fv (scFv), Fab, Fab′, or (Fab′).sub.2.
[0554] 21. The antibody of any one of embodiments 1 to 20, which is a bispecific or multispecific antibody or wherein the antibody is conjugated covalently or noncovalently to at least one other molecule.
[0555] 22. The antibody of embodiment 21, wherein the antibody is conjugated covalently or noncovalently to at least one other molecule, wherein the at least one other molecule comprises a detection label and/or a pharmaceutical agent.
[0556] 23. The antibody of any one of embodiments 1-22, wherein the antibody specifically binds to a polypeptide comprising the amino acid sequence of SEQ ID NO: 2, SEQ ID NO: 213, and/or SEQ ID NO: 214.
[0557] In a further aspect, an anti-APOL1 antibody herein may incorporate any of the features, singly or in combination, as described in Sections 1-6 further below. Certain antibodies according to this disclosure are further described in more detail in the sub-sections that directly follow.
[0558] Antibody 3.6D12
[0559] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 3.6D12 antibody, comprising SEQ ID NOS: 3, 4, and 5. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 3.6D12 antibody, comprising SEQ ID NOS: 6, 7, and 8. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 3.6D12, comprising SEQ ID NOS: 3, 4, 5, 6, 7, and 8.
[0560] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or the light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 9. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 10. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 9, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 10. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 9, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 9. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 10. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 9 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 9 and/or SEQ ID NO: 10.
[0561] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 9 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 10. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or the light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 11. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 12. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 11, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 12. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 11. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 12. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 11, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 11. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 3, 4, and 5, and/or light chain CDRs of SEQ ID NOS: 6, 7, and 8, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 12, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 12. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 11 and a light chain comprising the amino acid sequence of SEQ ID NO: 12, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 11 and/or SEQ ID NO: 12.
[0562] In some aspects, the antibody recognizes the PFD portion of APOL1. In some aspects, the antibody recognizes the PFD portion from amino acids 103-111. In some aspects, the antibody recognizes both podocyte APOL1 and serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody recognizes APOL1 on wild-type podocytes, for example, as measured by flow cytometry as described in the Examples herein. In some aspects, the antibody both blocks trypanolysis and recognizes APOL1 on wild-type podocytes, for example indicating that it binds to APOL1 located both on podocytes and in serum. In some aspects, the antibody recognizes APOL2, APOL3 and APOL4, but not APOL6 and thus may be used to distinguish APOL6 from the other family members.
[0563] Antibody 3.3B6
[0564] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 3.3B6 antibody, comprising SEQ ID NOS: 13, 14, and 15. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 3.3B6 antibody, comprising SEQ ID NOS: 16, 17, and 18. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 3.3B6, comprising SEQ ID NOS: 13, 14, 15, 16, 17, and 18.
[0565] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or the light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 19. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 20. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 19, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, SEQ ID NO: 20. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 19. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 20. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 19, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 19. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 20, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 20. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 19 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 20, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 19 and/or SEQ ID NO: 20.
[0566] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 19 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 20. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or the light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 21. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 22. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 21, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 22. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 21. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 22. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 21, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 21. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 13, 14, and 15, and/or light chain CDRs of SEQ ID NOS: 16, 17, and 18, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 22, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 22. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 21 and a light chain comprising the amino acid sequence of SEQ ID NO: 22, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 21 and/or SEQ ID NO: 22.
[0567] In some aspects, the antibody recognizes the PFD portion of APOL1. In some aspects, the antibody recognizes both podocyte APOL1 and serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody recognizes APOL1 on wild-type podocytes, for example, as measured by flow cytometry as described in the Examples herein. In some aspects, the antibody both blocks trypanolysis and recognizes APOL1 on wild-type podocytes, for example indicating that it binds to APOL1 located both on podocytes and in serum.
[0568] Antibody 3.7D6
[0569] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 3.7D6 antibody, comprising SEQ ID NOS: 23, 24, and 25. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 3.7D6 antibody, comprising SEQ ID NOS: 26, 27, and 28. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 3.7D6, comprising SEQ ID NOS: 23, 324, 25, 26, 27, and 28.
[0570] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or the light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 29. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 30. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 29, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 30. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 29. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 29, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 29. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 30. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 29 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 29 and/or SEQ ID NO: 30.
[0571] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 29 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 30. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or the light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 31. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 32. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 31, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 32. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 31. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 32. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 31, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 31. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 23, 24, and 25, and/or light chain CDRs of SEQ ID NOS: 26, 27, and 28, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 32, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 32. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 31 and a light chain comprising the amino acid sequence of SEQ ID NO: 32, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 31 and/or SEQ ID NO: 32.
[0572] In some aspects, the antibody recognizes the PFD portion of APOL1. In some aspects, the antibody recognizes the PFD portion from amino acids 150-172. In some aspects, the antibody recognizes both podocyte APOL1 and serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody recognizes APOL1 on wild-type podocytes, for example, as measured by flow cytometry as described in the Examples herein. In some aspects, the antibody both blocks trypanolysis and recognizes APOL1 on wild-type podocytes, for example indicating that it binds to APOL1 located both on podocytes and in serum. In some aspects, the antibody does not recognize any of the other APOL family members and is specific to APOL1.
[0573] Antibody 3.3A8
[0574] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 3.3A8 antibody, comprising SEQ ID NOS: 33, 34, and 35. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 3.3A8 antibody, comprising SEQ ID NOS: 36, 37, and 38. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 3.3A8, comprising SEQ ID NOS: 33, 34, 35, 36, 37, and 38.
[0575] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or the light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 39. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 40. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 39, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 40. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 39. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 40. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 39, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 39. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 40, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 40. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 39 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 40, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 39 and/or SEQ ID NO: 40.
[0576] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 39 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 40. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or the light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 41. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 42. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 41, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 42. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 41. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 42. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 41, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 41. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 33, 34, and 35, and/or light chain CDRs of SEQ ID NOS: 36, 37, and 38, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 42, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 42. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 41 and a light chain comprising the amino acid sequence of SEQ ID NO: 42, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 41 and/or SEQ ID NO: 42.
[0577] In some aspects, the 3.3A8 antibody recognizes the MAD portion of APOL1. In some aspects, the antibody recognizes the MAD portion from amino acids 260-294. In some aspects, the antibody preferentially recognizes serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody does not significantly recognize APOL1 on wild-type podocytes, for example, as measured by flow cytometry as described in the Examples herein, but does recognize APOL1 stably expressed in CHO cells. In some aspects, the antibody does not recognize APOL2-6.
[0578] Antibody 3.2C11
[0579] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 3.2C11 antibody, comprising SEQ ID NOS: 43, 44, and 45. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 3.2C11 antibody, comprising SEQ ID NOS: 46, 47, and 48. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 3.2C11, comprising SEQ ID NOS: 43, 44, 45, 46, 47, and 48.
[0580] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or the light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 49. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 50. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 49, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 50. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 49. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 50. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 49, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 49. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 50, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 50. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 49 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 50, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 49 and/or SEQ ID NO: 50.
[0581] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 49 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 50. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or the light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 51. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 52. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 51, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 52. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 51. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 52. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 51, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 51. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 43, 44, and 45, and/or light chain CDRs of SEQ ID NOS: 46, 47, and 48, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 52, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 52. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 51 and a light chain comprising the amino acid sequence of SEQ ID NO: 52, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 51 and/or SEQ ID NO: 52.
[0582] In some aspects, the antibody recognizes the junction between the MAD and Linker (L) portion of APOL1. In some aspects, the antibody recognizes the L portion from amino acids 294-314. In some aspects, the antibody preferentially recognizes serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody does not significantly recognize APOL1 on wild-type podocytes, for example, as measured by flow cytometry as described in the Examples herein.
[0583] Antibody 3.1C1
[0584] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 3.1C1 antibody, comprising SEQ ID NOS: 53, 54, and 55. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 3.1C1 antibody, comprising SEQ ID NOS: 56, 57, and 58. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 3.1C1, comprising SEQ ID NOS: 53, 54, 55, 56, 57, and 58.
[0585] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or the light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 59. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 60. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 59, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 60. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 59. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 60. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 59, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 59. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 60, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 60. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 59 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 60, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 59 and/or SEQ ID NO: 60.
[0586] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 59 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 60. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or the light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 61. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 62. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 61, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 62. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 61. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 62. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 61, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 61. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 53, 54, and 55, and/or light chain CDRs of SEQ ID NOS: 56, 57, and 58, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 62, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 62. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 61 and a light chain comprising the amino acid sequence of SEQ ID NO: 62, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 61 and/or SEQ ID NO: 62.
[0587] In some aspects, the antibody recognizes the Linker (L) portion of APOL1. In some aspects, the antibody recognizes the L portion from amino acids 314-333. In some aspects, the antibody preferentially recognizes serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody does not significantly recognize APOL1 on wild-type podocytes, for example, as measured by flow cytometry as described in the Examples herein. In some aspects, the antibody does not recognize APOLs 2, 3, 4, or 6.
[0588] Antibody 3.1C7
[0589] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 3.7C1 antibody, comprising SEQ ID NOS: 63, 64, and 65. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 3.7C1 antibody, comprising SEQ ID NOS: 66, 67, and 68. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 3.7C1, comprising SEQ ID NOS: 63, 64, 65, 66, 67, and 68.
[0590] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or the light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 69. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 70. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 69, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 70. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 69. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 70. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 69, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 69. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 70, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 70. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 69 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 70, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 69 and/or SEQ ID NO: 70.
[0591] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 69 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 70. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or the light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 71. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 72. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 71, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 72. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 71. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 72. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 71, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 71. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 63, 64, and 65, and/or light chain CDRs of SEQ ID NOS: 66, 67, and 68, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 72, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 72. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 71 and a light chain comprising the amino acid sequence of SEQ ID NO: 72, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 71 and/or SEQ ID NO: 72.
[0592] In some aspects, the antibody recognizes the Linker (L) portion of APOL1. In some aspects, the antibody recognizes the L portion from amino acids 314-333. In some aspects, the antibody preferentially recognizes serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody does not significantly recognize APOL1 on wild-type podocytes, for example, as measured by flow cytometry as described in the Examples herein.
[0593] Antibody 3.4G10
[0594] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 3.4G10 antibody, comprising SEQ ID NOS: 73, 74, and 75. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 3.4G10 antibody, comprising SEQ ID NOS: 76, 77, and 78. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 3.4G10, comprising SEQ ID NOS: 73, 74, 75, 76, 77, and 78.
[0595] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or the light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 79. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 80. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 79, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 80. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 79. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 80. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 79, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 79. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 80, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 80. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 79 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 80, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 79 and/or SEQ ID NO: 80.
[0596] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 79 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 80. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or the light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 81. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 82. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 81, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 82. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 81. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 82. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 81, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 81. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 73, 74, and 75, and/or light chain CDRs of SEQ ID NOS: 76, 77, and 78, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 82, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 82. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 81 and a light chain comprising the amino acid sequence of SEQ ID NO: 82, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 81 and/or SEQ ID NO: 82.
[0597] In some aspects, the antibody recognizes the Linker (L) portion of APOL1. In some aspects, the antibody recognizes the L portion from amino acids 324-343. In some aspects, the antibody preferentially recognizes serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody does not significantly recognize APOL1 that is overexpressed on wild-type podocytes, for example, as measured by flow cytometry as described in the Examples herein.
[0598] Antibody 3.6E10
[0599] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 3.6E10 antibody, comprising SEQ ID NOS: 83, 84, and 85. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 3.6E10 antibody, comprising SEQ ID NOS: 86, 87, and 88. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 3.6E10, comprising SEQ ID NOS: 83, 84, 85, 86, 87, and 88.
[0600] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or the light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 89. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 90. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 89, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 90. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 89. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 90. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 89, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 89. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 90, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 90. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 89 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 90, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 89 and/or SEQ ID NO: 90.
[0601] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 89 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 90. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or the light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 91. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 92. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 91, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 92. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 91. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 92. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 91, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 91. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 83, 84, and 85, and/or light chain CDRs of SEQ ID NOS: 86, 87, and 88, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 92, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 92. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 91 and a light chain comprising the amino acid sequence of SEQ ID NO: 92, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 91 and/or SEQ ID NO: 92.
[0602] In some aspects, the antibody recognizes the Linker (L) portion of APOL1. In some aspects, the antibody recognizes the L portion from amino acids 314-333. In some aspects, the antibody preferentially recognizes serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody does not significantly recognize APOL1 on wild-type podocytes, for example, as measured by flow cytometry as described in the Examples herein.
[0603] Antibody 3.3F7
[0604] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 3.3F7 antibody, comprising SEQ ID NOS: 93, 94, and 95. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 3.3F7 antibody, comprising SEQ ID NOS: 96, 97, and 98. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 3.3F7, comprising SEQ ID NOS: 93, 94, and 95, 96, 97, and 98.
[0605] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or the light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 99. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 100. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 99, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 100. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 99. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 100. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 99, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 99. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 100, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 100. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 99 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 100, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 99 and/or SEQ ID NO: 100.
[0606] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 99 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 100. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or the light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 101. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 102. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 101, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 102. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 101. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 102. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 101, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 101. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 93, 94, and 95, and/or light chain CDRs of SEQ ID NOS: 96, 97, and 98, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 102, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 102. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 101 and a light chain comprising the amino acid sequence of SEQ ID NO: 102, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 101 and/or SEQ ID NO: 102.
[0607] In some aspects, the antibody preferentially recognizes native APOL1, since it recognizes full length (e.g. SEQ ID NO: 2) but not any individual domains by flow cytometry as shown in
[0608] Antibody 3.7F5
[0609] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 3.7F5 antibody, comprising SEQ ID NOS: 203, 204, and 205. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 3.7F5 antibody, comprising SEQ ID NOS: 206, 207, and 208. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 3.7F5, comprising SEQ ID NOS: 203, 204, 205, 206, 207, and 208.
[0610] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or the light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 209. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 210. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 209, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 210. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 209. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 210. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 209, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 209. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 210, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 210. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 209 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 210, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 209 and/or SEQ ID NO: 210.
[0611] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 209 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 210. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or the light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 211. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 212. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 211, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 212. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 211. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 212. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 211, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 211. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 203, 204, and 205, and/or light chain CDRs of SEQ ID NOS: 206, 207, and 208, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 212, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 212. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 211 and a light chain comprising the amino acid sequence of SEQ ID NO: 212, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 211 and/or SEQ ID NO: 212.
[0612] In some aspects, the antibody preferentially recognizes native APOL1, since it recognizes full length APOL1 (e.g. SEQ ID NO: 2) but not any individual domains (similar to 3.3F7 shown in
[0613] Antibody 4.17A5
[0614] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 4.17A5 antibody, comprising SEQ ID NOS: 103, 104, and 105. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 4.17A5 antibody, comprising SEQ ID NOS: 106, 107, and 108. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 4.17A5, comprising SEQ ID NOS: 103, 104, 105, 106, 107, and 108.
[0615] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or the light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 109. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 110. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 109, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 110. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 109. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 110. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 109, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 109. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 110, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 110. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 109 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 110, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 109 and/or SEQ ID NO: 110.
[0616] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 109 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 110. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or the light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 111. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 112. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 111, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 112. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 111. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 112. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 111, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 111. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 103, 104, and 105, and/or light chain CDRs of SEQ ID NOS: 106, 107, and 108, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 112, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 112. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 111 and a light chain comprising the amino acid sequence of SEQ ID NO: 112, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 111 and/or SEQ ID NO: 112.
[0617] In some aspects, the antibody recognizes the PFD portion of APOL1. In some aspects, the antibody recognizes the PFD portion from amino acids 150-172. In some aspects, the antibody preferentially recognizes serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody does not significantly recognize APOL1 on wild-type podocytes, for example, as measured by flow cytometry as described in the Examples herein. In some aspects, the antibody does not significantly recognize APOL2. In some aspects, the antibody recognizes APOL4. In some aspects, the antibody does not significantly recognize any of APOL2, APOL3, or APOL6. Thus, in some aspects, the antibody may be used to distinguish APOL1 and/or APOL4 from other related proteins such as APOL2, APOL3, and/or APOL6.
[0618] Antibody 4.2C4
[0619] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 4.2C4 antibody, comprising SEQ ID NOS: 113, 114, and 115. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 4.2C4 antibody, comprising SEQ ID NOS: 116, 117, and 118. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 4.2C4, comprising SEQ ID NOS: 113, 114, 115, 116, 117, and 118.
[0620] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or the light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 119. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 120. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 119, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 120. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 119. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 120. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 119, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 119. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 120, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 120. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 119 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 120, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 119 and/or SEQ ID NO: 120.
[0621] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 119 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 120. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or the light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 121. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 122. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 121, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 122. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 121. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 122. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 121, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 121. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 113, 114, and 115, and/or light chain CDRs of SEQ ID NOS: 116, 117, and 118, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 122, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 122. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 121 and a light chain comprising the amino acid sequence of SEQ ID NO: 122, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 121 and/or SEQ ID NO: 122.
[0622] Antibody 4.12E5
[0623] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 4.12E5 antibody, comprising SEQ ID NOS: 123, 124, and 125. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 4.12E5 antibody, comprising SEQ ID NOS: 126, 127, and 128. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 4.12E5, comprising SEQ ID NOS: 123, 124, 15, 126, 127, and 128.
[0624] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or the light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 129. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 130. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 129, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 130. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 129. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 130. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 129, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 129. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 130, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 130. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 129 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 130, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 129 and/or SEQ ID NO: 130.
[0625] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 129 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 130. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or the light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 131. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 132. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 131, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 132. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 131. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 132. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 131, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 131. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 123, 124, and 125, and/or light chain CDRs of SEQ ID NOS: 126, 127, and 128, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 132, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 132. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 131 and a light chain comprising the amino acid sequence of SEQ ID NO: 132, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 131 and/or SEQ ID NO: 132.
[0626] In some aspects, the antibody recognizes the SRA-ID portion of APOL1, such as the portion from amino acids 376-398. In some aspects, the antibody preferentially recognizes serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody preferentially recognizes the G0 and G1 forms of APOL1 over the G2 form. Thus, in some aspects, the antibody can distinguish the G0 and G1 forms from the G2 form.
[0627] Antibody 4.11A10
[0628] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 4.11A10 antibody, comprising SEQ ID NOS: 133, 134, and 135. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 4.11A10 antibody, comprising SEQ ID NOS: 136, 137, and 138. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 4.11A10, comprising SEQ ID NOS: 133, 134, 135, 136, 137, and 138.
[0629] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or the light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 139. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 140. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 139, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 140. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 139. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 140. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 139, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 139. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 140, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 140. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 139 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 140, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 139 and/or SEQ ID NO: 140.
[0630] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 139 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 140. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or the light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 141. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 142. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 141, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 142. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 141. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 142. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 141, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 141. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 133, 134, and 135, and/or light chain CDRs of SEQ ID NOS: 136, 137, and 138, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 142, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 142. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 141 and a light chain comprising the amino acid sequence of SEQ ID NO: 142, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 141 and/or SEQ ID NO: 142.
[0631] In some aspects, the antibody recognizes the SRA-ID portion of APOL1. In some aspects, the antibody recognizes the SRA-ID portion from amino acids 376-398. In some aspects, the antibody preferentially recognizes serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 60% in such an assay. In some aspects, the antibody preferentially recognizes the G0 and G1 forms of APOL1 over the G2 form. Thus, in some aspects, the antibody can distinguish the G0 and G1 forms from the G2 form.
[0632] Antibody 4.11H11
[0633] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 4.11H11 antibody, comprising SEQ ID NOS: 143, 144, and 145. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 4.11H11 antibody, comprising SEQ ID NOS: 146, 147, and 148. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 4.11H11, comprising SEQ ID NOS: 13, 14, 15, 146, 147, and 148.
[0634] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or the light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 149. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 150. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 149, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 150. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 149. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 150. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 149, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 149. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 150, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 150. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 149 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 150, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 149 and/or SEQ ID NO: 150.
[0635] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 149 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 150. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or the light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, SEQ ID NO: 151. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 152. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 151, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 152. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 151. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 152. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 151, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 151. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 143, 144, and 145, and/or light chain CDRs of SEQ ID NOS: 146, 147, and 148, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 152, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 152. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 151 and a light chain comprising the amino acid sequence of SEQ ID NO: 152, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 151 and/or SEQ ID NO: 152.
[0636] In some aspects, the antibody recognizes the SRA-ID portion of APOL1, such as the portion from amino acids 376-398. In some aspects, the antibody preferentially recognizes the G0 and G1 forms of APOL1 over the G2 form. Thus, in some aspects, the antibody can distinguish the G0 and G1 forms from the G2 form.
[0637] Antibody 4.29C4
[0638] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 4.29C4 antibody, comprising SEQ ID NOS: 153, 154, and 155. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 4.29C4 antibody, comprising SEQ ID NOS: 156, 157, and 158. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 4.29C4, comprising SEQ ID NOS: 153, 154, 155, 156, 157, and 158.
[0639] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or the light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 159. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 160. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 159, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 160. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 159. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 160. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 159, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 159. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 160, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 160. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 159 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 160, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 159 and/or SEQ ID NO: 160.
[0640] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 159 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 160. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or the light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 161. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 162. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 161, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 162. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 161. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 162. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 161, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 161. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 153, 154, and 155, and/or light chain CDRs of SEQ ID NOS: 156, 157, and 158, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 162, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 162. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 161 and a light chain comprising the amino acid sequence of SEQ ID NO: 162, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 161 and/or SEQ ID NO: 162.
[0641] In some aspects, the antibody recognizes the SRA-ID portion of APOL1. In some aspects, the antibody recognizes the SRA-ID portion from amino acids 364-376. Those amino acids appear to be relatively inaccessible in both podocyte-expressed APOL1 and serum APOL1. Accordingly, in some aspects, the antibody does not significantly recognize either podocyte-expressed APOL1 or serum APOL1.
[0642] Antibody 5.17D12
[0643] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 5.17D12 antibody, comprising SEQ ID NOS: 163, 164, and 165. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 5.17D12 antibody, comprising SEQ ID NOS: 166, 167, and 168. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 5.17D12, comprising SEQ ID NOS: 163, 164, 165, 166, 167, and 168.
[0644] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or the light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 169. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 170. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 169, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 170. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 169. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 170. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 169, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 169. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 170, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 170. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 169 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 170, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 169 and/or SEQ ID NO: 170.
[0645] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 169 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 170. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or the light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 171. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 172. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 171, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 172. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 171. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 172. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 171, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 171. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 163, 164, and 165, and/or light chain CDRs of SEQ ID NOS: 166, 167, and 168, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 172, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 172. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 171 and a light chain comprising the amino acid sequence of SEQ ID NO: 172, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 171 and/or SEQ ID NO: 172.
[0646] In some aspects, the antibody recognizes the PFD portion of APOL1. In some aspects, the antibody recognizes wild-type APOL1 on the surface of podocytes. In some aspects, the antibody recognizes serum APOL1. In some aspects, the antibody blocks trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by at least 40% in such an assay. In some aspects, the antibody binds endogenous APOL1 on podocyte cells, such as by flow cytometry. In some aspects, the antibody does not significantly recognize APOL2. In some aspects, the antibody does not significantly recognize any of APOL2, APOL3, APOL4, or APOL6. Thus, in some aspects, the antibody may be used to distinguish APOL1 from other related proteins such as APOL2, APOL3, APOL4, and/or APOL6.
[0647] Antibody 5.17H8
[0648] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 5.17H8 antibody, comprising SEQ ID NOS: 173, 174, and 175. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 5.17H8 antibody, comprising SEQ ID NOS: 176, 177, and 178. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 5.17H8, comprising SEQ ID NOS: 173, 174, 175, 176, 177, and 178.
[0649] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or the light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 179. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 180. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 179, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 180. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 179. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 180. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 179, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 179. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 180, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 180. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 179 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 180, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 179 and/or SEQ ID NO: 180.
[0650] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 179 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 180. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or the light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 181. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 182. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 181, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 182. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 181. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 182. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 181, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 181. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 173, 174, and 175, and/or light chain CDRs of SEQ ID NOS: 176, 177, and 178, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 182, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 182. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 181 and a light chain comprising the amino acid sequence of SEQ ID NO: 182, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 181 and/or SEQ ID NO: 182.
[0651] In some aspects, the antibody recognizes the PFD portion of APOL1. In some aspects, the antibody recognizes the PFD portion from amino acids 61-103. In some aspects, the antibody preferentially recognizes podocyte APOL1, for example by flow cytometry. In some aspects, the antibody specifically binds to wild-type APOL1 expressed on podocyte cells. In some aspects, the antibody does not significantly block trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by less than 20% in such an assay. Thus, in some aspects, the antibody may be used to distinguish podocyte APOL1 from serum APOL1. Additionally this antibody in some aspects recognizes APOL2, APOL3 and APOL4, but not APOL6 and thus can be used to distinguish APOL6 from the other family members.
[0652] Antibody 5.11H2
[0653] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 5.11H12 antibody, comprising SEQ ID NOS: 183, 184, and 185. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 5.11H12 antibody, comprising SEQ ID NOS: 186, 187, and 188. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 5.11H12, comprising SEQ ID NOS: 183, 184, 185, 186, 187, and 188.
[0654] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or the light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 189. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 190. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 189, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 190. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 189. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 190. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 189, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 189. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 190, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 190. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 189 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 190, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 189 and/or SEQ ID NO: 190.
[0655] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 189 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 190. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or the light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 191. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 192. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 191, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 192. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 191. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 192. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 191, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 191. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 183, 184, and 185, and/or light chain CDRs of SEQ ID NOS: 186, 187, and 188, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 192, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 192. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 191 and a light chain comprising the amino acid sequence of SEQ ID NO: 192, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 191 and/or SEQ ID NO: 192.
[0656] In some aspects, the antibody recognizes the PFD portion of APOL1. In some aspects, the antibody recognizes the PFD portion from amino acids 61-103. In some aspects, the antibody preferentially recognizes podocyte APOL1. In some aspects, the antibody specifically binds to wild-type APOL1 expressed on podocyte cells. In some aspects, the antibody does not significantly block trypanolysis in an assay as described in the Examples herein. For example, in some aspects, the antibody blocks trypanolysis by less than 20% or less than 10% in such an assay. Thus, in some aspects, the antibody may be used to distinguish podocyte APOL1 from serum APOL1.
[0657] 5.14D6 Antibody
[0658] In some aspects, the disclosure relates to an antibody comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises an amino acid sequence comprising the heavy chain CDRs of the 5.14D6 antibody, comprising SEQ ID NOS: 193, 194, and 195. In some embodiments, the antibody comprises a heavy chain variable region and a light chain variable region, wherein the light chain variable region comprises an amino acid sequence comprising the light chain CDRs of the 5.14D6 antibody, comprising SEQ ID NOS: 196, 197, and 198. In some embodiments, the antibody comprises the heavy chain and the light chain CDRs of 5.14D6, comprising SEQ ID NOS: 193, 194, 195, 196, 197, and 198.
[0659] In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or the light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 199. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 200. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a heavy chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 199, and a light chain variable region comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 200. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 199. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 200. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 199, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 199. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 200, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 200. In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 199 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 200, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 199 and/or SEQ ID NO: 200.
[0660] In some embodiments, the antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 199 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 200. In some embodiments, the antibody further comprises a heavy chain and/or a light chain constant region, for instance, as described in the section above. In some embodiments, the antibody comprises a human IgG constant region, such as a human IgG.sub.1, IgG.sub.2, IgG.sub.3, or IgG.sub.4. In other embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or the light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 201. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 202. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a heavy chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 201, and a light chain comprising an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 202. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 201. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 202. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 201, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the heavy chain framework regions of SEQ ID NO: 201. In some embodiments, the antibody comprises heavy chain CDRs of SEQ ID NOS: 193, 194, and 195, and/or light chain CDRs of SEQ ID NOS: 196, 197, and 198, and further comprises a light chain comprising the amino acid sequence of SEQ ID NO: 202, but with up to 5, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the light chain framework regions of SEQ ID NO: 202. In some embodiments, the antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 201 and a light chain comprising the amino acid sequence of SEQ ID NO: 202, but with up to 5 amino acid substitutions, insertions, or deletions, such as 1, 2, 3, 4, or 5 amino acid substitutions, insertions, or deletions, in the framework regions of SEQ ID NO: 201 and/or SEQ ID NO: 202.
[0661] In some aspects, the antibody recognizes the linker (L) portion of APOL1. In some aspects, the antibody recognizes APOL1 at residues 304-323. In some aspects, the antibody significantly blocks trypanolysis in an assay as described in the Examples herein. In some aspects, the antibody does not significantly recognize APOL1 on podocyte cells in assays described herein.
[0662] 1. Antibody Affinity
[0663] In certain aspects, an antibody provided herein specifically binds to APOL1, indicating that it has a dissociation constant (K.sub.D; affinity) of ≤1 μM for APOL1. In some aspects, the antibody may have an affinity for APOL1 of ≤100 nM or ≤10 nM.
[0664] In one aspect, K.sub.D can be measured using surface plasmon resonance. In one aspect, K.sub.D is measured using a BIACORE® surface plasmon resonance assay, such as a BIAcore™ T200 or BIAcore™ 8K assay. For example, an assay using a BIAcore™ 8K (BIAcore, Inc., Piscataway, N.J.) can be performed at 25° C. or 37° C. with immobilized antibody on a protein A chip at ˜300 response units (RU). Ten-fold serial dilutions of antigen are injected in FIBS-P buffer at 37° C. with a flow rate of 100 μL/min. Alternatively, ten-fold serial dilutions of antigen are injected in FIBS-P buffer at 25° C. with a flow rate of 30 μL/min. Association rates (ka) and dissociation rates (kd) are calculated using a 1:1 Langmuir binding model (for example, using BIAcore Insight Evaluation Software version 2.0). The equilibrium dissociation constant (KD) are calculated as the ratio kd/ka.
[0665] In an alternative method, K.sub.D is measured by a radiolabeled antigen binding assay (RIA). In one aspect, an RIA is performed with the Fab version of an antibody of interest and its antigen. For example, solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of (.sup.125I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al., J. Mol. Biol. 293:865-881(1999)). To establish conditions for the assay, MICROTITER® multi-well plates (Thermo Scientific) are coated overnight with 5 μg/ml of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23° C.). In a non-adsorbent plate (Nunc #269620), 100 μM or 26 μM [.sup.125I]-antigen are mixed with serial dilutions of a Fab of interest (e.g., consistent with assessment of the anti-VEGF antibody, Fab-12, in Presta et al., Cancer Res. 57:4593-4599 (1997)). The Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g., for one hour). The solution is then removed, and the plate washed eight times with 0.1% polysorbate 20 (TWEEN-20®) in PBS. When the plates have dried, 150 μl/well of scintillant (MICROSCINT-20™; Packard) is added, and the plates are counted on a TOPCOUNT™ gamma counter (Packard) for ten minutes. Concentrations of each Fab that give less than or equal to 20% of maximal binding are chosen for use in competitive binding assays.
[0666] 2. Antibody Fragments
[0667] In certain aspects, an antibody provided herein is an antibody fragment.
[0668] In one aspect, the antibody fragment is an Fv, single chain Fv, Fab, Fab′, Fab′-SH, or F(ab′).sub.2 fragment, in particular a Fab fragment. Papain digestion of intact antibodies produces two identical antigen-binding fragments, called “Fab” fragments containing each the heavy- and light-chain variable domains (VH and VL, respectively) and also the constant domain of the light chain (CL) and the first constant domain of the heavy chain (CH1). The term “Fab fragment” thus refers to an antibody fragment comprising a light chain comprising a VL domain and a CL domain, and a heavy chain fragment comprising a VH domain and a CH1 domain. “Fab′ fragments” differ from Fab fragments by the addition of residues at the carboxy terminus of the CH1 domain including one or more cysteines from the antibody hinge region. Fab′-SH are Fab′ fragments in which the cysteine residue(s) of the constant domains bear a free thiol group. Pepsin treatment yields an F(ab′).sub.2 fragment that has two antigen-binding sites (two Fab fragments) and a part of the Fc region. For discussion of Fab and F(ab′).sub.2 fragments comprising salvage receptor binding epitope residues and having increased in vivo half-life, see U.S. Pat. No. 5,869,046.
[0669] In another aspect, the antibody fragment is a diabody, a triabody or a tetrabody. “Diabodies” are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01161; Hudson et al., Nat. Med. 9:129-134 (2003); and Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993). Triabodies and tetrabodies are also described in Hudson et al., Nat. Med. 9:129-134 (2003).
[0670] In a further aspect, the antibody fragment is a single chain Fab fragment. A “single chain Fab fragment” or “scFab” is a polypeptide consisting of an antibody heavy chain variable domain (VH), an antibody heavy chain constant domain 1 (CH1), an antibody light chain variable domain (VL), an antibody light chain constant domain (CL) and a linker, wherein said antibody domains and said linker have one of the following orders in N-terminal to C-terminal direction: a) VH-CH1-linker-VL-CL, b) VL-CL-linker-VH-CH1, c) VH-CL-linker-VL-CH1 or d) VL-CH1-linker-VH-CL. In particular, said linker is a polypeptide of at least 30 amino acids, preferably between 32 and 50 amino acids. Said single chain Fab fragments are stabilized via the natural disulfide bond between the CL domain and the CH1 domain. In addition, these single chain Fab fragments might be further stabilized by generation of interchain disulfide bonds via insertion of cysteine residues (e.g., position 44 in the variable heavy chain and position 100 in the variable light chain according to Kabat numbering).
[0671] In another aspect, the antibody fragment is single-chain variable fragment (scFv). A “single-chain variable fragment” or “scFv” is a fusion protein of the variable domains of the heavy (VH) and light chains (VL) of an antibody, connected by a linker. In particular, the linker is a short polypeptide of 10 to 25 amino acids and is usually rich in glycine for flexibility, as well as serine or threonine for solubility, and can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa. This protein retains the specificity of the original antibody, despite removal of the constant regions and the introduction of the linker. For a review of scFv fragments, see, e.g., Plückthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York), pp. 269-315 (1994); see also WO 93/16185; and U.S. Pat. Nos. 5,571,894 and 5,587,458.
[0672] In another aspect, the antibody fragment is a single-domain antibody. “Single-domain antibodies” are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody. In certain aspects, a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, Mass.; see, e.g., U.S. Pat. No. 6,248,516 B1).
[0673] Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as recombinant production by recombinant host cells (e.g., E. coli), as described herein.
[0674] 3. Chimeric and Humanized Antibodies
[0675] In certain aspects, an antibody provided herein is a chimeric antibody. Certain chimeric antibodies are described, e.g., in U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). In one example, a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region. In a further example, a chimeric antibody is a “class switched” antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
[0676] In certain aspects, a chimeric antibody is a humanized antibody. Typically, a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. Generally, a humanized antibody comprises one or more variable domains in which the CDRs (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences. A humanized antibody optionally will also comprise at least a portion of a human constant region. In some aspects, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the CDR residues are derived), e.g., to restore or improve antibody specificity or affinity.
[0677] Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008), and are further described, e.g., in Riechmann et al., Nature 332:323-329 (1988); Queen et al., Proc. Nat'l Acad. Sci. USA 86:10029-10033 (1989); U.S. Pat. Nos. 5,821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri et al., Methods 36:25-34 (2005) (describing specificity determining region (SDR) grafting); Padlan, Mol. Immunol. 28:489-498 (1991) (describing “resurfacing”); Dall'Acqua et al., Methods 36:43-60 (2005) (describing “FR shuffling”); and Osbourn et al., Methods 36:61-68 (2005) and Klimka et al., Br. J. Cancer, 83:252-260 (2000) (describing the “guided selection” approach to FR shuffling).
[0678] Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the “best-fit” method (see, e.g., Sims et al. J. Immunol. 151:2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and Presta et al. J. Immunol., 151:2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008)); and framework regions derived from screening FR libraries (see, e.g., Baca et al., J. Biol. Chem. 272:10678-10684 (1997) and Rosok et al., J. Biol. Chem. 271:22611-22618 (1996)).
[0679] 4. Multispecific Antibodies
[0680] In certain aspects, an antibody provided herein is a multispecific antibody, e.g., a bispecific antibody. “Multispecific antibodies” are monoclonal antibodies that have binding specificities for at least two different sites, i.e., different epitopes on different antigens or different epitopes on the same antigen. In certain aspects, the multispecific antibody has three or more binding specificities. In certain aspects, one of the binding specificities is for APOL1 and the other specificity is for any other antigen. In certain aspects, bispecific antibodies may bind to two (or more) different epitopes of an antigen. Multispecific antibodies may be prepared as full-length antibodies or antibody fragments.
[0681] Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein and Cuello, Nature 305: 537 (1983)) and “knob-in-hole” engineering (see, e.g., U.S. Pat. No. 5,731,168, and Atwell et al., J. Mol. Biol. 270:26 (1997)). Nonlimiting exemplary knob-in-hole substitutions include T366W (knob) and T366S/L368A/Y407V (hole). In some embodiments, the knob-in-hole substitutions are in IgG.sub.1 constant domains.
[0682] Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules. See, e.g., WO 2009/089004; Dillon et al., Mabs 9(2): 213-230 (2017). As a nonlimiting example, in a bispecific antibody comprising two heavy chain variable regions and two light chain variable regions, a first heavy chain variable region may comprise a Q39E substitution (Kabat numbering) and a first light chain variable region may comprise a Q38K substitution (Kabat numbering); and a second heavy chain variable region may comprise a Q39K substitution (Kabat numbering) and a second light chain variable region may comprise a Q38E substitution (Kabat numbering). In some embodiments, the Q39E/Q38K and Q39K/Q38E substitutions reduce mispairing of the heavy and light chains of the bispecific antibody. Similarly, a first heavy chain constant region may comprise a S183K substitution (EU numbering) and a first light chain constant region may comprise a V133E substitution (EU numbering), and the a second heavy chain constant region may comprise a S183E substitution (EU numbering) and a second light chain constant region may comprise a V133K substitution (EU numbering). In some embodiments, the S183K/V133E and S183E/V133K substitutions reduce mispairing of the heavy and light chains of the bispecific antibody.
[0683] In some embodiments, a bispecific antibody comprises Q39E/Q38K and Q39K/Q38E substitutions in the binding domains and S183K/V133E and S183E/V133K substitutions in the constant regions. In some embodiments, a bispecific antibody comprises both knob-in-hole substitutions and electrostatic substitutions. See, e.g., WO 2016/172485, which is incorporated by reference here in its entirety for any purpose.
[0684] Accordingly, in some embodiments, a multispecific antibody is provided, which comprises a) a first heavy chain/light chain pair binding to a first antigen which comprises a first heavy chain polypeptide (H1) and a first light chain polypeptide (L1), and b) a second heavy chain/light chain pair binding to a second antigen which comprises a second heavy chain polypeptide (H2) and a second light chain polypeptide (L2), wherein each H1 and H2 comprises a heavy chain variable domain (VH) and a heavy chain constant domain (CH1), and each L1 and L2 comprises a light chain variable domain (VL) and a light chain constant domain (CL); wherein the CH1 domain of H1 comprises an amino acid substitution at 5183 (EU numbering) and the CL domain of L1 comprises an amino acid substitution at V133 (EU numbering); and wherein the VH domain of H1 comprises an amino acid substitution at position Q39 and the VL domain of L1 comprises an amino acid substitutions at position Q38 and/or the VH domain of H2 comprises an amino acid substitutions at position Q39 and the VL domain of L2 comprises an amino acid substitution at position Q38 (all Kabat numbering). In some embodiments, the VH domain of H1 comprises an amino acid substitution at Q39 (Kabat numbering) and the VL domain of L1 comprises an amino acid substitution at Q38 (Kabat numbering). In some embodiments, the CH1 domain of H2 comprises an amino acid substitution at 5183 (EU numbering) and the CL domain of L2 comprises an amino acid substitution at V133 (EU numbering). In some embodiments, the VH domain of H2 further comprises an amino acid substitution at position Q39 and the VL domain of L2 further comprises an amino acid substitution at position Q38 (Kabat numbering). In some embodiments, the CH1 domain of H1 comprises a S183K mutation and CL of L1 comprises a V133E mutation, and CH1 of H2 comprises a S183E mutation and the CL domain of L2 comprises the V133K mutation. In some embodiments, the VH domain of H1 comprises a Q39E mutation, the VL domain of L1 comprises a Q38K mutation, the VH domain of H2 comprises a Q39K mutation and the VL domain of L2 comprises a Q38E mutation (all Kabat numbering).
[0685] Multi-specific antibodies may also be made by cross-linking two or more antibodies or fragments (see, e.g., U.S. Pat. No. 4,676,980, and Brennan et al., Science, 229: 81 (1985)); using leucine zippers to produce bi-specific antibodies (see, e.g., Kostelny et al., J. Immunol., 148(5):1547-1553 (1992) and WO 2011/034605); using the common light chain technology for circumventing the light chain mis-pairing problem (see, e.g., WO 98/50431); using “diabody” technology for making bispecific antibody fragments (see, e.g., Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993)); and using single-chain Fv (sFv) dimers (see, e.g., Gruber et al., J. Immunol., 152:5368 (1994)); and preparing trispecific antibodies as described, e.g., in Tutt et al. J. Immunol. 147: 60 (1991).
[0686] Engineered antibodies with three or more antigen binding sites, including for example, “Octopus antibodies”, or DVD-Ig are also included herein (see, e.g., WO 2001/77342 and WO 2008/024715). Other examples of multispecific antibodies with three or more antigen binding sites can be found in WO 2010/115589, WO 2010/112193, WO 2010/136172, WO 2010/145792, and WO 2013/026831. The bispecific antibody or antigen binding fragment thereof also includes a “Dual Acting FAb” or “DAF” comprising an antigen binding site that binds to APOL1 as well as another different antigen (see, e.g., US 2008/0069820 and WO 2015/095539).
[0687] Multi-specific antibodies may also be provided in an asymmetric form with a domain crossover in one or more binding arms of the same antigen specificity, i.e. by exchanging the VH/VL domains (see e.g., WO 2009/080252 and WO 2015/150447), the CH1/CL domains (see e.g., WO 2009/080253) or the complete Fab arms (see e.g., WO 2009/080251, WO 2016/016299, also see Schaefer et al, PNAS, 108 (2011) 1187-1191, and Klein at al., MAbs 8 (2016) 1010-20). In one aspect, the multispecific antibody comprises a cross-Fab fragment. The term “cross-Fab fragment” or “xFab fragment” or “crossover Fab fragment” refers to a Fab fragment, wherein either the variable regions or the constant regions of the heavy and light chain are exchanged. A cross-Fab fragment comprises a polypeptide chain composed of the light chain variable region (VL) and the heavy chain constant region 1 (CH1), and a polypeptide chain composed of the heavy chain variable region (VH) and the light chain constant region (CL). Asymmetrical Fab arms can also be engineered by introducing charged or non-charged amino acid mutations into domain interfaces to direct correct Fab pairing. See e.g., WO 2016/172485.
[0688] Various further molecular formats for multispecific antibodies are known in the art and are included herein (see e.g., Spiess et al., Mol Immunol 67 (2015) 95-106).
[0689] Examples of bispecific antibody formats that may be useful for this purpose include, but are not limited to, the so-called “BiTE” (bispecific T cell engager) molecules wherein two scFv molecules are fused by a flexible linker (see, e.g., WO 2004/106381, WO 2005/061547, WO 2007/042261, and WO 2008/119567, Nagorsen and Bäuerle, Exp Cell Res 317, 1255-1260 (2011)); diabodies (Holliger et al., Prot Eng 9, 299-305 (1996)) and derivatives thereof, such as tandem diabodies (“TandAb”; Kipriyanov et al., J Mol Biol 293, 41-56 (1999)); “DART” (dual affinity retargeting) molecules which are based on the diabody format but feature a C-terminal disulfide bridge for additional stabilization (Johnson et al., J Mol Biol 399, 436-449 (2010)), and so-called triomabs, which are whole hybrid mouse/rat IgG molecules (reviewed in Seimetz et al., Cancer Treat Rev 36, 458-467 (2010)). Particular T cell bispecific antibody formats included herein are described in WO 2013/026833, WO 2013/026839, WO 2016/020309; Bacac et al., Oncoimmunology 5(8) (2016) e1203498.
[0690] 5. Antibody Variants
[0691] In certain aspects, amino acid sequence variants of the antibodies provided herein are contemplated. For example, it may be desirable to alter the binding affinity and/or other biological properties of the antibody. Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen-binding.
[0692] a) Substitution, Insertion, and Deletion Variants
[0693] In certain aspects, antibody variants having one or more amino acid substitutions are provided. Sites of interest for substitutional mutagenesis include the CDRs and FRs. Conservative substitutions are shown in Table 1 under the heading of “preferred substitutions”. More substantial changes are provided in Table 1 under the heading of “exemplary substitutions”, and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
TABLE-US-00001 TABLE 1 Original Exemplary Preferred Residue Substitutions Substitutions Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Asp, Lys; Arg Gln Asp (D) Glu; Asn Glu Cys (C) Ser; Ala Ser Gln (Q) Asn; Glu Asn Glu (E) Asp; Gln Asp Gly (G) Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Val; Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala; Norleucine Leu
[0694] Amino acids may be grouped according to common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; [0695] (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; [0696] (3) acidic: Asp, Glu; [0697] (4) basic: His, Lys, Arg; [0698] (5) residues that influence chain orientation: Gly, Pro; [0699] (6) aromatic: Trp, Tyr, Phe.
[0700] Non-conservative substitutions will entail exchanging a member of one of these classes for a member of another class.
[0701] One type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g., a humanized or human antibody). Generally, the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody. An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more. CDR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g., binding affinity).
[0702] Alterations (e.g., substitutions) may be made in CDRs, e.g., to improve antibody affinity. Such alterations may be made in CDR “hotspots”, i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207:179-196 (2008)), and/or residues that contact antigen, with the resulting variant VH or VL being tested for binding affinity. Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., (2001).) In some aspects of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity. Another method to introduce diversity involves CDR-directed approaches, in which several CDR residues (e.g., 4-6 residues at a time) are randomized. CDR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.
[0703] In certain aspects, substitutions, insertions, or deletions may occur within one or more CDRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in the CDRs. Such alterations may, for example, be outside of antigen contacting residues in the CDRs. In certain variant VH and VL sequences provided above, each CDR either is unaltered, or contains no more than one, two or three amino acid substitutions.
[0704] A useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham and Wells (1989) Science, 244:1081-1085. In this method, a residue or group of target residues (e.g., charged residues such as arg, asp, his, lys, and glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to determine whether the interaction of the antibody with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antibody complex may be used to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
[0705] Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT (antibody directed enzyme prodrug therapy)) or a polypeptide which increases the serum half-life of the antibody.
[0706] 6. Antibody Conjugates
[0707] In certain aspects, an antibody provided herein may be modified to contain additional protein or nonproteinaceous moieties. Moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer is attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
[0708] The invention also provides conjugates comprising an antibody herein conjugated (chemically bonded) to one or more therapeutic agents such as cytotoxic agents, drugs or radioactive isotopes. In one aspect, a conjugate is an antibody-drug conjugate (ADC) in which an antibody is conjugated to one or more therapeutic agents, for example. The antibody is typically connected to one or more therapeutic agents using linkers. An overview of ADC technology is set forth in Pharmacol Review 68:3-19 (2016).
[0709] Conjugates of an antibody and another agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238:1098 (1987). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO 94/11026. The linker may be a “cleavable linker” facilitating release of a cytotoxic drug in the cell. For example, an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker (Chari et al., Cancer Res. 52:127-131 (1992); U.S. Pat. No. 5,208,020) may be used.
[0710] The conjugates or ADCs herein expressly contemplate, but are not limited to such conjugates prepared with cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate) which are commercially available (e.g., from Pierce Biotechnology, Inc., Rockford, Ill., U.S.A).
B. Recombinant Methods and Compositions
[0711] Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Pat. No. 4,816,567. For these methods one or more isolated nucleic acid(s) encoding an antibody are provided.
[0712] In case of a native antibody or native antibody fragment two nucleic acids are required, one for the light chain or a fragment thereof and one for the heavy chain or a fragment thereof. Such nucleic acid(s) encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chain(s) of the antibody). These nucleic acids can be on the same expression vector or on different expression vectors.
[0713] In case of a bispecific antibody with heterodimeric heavy chains four nucleic acids are required, one for the first light chain, one for the first heavy chain comprising the first heteromonomeric Fc-region polypeptide, one for the second light chain, and one for the second heavy chain comprising the second heteromonomeric Fc-region polypeptide. The four nucleic acids can be comprised in one or more nucleic acid molecules or expression vectors. Such nucleic acid(s) encode an amino acid sequence comprising the first VL and/or an amino acid sequence comprising the first VH including the first heteromonomeric Fc-region and/or an amino acid sequence comprising the second VL and/or an amino acid sequence comprising the second VH including the second heteromonomeric Fc-region of the antibody (e.g., the first and/or second light and/or the first and/or second heavy chains of the antibody). These nucleic acids can be on the same expression vector or on different expression vectors, normally these nucleic acids are located on two or three expression vectors, i.e. one vector can comprise more than one of these nucleic acids. Examples of these bispecific antibodies are CrossMabs (see, e.g., Schaefer, W. et al, PNAS, 108 (2011) 11187-1191). For example, one of the heteromonomeric heavy chain comprises the so-called “knob mutations” (T366W and optionally one of S354C or Y349C) and the other comprises the so-called “hole mutations” (T366S, L368A and Y407V and optionally Y349C or S354C) (see, e.g., Carter, P. et al., Immunotechnol. 2 (1996) 73) according to EU index numbering.
[0714] In one aspect, isolated nucleic acids encoding an antibody as used in the methods as reported herein are provided.
[0715] In one aspect, a method of making an antibody is provided, wherein the method comprises culturing a host cell comprising nucleic acid(s) encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
[0716] For recombinant production of an antibody, nucleic acids encoding the antibody, e.g., as described above, are isolated and inserted into one or more vectors for further cloning and/or expression in a host cell. Such nucleic acids may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody) or produced by recombinant methods or obtained by chemical synthesis.
[0717] Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein. For example, antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed. For expression of antibody fragments and polypeptides in bacteria, see, e.g., U.S. Pat. Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, K. A., In: Methods in Molecular Biology, Vol. 248, Lo, B. K. C. (ed.), Humana Press, Totowa, N.J. (2003), pp. 245-254, describing expression of antibody fragments in E. coli.) After expression, the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
[0718] In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been “humanized”, resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross, T. U., Nat. Biotech. 22 (2004) 1409-1414; and Li, H. et al., Nat. Biotech. 24 (2006) 210-215.
[0719] Suitable host cells for the expression of (glycosylated) antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
[0720] Plant cell cultures can also be utilized as hosts. See, e.g., U.S. Pat. Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIES™ technology for producing antibodies in transgenic plants).
[0721] Vertebrate cells may also be used as hosts. For example, mammalian cell lines that are adapted to grow in suspension may be useful. Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293T cells as described, e.g., in Graham, F. L. et al., J. Gen Virol. 36 (1977) 59-74); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, J. P., Biol. Reprod. 23 (1980) 243-252); monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells (as described, e.g., in Mather, J. P. et al., Annals N.Y. Acad. Sci. 383 (1982) 44-68); MRC 5 cells; and FS4 cells. Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR-CHO cells (Urlaub, G. et al., Proc. Natl. Acad. Sci. USA 77 (1980) 4216-4220); and myeloma cell lines such as Y0, NS0 and Sp2/0. For a review of certain mammalian host cell lines suitable for antibody production, see, e.g., Yazaki, P. and Wu, A. M., Methods in Molecular Biology, Vol. 248, Lo, B. K. C. (ed.), Humana Press, Totowa, N.J. (2004), pp. 255-268.
[0722] In one aspect, the host cell is eukaryotic, e.g., a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell).
C. Assays
[0723] Anti-APOL1 antibodies provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays.
[0724] In one aspect, an antibody of the invention is tested for its antigen binding activity, e.g., by known methods such as ELISA, Western blot, etc. Binding of antibodies to podocytes may be tested, for example, by in situ hybridization, immuno-histo chemistry (IHC), immunoprecipitation, flow cytometry, or Western blotting. To differentiate binding between podocytes and HDL particles, one may test binding using APOL1 in its native state, for example by flow cytometry or immunoprecipitation. After fixation and/or permeabilization or denaturation on a denaturing western blot, different APOL1 epitopes become exposed.
[0725] Binding of antibodies to APOL1 in serum, i.e. on HDL particles, may be tested, for example, by the assay described in the Examples herein that reports ability of the antibodies to block trypanolysis. This assay is described in more detail above and in the Examples. This assay can be used in a sample, for instance, to determine the extent to which APOL1 present is exposed on HDL particles.
[0726] Any of the above assays may also be combined, depending on the interest of the researcher.
D. Methods and Compositions for Diagnostics and Detection
[0727] In certain aspects, any of the antibodies provided herein is useful for detecting the presence of antigen such as APOL1 in a biological sample. The term “detecting” as used herein encompasses quantitative or qualitative detection. In certain aspects, a biological sample comprises a cell or tissue, such as a sample containing podocyte cells.
[0728] In certain aspects, the method comprises contacting the biological sample with an anti-APOL1 antibody as described herein under conditions permissive for binding of the antibody to APOL1, and detecting whether a complex is formed between the antibody and the antigen. Such method may be an in vitro or in vivo method. In certain aspects, detection methods involve determining expression of endogenous APOL1 associated with podocyte cells in a sample. For such assays, anti-APOL1 antibodies that distinguish APOL1 from other APOL forms such as one or more of APOL2, APOL3, APOL4, and APOL6 may be used, such as antibodies comprising the CDRs of 5.17D2, 4.17A5, 3.1C1 and 3.7D6. Other antibodies that do not distinguish these proteins, such as one with the CDRs of 3.6D12 or 5.17H8, might also be used in such an assay as controls. In some assays, antibodies that specifically bind to APOL1 on podocytes but do not significantly bind to APOL1 in serum or block trypanolysis as described herein may be used. In some assays, it may be desirable to determine if APOL1 G2 is present on podocytes by using an antibody that can distinguish between the G0 and G1 forms and the G2 form of APOL1, such as one with the CDRs of 4.11A10, 4.12E5, or 4.11H11. Assays used to detect APOL1 on podocytes may include, for example, flow cytometry, in situ hybridization (ISH), immunocytochemistry (IHC), immunoprecipitation, Western blots, and the like. In some aspects, a trypanolysis assay may be used as described herein to detect APOL1 found in serum, e.g. on HDL particles.
[0729] In certain aspects, labeled anti-APOL1 antibodies are provided for such assays. Labels include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction. Exemplary labels include, but are not limited to, the radioisotopes .sup.32P, .sup.14C, .sup.125I, .sup.3H, and .sup.131I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Pat. No. 4,737,456), luciferin, 2,3-dihydrophthalazinediones, horseradish peroxidase (HRP), alkaline phosphatase, β-galactosidase, glucoamylase, lysozyme, saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase, heterocyclic oxidases such as uricase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase, biotin/avidin, spin labels, bacteriophage labels, stable free radicals, and the like. In other aspects, the antibodies herein are not labeled, but are recognized, for example, through secondary antibodies that may incorporate labels or that may induce other molecules to change color or state, thus acting as labels.
E. Articles of Manufacture
[0730] In another aspect of the invention, an article of manufacture containing materials useful for diagnostic assays described above is provided. The article of manufacture may be a composition or kit comprising at least one of the antibodies herein stored for future use, e.g. lyophilized or in a liquid formulation comprising other ingredients such as buffers and stabilizers. The article of manufacture may further comprise other reagents useful in performing an assay with the antibody, such as labeling reagents. The article of manufacture may also comprise a container and a label on or associated with the container.
III. Examples
[0731] The following are examples of methods and compositions of the invention. It is understood that various other embodiments may be practiced, given the general description provided above.
Example 1: Domain-Specific Antibodies Reveal Differences in the Membrane Topologies of APOL1 in Serum and Podocytes
[0732] Two variants of circulating APOL1 (Apolipoprotein L1), G1 and G2 protect against subspecies of Trypanosoma brucei infection, but concurrently confer a greater risk of chronic kidney disease. Little is known about the topology of APOL1 in HDL particles or on the podocyte cells affected in kidney disease. By generating antibodies along the length of APOL1, we identified which domains are exposed, finding differences between serum and podocyte surface APOL1 topologies. These are the first direct insights into APOL1 conformations in physiological settings and have implications for APOL1-targeted drugs for APOL1 nephropathies.
[0733] Circulating Apolipoprotein L1 (APOL1) is the lytic factor for trypanosomes, protecting from human sleeping sickness. Two common African variants of APOL1, G1 and G2, which evolved to protect against species of trypanosomes resistant to wild type, somehow predispose humans to certain chronic kidney diseases (CKD). However, the exact mechanism of APOL1-mediated kidney podocyte damage is still not clear, including its subcellular localization and whether it is related to its role in trypanolysis. 170 APOL1 domain-specific monoclonal antibodies were generated in order to map APOL1 topology in serum (HDL particles) and kidney podocytes by flow cytometry, immunoprecipitation, and trypanolysis assays, and generated APOL1 knockout podocytes to confirm antibody specificity. The results indicate that APOL1 is localized to the cell surface of kidney podocytes, with most of the pore-forming domain (PFD) and C-terminus of the Serum Resistance Associated-interacting domain (SRA-ID), but not the membrane-addressing domain (MAD), being exposed. By contrast, differential trypanolytic blocking activity reveals that the MAD is exposed in serum APOL1, with less of the PFD accessible. The gross topology of APOL1 either in serum or on podocytes was not detectably altered by low pH. The antibodies permitted examination of native APOL1 topology in physiologically relevant membranes, revealing it has a different conformation in serum than on the cell surface. The findings lend credence to the surface ion channel model for APOL1 risk variant-mediated podocyte injury, as well as providing domain accessibility information for designing APOL1-targeted therapeutics.
[0734] Apolipoprotein L1 (APOL1) is the component of human serum responsible for trypanolysis (refs. 1-3) and is the only member of APOL1-6 gene cluster (4-5) to have a signal sequence and hence be secreted into the circulation. Circulating APOL1 confers resistance to Trypanosoma brucei brucei, thus protecting humans against African sleeping sickness (1). APOL1 exists in two complexes with APOA1 and haptoglobin-related protein (HPR) in human serum: Trypanosome Lytic Factor1 (TLF1) is a lipoprotein particle (HDL3b), whereas TLF2 is lipid-poor but contains IgM (6-8). Upon internalization of TLF1/HDL particles into trypanosomes via the TbHpHb receptor (or of TLF2 independent of this receptor), APOL1 becomes inserted into the lysosomal membrane at low pH, leading to osmotic swelling and eventual trypanosome lysis (6, 9-12). APOL1 has three domains named for putative roles in trypanolysis: a pore forming domain (PFD), membrane addressing domain (MAD) and SRA-interacting domain (1). Two coding variants of APOL1 (G1 and G2) evolved to provide resistance against various sub-species of T. brucei (3, 11, 13), but these strongly associate with increased risk of chronic kidney disease in African diaspora (14-15). Kidney disease is thought to be caused by endogenous APOL1 variants in kidney podocytes (the cell type affected in APOL1 nephropathies) rather than circulating APOL1 (16-20). APOL1 is proposed to act as an ion channel in both trypanosomes and mammalian cells, but its location and the nature of the ion are still debated and it is unclear if the same mechanism operates in both species (21-22, 36). Additionally, little is known regarding the topology of APOL1 either in podocyte membranes or HDL particles. Furthermore, it has not been established whether endogenous APOL1 is found on the podocyte cell surface.
[0735] To better characterize both podocyte and serum-associated APOL1, we generated 170 antibodies to APOL1. We found different topologies for the two forms of APOL1 and identified regions that might be targetable by APOL1-binding drugs for APOL1 nephropathies.
[0736] Materials and Methods
[0737] Recombinant APOL1 Generation
[0738] His.sub.6-APOL1 for immunization: Human APOL1 (NM_003661) aa 61-398 (to ensure all splice isoforms would be recognized) was sub-cloned with an N-terminal his.sub.6 tag into a baculovirus intracellular expression vector (pBiNTH, Genentech) and expressed in 101 Sf9 cells. The cell pellet was washed with Tris buffer with protease and proteasome inhibitor MG132 then lysed with 1% Zwittergent 3-14 in Tris buffer with 2× Complete protease inhibitors (Roche 11836153001), plus proteasome inhibitor MG132. It was purified by a 3 ml NiNTA column followed by 5200 column. NiNTA buffer A and B contain 1% Zwittergent 3-14 and Complete protease inhibitors, while 5200 buffer contains 0.1% DDM (n-dodecyl β-D maltoside, Sigma). The 5200 fractions showed three major bands corresponding to full length and degradation products (
[0739] FLAG-APOL1 for trypanolysis assays: Human APOL1 (NM_003661) aa 61-398 (“full length”) or truncation constructs aa 61-203, 92-321, 61-260 and 88-321 for antibody mapping (see
[0740] APOL1 Mapping Peptides
[0741] Peptides (˜20 mers) along the length of APOL1 (
[0742] Antibody Generation
[0743] For the HTV (high pressure tail vein injection) DNA delivery method #1, 10 Balb/c mice were each immunized 6 times (50 μg biweekly) with APOL1-G1 or G2 cDNA in a pCAGG vector with mGM-CSF adjuvant (24). Method #2 used 5 Balb/c mice immunized 16 times with the same cDNAs delivered by GeneGun (0.3 μg biweekly) with mGM-CSF and pORFmoF1t3L adjuvant (25). For Method #3, 3 sets of 5 Balb/c mice were each immunized with his.sub.6-APOL1-G0 with one of three protocols: a) 16 doses, 10 μg twice a week with RIBI adjuvant (resulting in the highest titers); b) 50 μg biweekly with CFA/IFA adjuvant, 7 doses; c) 10 μg twice a week with TLR cocktail, 16 times. For Method #4, six of the low titer mice from method #3 were boosted 6× with his.sub.6-APOL1-G0 SRA-ID (aa 305-398) with RIBI adjuvant to enrich for SRA-ID binding antibodies. Over 15,000 IgG-positive hybridomas (as assessed by CloneDetect) were screened by standard ELISA on his.sub.6-APOL1-G0 (data not shown) and the positive antibodies obtained from each immunization were given a prefix 1-4 indicating the immunization strategy used (summarized in Table 2A). Rabbit monoclonal production (Method #5) is described in the accompanying Example below.
[0744] Table 2A: Attempts to generate APOL1 variant-specific antibodies using APOL1-G1 and G2 cDNAs injected into mice were not very successful, yielding only four weakly APOL1-binding monoclonals that bound APOL1-G0 in addition to the variants (Method 1 & 2). Injection of protein (Methods 3-5) yielded better results (see above for details). See Example 2 below for details of rabbit monoclonal generation (Method #5). See
TABLE-US-00002 TABLE 2A a) Immunization Method (and Method ELISA-positive Ab prefix) Antigen (host species) Antibodies 1 APOL1-G1 HTV (mouse) 3 and G2 DNA 2 APOL1-G1 GeneGun 1 and G2 DNA (mouse) 3 His.sub.6-APOL1-G0 I.V. (mouse) 105 protein 4 His.sub.6-APOL1-G0 I.V. (mouse) 26 protein + SRA- ID-G0 boost 5 His.sub.6-APOL1-G0 I.V. (rabbit) 35 protein
[0745] Antibody Cloning
[0746] 35 murine antibodies, selected from each domain for either strong or no FACS signal on iAPOL1-CHO cells and/or ability to block trypanolysis, were selected for DNA cloning and expressed in CHO cells for scale-up and further analysis; the original hybridomas were discarded. The vector was a murine IgG.sub.2a backbone with effectorless L234A, L235A, P329G (LALAPG) mutations as previously described (26-27). 22 of the cloned antibodies successfully recognized APOL1 by ELISA. A few of the top cloned murine antibodies were also reformatted with a rabbit or rat backbone. (See Example 2 below.)
[0747] Cell Lines
[0748] Stably APOL1 expressing CHO cells (iAPOL1-CHO) were generated by lentiviral infection. APOL1 cDNAs encoding sequence for G0 (ref sequence NM_003661) were cloned either as is (iAPOL1-CHO), or with an N-terminal gD epitope tag and a C-terminal GPI anchor sequence (gD-iAPOL1-GPI-CHO or truncation mutants thereof), into the pInducer20 vector and HEK-293 cells were infected to generate lentiviral stocks (28). CHO cells were infected with APOL1-expressing lentivirus and analyzed for expression by Western blotting and FACS.
[0749] Human immortal podocytes (AB 8/13) were obtained under license from Prof. Moin Saleem (29). They were grown at 33° C., feeding 2-3× a week with fresh growth medium: RPMI with 10% FBS (Seradigm IXL9/06807/GEN), 1% glutamine (Genentech), 1% pen/strep (Gibco 15140-122), 1% ITS (insulin, transferrin, selenium; Gibco 41400-045).
[0750] To generate the APOL1 KO cell line, using the Zhang lab design tool described at the Website “crispr (dot) mit (dot) edu.” (See also Haeussler, M.; Schonig, K.; Eckert, H.; Eschstruth, A.; Mianne, J.; Renaud, J. B.; Schneider-Maunoury, S.; Shkumatava, A.; Teboul, L.; Kent, J.; Joly, J. S.; Concordet, J. P., Evaluation of off-target and on-target scoring algorithms and integration into the guide RNA selection tool CRISPOR. Genome Biol 2016, 17 (1), 148.)
[0751] Guide RNAs were designed targeting exon 1 and exon 7 (
[0752] For iAPOL1 (dox-inducible APOL1) podocytes, untagged APOL1 isoform A cDNA (Origene SC109941) was recloned into a custom dox-inducible PiggyBac vector (PB indu APOL1 T2 mCherry pgk puro, with mCherry removed) and co-transfected with PiggyBac transposase (pBO, Transposagen Biopharmaceuticals, Inc.) into APOL1 KO clone 89401-3 podocytes using GeneJuice (EMD Millipore 70967). Transfected cells were selected 48 h post transfection with 5 μg/ml puromycin for 2 weeks. Single cell clones were generated from pools of iAPOL1 expressing cells using limiting dilution. All clones were maintained at 33° C. in podocyte media as above except with tetracycline-free FBS (TaKaRa 631101) and 5 μg/ml puromycin (Clontech 631305).
[0753] JHH-1 (human hepatocellular carcinoma), 786-0 (human kidney adenocarcinoma) and HCC827 (human lung adenocarcinoma) cells were obtained from a Genentech, Inc. cell repository (which validates lines by STR analysis and checks for absence of mycoplasma) and grown in RPMI-1640, with 10% FBS, 1% HEPES and 2 mM glutamine.
[0754] Flow Cytometry
[0755] Cells were harvested with 5 mM EDTA in PBS, washed once with growth media and twice with PBS. Approximately 0.5×10.sup.6/m1 of cells resuspended in PBS were incubated with anti-APOL1 antibodies for 1 h on ice. Following two PBS washes, 2 μg/ml of Alexa488 anti-mouse or anti-rabbit (Invitrogen A11029 and A21206, respectively) was used for 1 h on ice for detection. Cells were washed twice in PBS and resuspended in PBS with 1 μg/ml propidium iodide. Signals were read in a FACSCalibur3 (Becton Dickinson), with the exception of
[0756] Western Blotting
[0757] Cell lysates were prepared using native RIPA (NP-40) lysis buffer (150 mM NaCl, 50 mM Tris pH 8, 1% NP-40, 1 mM PMSF and 1× Complete Protease Inhibitors (Roche 11836153001). Protein concentrations were determined using the BCA assay (Pierce 23225). Cell lysates were run on 4-12% Bis-Tris gels (Invitrogen NP03220) in MOPS buffer (Invitrogen NP0001) and transferred to nitrocellulose membranes using an iBLOT2. Precision Plus protein Kaleidoscope markers (BioRad #1610375) was used to determine molecular weights unless otherwise stated. Membranes blocked in 5% Skim Milk in TBST (Tris buffered saline with 0.1% Tween-20) were incubated with 1-2.5 μg/ml primary antibodies overnight at 4° C. Following three TBST washes, anti-mouse (GE Healthcare NA931V, 1:3000) or anti-rabbit HRP (Jackson 711-036-152, 1:8000) was added as secondary antibody. After 1 h, membranes were washed and protein detected using ECL prime (Amersham RPN2232) exposed to MR film (Kodak). Anti-actin HRP-conjugated antibody (clone 13E5, Cell Signaling Technologies 5125S at 1:5000) or calnexin (Abcam Ab22595 at 1:1000) was used as a loading control. For peptide mapping, 2 μl of 1 mM peptides in DMSO were boiled in 5× sample buffer and loaded on 10% Tris-Glycine gel and run using MES buffer. Cell pellets of Sf9 lysates were lysed in native RIPA (NP-40) lysis buffer and run on 10% Tris-Glycine gels.
[0758] Immunoprecipitation
[0759] Anti-APOL1 antibodies were conjugated to Dynabeads (ThermoFisher 14311D) as per the manufacturer's protocol. Briefly, 10 μg of each antibody was conjugated to 2 mg of Dynabeads overnight at 37° C. with rotation. Next day, unbound antibody was washed off and conjugated antibody was resuspended at a final concentration of 50 μg/ml. 2-5 μg of the conjugated antibody was incubated with 1 μl of undiluted human serum at 4° C. for 16 h in a total volume of 500 μl with PBS. Unbound serum was washed with 150 mM NaCl in PBS. Bound APOL1 was eluted with low pH glycine buffer (this was preferable to direct boiling to avoid elution of non-specifically bound proteins). Eluates were boiled in 5× sample buffer (Invitrogen 39000) and loaded on 4-12% Bis-Tris gels (Invitrogen NP03220). Immunoprecipitated APOL1 was detected by rabbit polyclonal APOL1 antibody (Proteintech 11486-2-AP, 1:1000) and ECL. APOA1 was detected with goat anti-APOA1 (Rockland 600-101-109), HPR was detected with 1 μg/ml rabbit anti-HPR (Millipore ABS 196) and ECL Prime. For low pH experiments, conjugated antibody was incubated with human serum at 4° C. for 1-2 h in presence of PBS pH 7.0 or pH 5.5.
[0760] Trypanosome Assay
[0761] Trypanosoma brucei brucei were obtained under MTA from ATCC and cultured in HMI-9 media containing IMDM (Genentech), heat-inactivated (56° C. for 30 min) FBS (Seradigm IXL9/06807/GEN), 1% serum plus (Sigma 14008C), HMI-9 (Genentech) and 1% hypoxanthine (Genentech). Trypanosome lysis was performed by treating 1×10.sup.5 Trypanosomes with serial dilutions of NHS or recombinant APOL1 for 16 h in a total of 100 μl. Live cell read out was done by the Alamar Blue assay as per the manufacturer's protocol (30) (Thermo Fisher, DAL1100). Briefly 10 μl of Alamar Blue was added to each well, incubated at 37° C. for 4 h. Red fluorescence, indicating live trypanosomes, was measured on a SpectraMax fluorimeter powered by SoftMAX PRO with excitation at 530 nm and emission 590 nm. For the antibody blocking assay, 1% normal human serum was preincubated with 1-10 μg/ml of anti-APOL1 antibody or media at room temperature for 20 mins followed by addition of trypanosomes. After 16 h, the Alamar Blue assay was performed as above and background values for media only were subtracted and % blocking calculated by normalizing to no antibody control. Data were plotted in Prism v7. Normal Human serum was obtained from healthy volunteers at Genentech. Lipoprotein deficient serum (LPDS, depleted by ultracentrifugation) was commercially obtained from Kalen Biomedical (Cat #780100). KBr-density gradient purified HDL was obtained from Millipore (LP3-5MG).
[0762] Surface Plasmon Resonance (SPR) and Wasatch Binning
[0763] A 96×96 array-based SPR imaging system (Carterra USA) was used for epitope mapping of anti-ApoL1 monoclonal antibodies. Briefly, purified monoclonal hybridoma antibodies were diluted at 10 μg/ml in 10 mM sodium acetate buffer pH 4.5. Using amine coupling, antibodies were directly immobilized onto a SPR sensorprism CMD 200M chip (XanTec Bioanalytics, Germany) using a Continuous Flow Microspotter (Carterra, USA) to create an array of antibodies. After coupling, the antibodies were blocked with ethanolamine, and primed with running buffer (10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.005% Tween 20). Epitope mapping was performed by flowing 100 nM of different peptides of APOL1 across the immobilized anti-APOL1 antibodies on the biosensor chip at 25° C. in a running buffer of 10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.005% Tween 20. After each flow through of the APOL1 peptide, the chip surface was regenerated using 10 mM glycine, pH 2.0. The binding data was processed using the Wasatch binning software tool.
[0764] Anti-APOL1 Antibody Generation and Domain Specificity
[0765] Several approaches were taken to generate antibodies (Table 2A), the most successful being inoculation of trypanolytically-active his.sub.6-tagged APOL1-G0 (wild type;
[0766] To test if the antibodies could recognize APOL1 expressed in cells, all 170 antibodies were tested by flow cytometry on CHO cells stably expressing doxycycline-inducible GPI-anchored WT-APOL1 (gD-iAPOL1-GPI-CHO;
[0767] APOL1 is Present on the Cell Surface
[0768] Whether APOL1 forms a chloride channel in the lysosome (12, 21, 32) or a cation channel at the plasma membrane is still debated (24,25). Since our antibodies recognized GPI-anchored gD-APOL1 expressed in CHO cells, we tested by flow cytometry whether non GPI-anchored untagged native full length APOL1 (construct a in iAPOL1-CHO cells) is also localized to the cell surface (
[0769] Surface expression in CHO cells was not merely a transfection artifact because most of our antibodies also detected endogenous APOL1 (
[0770] Specificity of Antibodies Towards Podocyte Surface APOL1
[0771] To confirm the specificity of the APOL1 signals on the podocyte cell surface, we first knocked out endogenous APOL1 using CRISPR/Cas9 (
[0772] Functional Activity of Anti-APOL1 Antibodies
[0773] To determine if there is similarly differential exposure of APOL1 domains in circulating APOL1, we took advantage of the proven functional activity of circulating APOL1 in mediating trypanosome lysis (12, 35, 36). We hypothesized that antibodies binding to accessible parts of serum APOL1 might inhibit APOL1-mediated lysis of Trypanosoma brucei brucei (
[0774] Correlation Between Cell Surface and Circulating APOL1 Accessibility
[0775] Since trypanolytic blockade is a useful surrogate for serum APOL1 binding (
[0776] More importantly, there were also differential APOL1 accessibilities between serum APOL1 and kidney disease-relevant podocytes (
[0777] APOL1 Topology
[0778] To obtain a more detailed epitope map of the anti-APOL1 antibodies, we determined their binding to a panel of overlapping peptides spanning the entire length of APOL1 by surface plasmon resonance and western blotting, as well as western blotting also using Sf9 lysates expressing truncated APOL1 (examples in
TABLE-US-00003 TABLE 2B b) Transmembrane prediction program results Model # tm* Tm1 Tm2 Tm3 Tm4 Fits FACS data? DAS 3 177-197 (183-222) 338-353 Only if tm3 is a hairpin loop server DAS/cgi 2 184-193 341-351 No, MAD is not intracellular.sup.# and linker is exposed TMHMM 1 177-199 No, PFD and C-terminus are both exposed TMpred 2 177-196 332-353 No, MAD is not intracellular.sup.# and linker is exposed Tmpred 4 177-196 (212-230) (257-276) 332-353 No, linker is exposed SPLIT 3 175-196 (200-224) 338-354 Only if tm3 is a hairpin loop server *The N-terminal signal sequence is not counted as a transmembrane domain Parentheses indicate a weak tm prediction. * .sup.#Although the MAD is not exposed in podocytes or other human cell lines, it is in CHO cells, thus we believe it is not intracellular or buried in the membrane, but instead bound to another protein in podocytes and other human cells, since it is unlikely that the transmembrane domains would fundamentally differ between species. See FIG. 9 for working model with 2 full transmembrane domains and hairpin (semi) loop for tm3.
[0779] In podocytes, the N- and C-termini are both exposed (
[0780] By contrast in serum (presumably in HDL particles), the N-terminus of the PFD is buried up to aa 103 (as is region 111-150) and most of the MAD and start of the linker appear exposed. Assuming that the transmembrane domains are buried (untestable due to lack of antibodies), the remaining topology is similar to podocytes. However, we cannot exclude the possibility that the transmembrane domains could be exposed on the surface of HDL particles.
[0781] Low pH does not Affect APOL1 Topology
[0782] To further probe the topology of APOL1, we relied on prior knowledge that APOL1 requires a low pH-triggered conformational change to insert into artificial membranes or translocate from HDL to trypanosome lysosome membranes (purportedly via the MAD) (1, 21, 32) and attempted to determine if low pH would alter epitope exposure. iAPOL1-podocytes were therefore incubated with antibodies to each domain at acidic and neutral pH, but revealed no differences in binding (
[0783] To test whether APOL1 is released from HDL at low pH, we attempted to immunoprecipitate it with non-blocking antibodies to each domain at pH 5.5, but without success (
[0784] Discussion of Results
[0785] We generated and characterized 170 monoclonal antibodies against APOL1 to examine the topology of APOL1 on the cell surface and in serum. Our findings demonstrate that APOL1 exhibits different topologies in serum versus on cell lines, implying that different reagents would be required to optimally target the two sources of APOL 1.
[0786] To determine which domains of APOL1 are exposed in HDL particles, we screened all the antibodies for blockade of serum-mediated trypanolysis as a high-throughput proxy for recognition of serum APOL1. We found that every single antibody that could immunoprecipitate serum APOL1 was a trypanolytic blocker, irrespective of binding site. While it remains to be determined at which step this blockade occurs, the abundance of blocking antibodies suggests that they may simply cause or prevent conformational changes in APOL1. In some aspects, antibodies herein may provide an important tool to study the role of circulating APOL1 in vivo.
[0787] Our data reveal differences in the conformation of APOL1 between podocytes and serum, although the topology of APOL1 in the trypanosome lysosome may differ to that in HDL. Other differences between trypanolytic and podocyte APOL1 are that only the risk variants are toxic to mammalian cells (39, 40, 19) and homozygosity increases the risk for development of CKD (14-15, 41). The proposed mechanisms for endogenous APOL1 cytotoxicity are varied and conflicting (33) it being unclear even if cytotoxicity occurs intracellularly or at the cell surface. Our data provide evidence that APOL1 is at the podocyte cell surface, potentially supporting the cell surface cation channel model (32, 39, 42). However, the extensive exposure of APOL1 and predicted low number of transmembrane domains (2-4) clearly differs from typical ion channels with >6 transmembrane domains and few extracellular residues (43).
[0788] Our podocyte topology model predicts extracellular exposure of most of APOL1 except the transmembrane domains and adjacent residues and the MAD. The MAD is extracellular in CHO cells but obscured in podocytes, as well other endogenously expressing human cell lines tested, putatively obstructed by a human-specific binding partner (
[0789] In serum APOL1, in contrast with podocytes, most of the PFD is inaccessible, potentially buried in the TLF particles or folded onto itself, while the MAD is mainly exposed (
[0790] In summary, we have shown that native APOL1 is present on the cell surface of cultured podocytes and stably transfected CHO cells and hence is correctly located to form surface ion channels, albeit with atypical topology. More importantly, APOL1 has different conformations on the cell surface and in the circulation, meaning that not all APOL1-binding agents will bind both sources of APOL1. Testing if the proposed APOL1-suPAR interaction in podocytes (49) is blocked by any of our antibodies might provide clues as to the currently unknown source of APOL1 in this interaction. While our antibodies could potentially target circulating APOL1, they would probably not cross the glomerular filtration barrier to access podocyte APOL1, at least in IgG format.
[0791] Details of Antibody Domain Mapping
[0792] Since any one given method was not optimal for all the antibodies tested, data from different approaches were combined to understand antibody domains. For brevity, “binders” refer to podocyte FACS positive antibodies, while “blockers” refer to trypanolysis blockers (i.e. serum APOL1 binders). Because our immunogen lacked the first 60 aa, there were of course no antibodies to this region. In the PFD, two binding non-blockers and weak blocker (5.11H2 and 5.17H8 mapped to aa 61-92 (
[0793] Only 4 MAD binders were successfully cloned: three blocking non-binders mapping to the C-terminal half of the MAD (aa 260-305), indicating that this region is exposed in serum but not on podocytes. By contrast 4.12F4 and 3.5H9 (which could not be cloned) mapped to the N-terminus of the MAD (235-260), but were negative for both binding and blocking, suggesting this domain may be buried in both cases. Thus, the whole MAD is buried in podocytes, but the C-terminal portion is exposed in serum.
[0794] Most SRA-ID binders actually mapped to the linker region between the MAD and SRA-ID (aa 306-339), only nine recognizing the SRA-ID proper, seven of which don't recognize APOL1-G2 (
[0795] Amino acid sequences for antibodies whose sequences were obtained are provided in the Sequence Table further below.
REFERENCES FOR EXAMPLE 1
[0796] 1. Pays, E.; Vanhollebeke, B.; Vanhamme, L.; Paturiaux-Hanocq, F.; Nolan, D. P.; Perez-Morga, D., The trypanolytic factor of human serum. Nat Rev Microbiol 2006, 4 (6), 477-86. [0797] 2. Samanovic, M.; Molina-Portela, M. P.; Chessler, A. D.; Burleigh, B. A.; Raper, J., Trypanosome lytic factor, an antimicrobial high-density lipoprotein, ameliorates Leishmania infection. PLoS Pathog 2009, 5 (1), e1000276. [0798] 3. Vanhamme, L.; Paturiaux-Hanocq, F.; Poelvoorde, P.; Nolan, D. P.; Lins, L.; Van Den Abbeele, J.; Pays, A.; Tebabi, P.; Van Xong, H.; Jacquet, A.; Moguilevsky, N.; Dieu, M.; Kane, J. P.; De Baetselier, P.; Brasseur, R.; Pays, E., Apolipoprotein L-I is the trypanosome lytic factor of human serum. Nature 2003, 422 (6927), 83-7. [0799] 4. Duchateau, P. N.; Pullinger, C. R.; Cho, M. H.; Eng, C.; Kane, J. P., Apolipoprotein L gene family: tissue-specific expression, splicing, promoter regions; discovery of a new gene. J Lipid Res 2001, 42 (4), 620-30. [0800] 5. Page, N. M.; Butlin, D. J.; Lomthaisong, K.; Lowry, P. J., The human apolipoprotein L gene cluster: identification, classification, and sites of distribution. Genomics 2001, 74 (1), 71-8. [0801] 6. Hajduk, S. L.; Hager, K.; Esko, J. D., High-density lipoprotein-mediated lysis of trypanosomes. Parasitol Today 1992, 8 (3), 95-8. [0802] 7. Raper, J.; Fung, R.; Ghiso, J.; Nussenzweig, V.; Tomlinson, S., Characterization of a novel trypanosome lytic factor from human serum. Infect Immun 1999, 67 (4), 1910-6. [0803] 8. Hajduk, S. L.; Moore, D. R.; Vasudevacharya, J.; Siqueira, H.; Torri, A. F.; Tytler, E. M.; Esko, J. D., Lysis of Trypanosoma brucei by a toxic subspecies of human high density lipoprotein. J Biol Chem 1989, 264 (9), 5210-7. [0804] 9. Bishop, J. R.; Shimamura, M.; Hajduk, S. L., Insight into the mechanism of trypanosome lytic factor-1 killing of Trypanosoma brucei brucei. Mol Biochem Parasitol 2001, 118 (1), 33-40. [0805] 10. Drain, J.; Bishop, J. R.; Hajduk, S. L., Haptoglobin-related protein mediates trypanosome lytic factor binding to trypanosomes. J Biol Chem 2001, 276 (32), 30254-60. [0806] 11. Oli, M. W.; Cotlin, L. F.; Shiflett, A. M.; Hajduk, S. L., Serum resistance-associated protein blocks lysosomal targeting of trypanosome lytic factor in Trypanosoma brucei. Eukaryot Cell 2006, 5 (1), 132-9. [0807] 12. Perez-Morga, D.; Vanhollebeke, B.; Paturiaux-Hanocq, F.; Nolan, D. P.; Lins, L.; Homble, F.; Vanhamme, L.; Tebabi, P.; Pays, A.; Poelvoorde, P.; Jacquet, A.; Brasseur, R.; Pays, E., Apolipoprotein L-I promotes trypanosome lysis by forming pores in lysosomal membranes. Science 2005, 309 (5733), 469-72. [0808] 13. Cooper, A.; Ilboudo, H.; Alibu, V. P.; Ravel, S.; Enyaru, J.; Weir, W.; Noyes, H.; Capewell, P.; Camara, M.; Milet, J.; Jamonneau, V.; Camara, O.; Matovu, E.; Bucheton, B.; MacLeod, A., APOL1 renal risk variants have contrasting resistance and susceptibility associations with African trypanosomiasis. Elife 2017, 6. [0809] 14. Tzur, S.; Rosset, S.; Shemer, R.; Yudkovsky, G.; Selig, S.; Tarekegn, A.; Bekele, E.; Bradman, N.; Wasser, W. G.; Behar, D. M.; Skorecki, K., Missense mutations in the APOL1 gene are highly associated with end stage kidney disease risk previously attributed to the MYH9 gene. Hum Genet 2010, 128 (3), 345-50. [0810] 15. Genovese, G.; Friedman, D. J.; Ross, M. D.; Lecordier, L.; Uzureau, P.; Freedman, B. I.; Bowden, D. W.; Langefeld, C. D.; Oleksyk, T. K.; Uscinski Knob, A. L.; Bernhardy, A. J.; Hicks, P. J.; Nelson, G. W.; Vanhollebeke, B.; Winkler, C. A.; Kopp, J. B.; Pays, E.; Pollak, M. R., Association of trypanolytic ApoL1 variants with kidney disease in African Americans. Science 2010, 329 (5993), 841-5. [0811] 16. Freedman, B. I.; Limou, S.; Ma, L.; Kopp, J. B., APOL1-Associated Nephropathy: A Key Contributor to Racial Disparities in CKD. Am J Kidney Dis 2018, 72 (5S1), S8-S16. [0812] 17. Santoriello, D.; Husain, S. A.; De Serres, S. A.; Bomback, A. S.; Crew, R. J.; Vasilescu, E. R.; Serban, G.; Campenot, E. S.; Kiryluk, K.; Mohan, S.; Hawkins, G. A.; Hicks, P. J.; Cohen, D. J.; Radhakrishnan, J.; Stokes, M. B.; Markowitz, G. S.; Freedman, B. I.; D'Agati, V. D.; Batal, I., Donor APOL1 high-risk genotypes are associated with increased risk and inferior prognosis of de novo collapsing glomerulopathy in renal allografts. Kidney Int 2018, 94 (6), 1189-1198. [0813] 18. Freedman, B. I.; Pastan, S. O.; Israni, A. K.; Schladt, D.; Julian, B. A.; Gautreaux, M. D.; Hauptfeld, V.; Bray, R. A.; Gebel, H. M.; Kirk, A. D.; Gaston, R. S.; Rogers, J.; Farney, A. C.; Orlando, G.; Stratta, R. J.; Mohan, S.; Ma, L.; Langefeld, C. D.; Bowden, D. W.; Hicks, P. J.; Palmer, N. D.; Palanisamy, A.; Reeves-Daniel, A. M.; Brown, W. M.; Divers, J., APOL1 Genotype and Kidney Transplantation Outcomes From Deceased African American Donors. Transplantation 2016, 100 (1), 194-202. [0814] 19. Beckerman, P.; Bi-Karchin, J.; Park, A. S.; Qiu, C.; Dummer, P. D.; Soomro, I.; Boustany-Kari, C. M.; Pullen, S. S.; Miner, J. H.; Hu, C. A.; Rohacs, T.; Inoue, K.; Ishibe, S.; Saleem, M. A.; Palmer, M. B.; Cuervo, A. M.; Kopp, J. B.; Susztak, K., Transgenic expression of human APOL1 risk variants in podocytes induces kidney disease in mice. Nat Med 2017, 23 (4), 429-438. [0815] 20. Aghajan, M.; Booten, S. L.; Althage, M.; Hart, C. E.; Ericsson, A.; Maxvall, I.; Ochaba, J.; Menschik-Lundin, A.; Hartleib, J.; Kuntz, S.; Gattis, D.; Ahlstrom, C.; Watt, A. T.; Engelhardt, J. A.; Monia, B. P.; Magnone, M. C.; Guo, S., Antisense oligonucleotide treatment ameliorates IFN-gamma-induced proteinuria in APOL1-transgenic mice. JCI Insight 2019, 4 (12). [0816] 21. Bruno, J.; Pozzi, N.; Oliva, J.; Edwards, J. C., Apolipoprotein L1 confers pH-switchable ion permeability to phospholipid vesicles. J Biol Chem 2017, 292 (44), 18344-18353. [0817] 22. Thomson, R.; Genovese, G.; Canon, C.; Kovacsics, D.; Higgins, M. K.; Carrington, M.; Winkler, C. A.; Kopp, J.; Rotimi, C.; Adeyemo, A.; Doumatey, A.; Ayodo, G.; Alper, S. L.; Pollak, M. R.; Friedman, D. J.; Raper, J., Evolution of the primate trypanolytic factor APOL1. Proc Natl Acad Sci USA 2014, 111 (20), E2130-9. [0818] 23. Chan, W. C.; White, P. D., Fmoc solid phase peptide synthesis: a practical approach. Oxford University Press: New York, 2000; p xxiv, 346 p. [0819] 24. Hazen, M.; Bhakta, S.; Vij, R.; Randle, S.; Kallop, D.; Chiang, V.; Hotzel, I.; Jaiswal, B. S.; Ervin, K. E.; Li, B.; Weimer, R. M.; Polakis, P.; Scheller, R. H.; Junutula, J. R.; Hongo, J. A., An improved and robust DNA immunization method to develop antibodies against extracellular loops of multi-transmembrane proteins. MAbs 2014, 6 (1), 95-107. [0820] 25. Vij, R.; Lin, Z.; Schneider, K.; Seshasayee, D.; Koerber, J. T., Analysis of the effect of promoter type and skin pretreatment on antigen expression and antibody response after gene gun-based immunization. PLoS One 2018, 13 (6), e0197962. [0821] 26. Lo, M., Kim, H. S., Tong, R. K., Bainbridge, T. W., Vernes, J. M., Zhang, Y., Lin, Y. L., Chung, S., Dennis, M. S., Zuchero, Y. J., Watts, R. J., Couch, J. A., Meng, Y. G., Atwal, J. K., Brerski, R. J., Spiess, C., and Ernst, J. A. (2017) Effector-attenuating Substitutions That Maintain Antibody Stability and Reduce Toxicity in Mice. J Biol Chem 292, 3900-3908. [0822] 27. Schlothauer, T., Herter, S., Koller, C. F., Grau-Richards, S., Steinhart, V., Spick, C., Kubbies, M., Klein, C., Umana, P., and Mossner, E. (2016) Novel human IgG.sub.1 and IgG.sub.4 Fc-engineered antibodies with completely abolished immune effector functions. Protein Eng Des Sel 29, 457-466 [0823] 28. Meerbrey, K. L.; Hu, G.; Kessler, J. D.; Roarty, K.; Li, M. Z.; Fang, J. E.; Herschkowitz, J. I.; Burrows, A. E.; Ciccia, A.; Sun, T.; Schmitt, E. M.; Bernardi, R. J.; Fu, X.; Bland, C. S.; Cooper, T. A.; Schiff, R.; Rosen, J. M.; Westbrook, T. F.; Elledge, S. J., The pINDUCER lentiviral toolkit for inducible RNA interference in vitro and in vivo. Proc Natl Acad Sci USA 2011, 108 (9), 3665-70. [0824] 29. Saleem, M. A.; O'Hare, M. J.; Reiser, J.; Coward, R. J.; Inward, C. D.; Farren, T.; Xing, C. Y.; Ni, L.; Mathieson, P. W.; Mundel, P., A conditionally immortalized human podocyte cell line demonstrating nephrin and podocin expression. J Am Soc Nephrol 2002, 13 (3), 630-8. [0825] 30. Raz, B.; Iten, M.; Grether-Buhler, Y.; Kaminsky, R.; Brun, R., The Alamar Blue assay to determine drug sensitivity of African trypanosomes (T. b. rhodesiense and T. b. gambiense) in vitro. Acta Trop 1997, 68 (2), 139-47. [0826] 31. Lan, X.; Jhaveri, A.; Cheng, K.; Wen, H.; Saleem, M. A.; Mathieson, P. W.; Mikulak, J.; Aviram, S.; Malhotra, A.; Skorecki, K.; Singhal, P. C., APOL1 risk variants enhance podocyte necrosis through compromising lysosomal membrane permeability. Am J Physiol Renal Physiol 2014, 307 (3), F326-36. [0827] 32. Thomson, R.; Finkelstein, A., Human trypanolytic factor APOL1 forms pH-gated cation-selective channels in planar lipid bilayers: relevance to trypanosome lysis. Proc Natl Acad Sci USA 2015, 112 (9), 2894-9. [0828] 33. Olabisi, O. A.; Heneghan, J. F., APOL1 Nephrotoxicity: What Does Ion Transport Have to Do With It? Semin Nephrol 2017, 37 (6), 546-551. [0829] 34. Nichols, B.; Jog, P.; Lee, J. H.; Blackler, D.; Wilmot, M.; D'Agati, V.; Markowitz, G.; Kopp, J. B.; Alper, S. L.; Pollak, M. R.; Friedman, D. J., Innate immunity pathways regulate the nephropathy gene Apolipoprotein L1. Kidney Int 2015, 87 (2), 332-42. [0830] 35. Cooper, A.; Capewell, P.; Clucas, C.; Veitch, N.; Weir, W.; Thomson, R.; Raper, J.; MacLeod, A., A Primate APOL1 Variant That Kills Trypanosoma brucei gambiense. PLoS Negl Trop Dis 2016, 10 (8), e0004903. [0831] 36. Molina Portela, M. P.; Raper, J.; Tomlinson, S., An investigation into the mechanism of trypanosome lysis by human serum factors. Mol Biochem Parasitol 2000, 110 (2), 273-82. [0832] 37. Shiflett, A. M.; Bishop, J. R.; Pahwa, A.; Hajduk, S. L., Human high density lipoproteins are platforms for the assembly of multi-component innate immune complexes. J Biol Chem 2005, 280 (38), 32578-85. [0833] 38. Thomson, R.; Samanovic, M.; Raper, J., Activity of trypanosome lytic factor: a novel component of innate immunity. Future Microbiol 2009, 4 (7), 789-96. [0834] 39 Olabisi, 0. A.; Zhang, J. Y.; VerPlank, L.; Zahler, N.; DiBartolo, S., 3rd; Heneghan, J. F.; Schlondorff, J. S.; Suh, J. H.; Yan, P.; Alper, S. L.; Friedman, D. J.; Pollak, M. R., APOL1 kidney disease risk variants cause cytotoxicity by depleting cellular potassium and inducing stress-activated protein kinases. Proc Natl Acad Sci USA 2016, 113 (4), 830-7. [0835] 40. Ma, L.; Divers, J.; Freedman, B. I., Mechanisms of Injury in APOL1-associated Kidney Disease. Transplantation 2019, 103 (3), 487-492. [0836] 41. Parsa, A.; Kao, W. H.; Xie, D.; Astor, B. C.; Li, M.; Hsu, C. Y.; Feldman, H. I.; Parekh, R. S.; Kusek, J. W.; Greene, T. H.; Fink, J. C.; Anderson, A. H.; Choi, M. J.; Wright, J. T., Jr.; Lash, J. P.; Freedman, B. I.; Ojo, A.; Winkler, C. A.; Raj, D. S.; Kopp, J. B.; He, J.; Jensvold, N. G.; Tao, K.; Lipkowitz, M. S.; Appel, L. J.; Investigators, A. S.; Investigators, C. S., APOL1 risk variants, race, and progression of chronic kidney disease. N Engl J Med 2013, 369 (23), 2183-96. [0837] 42. O'Toole, J. F.; Schilling, W.; Kunze, D.; Madhavan, S. M.; Konieczkowski, M.; Gu, Y.; Luo, L.; Wu, Z.; Bruggeman, L. A.; Sedor, J. R., ApoL1 Overexpression Drives Variant-Independent Cytotoxicity. J Am Soc Nephrol 2018, 29 (3), 869-879. [0838] 43. Benham, C. D., Simple recipe for blocking ion channels. Nat Biotechnol 2005, 23 (10), 1234-5. [0839] 44. Wan, G.; Zhaorigetu, S.; Liu, Z.; Kaini, R.; Jiang, Z.; Hu, C. A., Apolipoprotein L1, a novel Bc1-2 homology domain 3-only lipid-binding protein, induces autophagic cell death. J Biol Chem 2008, 283 (31), 21540-9. [0840] 45. Vanhollebeke, B.; Pays, E., The function of apolipoproteins L. Cell Mol Life Sci 2006, 63 (17), 1937-44. [0841] 46. Paul Paroutis, N. T., and; Grinstein, S., The pH of the Secretory Pathway: Measurement, Determinants, and Regulation. american physiology society 2004, 19. [0842] 47. Sharma, A. K.; Friedman, D. J.; Pollak, M. R.; Alper, S. L., Structural characterization of the C-terminal coiled-coil domains of wild-type and kidney disease-associated mutants of apolipoprotein L1. FEBS J2016, 283 (10), 1846-62. [0843] 48. Vanhollebeke, B.; Nielsen, M. J.; Watanabe, Y.; Truc, P.; Vanhamme, L.; Nakajima, K.; Moestrup, S. K.; Pays, E., Distinct roles of haptoglobin-related protein and apolipoprotein L-I in trypanolysis by human serum. Proc Natl Acad Sci USA 2007, 104 (10), 4118-23. [0844] 49. Hayek, S. S.; Koh, K. H.; Grams, M. E.; Wei, C.; Ko, Y. A.; Li, J.; Samelko, B.; Lee, H.; Dande, R. R.; Lee, H. W.; Hahm, E.; Peev, V.; Tracy, M.; Tardi, N. J.; Gupta, V.; Altintas, M. M.; Garborcauskas, G.; Stojanovic, N.; Winkler, C. A.; Lipkowitz, M. S.; Tin, A.; Inker, L. A.; Levey, A. S.; Zeier, M.; Freedman, B. I.; Kopp, J. B.; Skorecki, K.; Coresh, J.; Quyyumi, A. A.; Sever, S.; Reiser, J., A tripartite complex of suPAR, APOL1 risk variants and alphavbeta3 integrin on podocytes mediates chronic kidney disease. Nat Med 2017, 23 (8), 945-953. [0845] 50. Davidson, W. S.; Silva, R. A.; Chantepie, S.; Lagor, W. R.; Chapman, M. J.; Kontush, A., Proteomic analysis of defined HDL subpopulations reveals particle-specific protein clusters: relevance to antioxidative function. Arterioscler Thromb Vasc Biol 2009, 29 (6), 870-6. [0846] 51. Verdery, R. B.; Benham, D. F.; Baldwin, H. L.; Goldberg, A. P.; Nichols, A. V., Measurement of normative HDL subfraction cholesterol levels by Gaussian summation analysis of gradient gels. J Lipid Res 1989, 30 (7), 1085-95.
Example 2: Apolipoprotein L1-Specific Antibodies Detect Endogenous APOL1 Inside the Endoplasmic Reticulum and on the Plasma Membrane of Podocytes
[0847] APOL1-G1 and G2 variants associate with African American chronic kidney disease. Overexpression of these variants kills cells, with a wide variety of mechanisms proposed, all involving different compartments. The localization of endogenous APOL1 has not been conclusively established because most published antibodies cross-react with APOL2. Here we generated APOL1-specific antibodies and show that endogenous podocyte APOL1 is mainly inside the ER, with a small amount on the cell surface. This potentially supports the ER stress or cell surface cation channel models of cytotoxicity.
[0848] Genetic variants G1 and G2 of Apolipoprotein L1 (APOL1) account for the majority of racially disparate chronic kidney diseases in African Americans. Multiple mechanisms of kidney podocyte cytotoxicity by APOL1 variant overexpression have been proposed, each involving different subcellular compartments. It is unclear which compartment endogenous podocyte APOL1 resides in because previous immunolocalization studies either utilized overexpressed protein or commercially available antibodies that we demonstrate cross-react with APOL2. Genetic variants G1 and G2 of Apolipoprotein L1 (APOL1) account for the majority of racially disparate chronic kidney diseases in African Americans. Multiple mechanisms of kidney podocyte cytotoxicity by APOL1 variant overexpression have been proposed, each involving different subcellular compartments. It is unclear which compartment endogenous podocyte APOL1 resides in because previous immunolocalization studies either utilized overexpressed protein or commercially available antibodies that we demonstrate cross-react with APOL2.
[0849] APOL1 is found in human kidney podocytes and endothelia. Both endogenous podocyte and transfected APOL1 isoforms vA and vB1 (and a little of isoform vC) localize to the luminal face of the endoplasmic reticulum and to the cell surface, but not to mitochondria, endosomes or lipid droplets. By contrast, APOL2 and isoforms vB3 and vC of APOL1 localize to the cytoplasmic face of the endoplasmic reticulum and are consequently absent from the cell surface. APOL1 knockout podocytes lack staining, attesting to staining specificity. Stable re-transfection of knockout podocytes with inducible APOL1-G0, G1 and G2 showed no differences in localization between variants. APOL1 is found in the ER and plasma membrane, potentially supporting the surface cation channel or ER stress models of APOL1-mediated cytotoxicity.
[0850] End-stage renal disease disparately affects African Americans compared to European Americans, in large part due to risk variants G1 and G2 in the APOL1 gene (wild type being designated G0) that are associated with non-diabetic kidney diseases (refs. 52-53). Generation of therapeutics for these APOL1 nephropathies first requires a better understanding of the mechanism of action of APOL1 (refs. 54-55).
[0851] Evidence supports that expression of APOL1 in kidney podocytes, rather than circulating APOL1, is likely responsible for kidney disease (54-58). In vitro overexpression of either APOL1 risk variant is usually more cytotoxic than G0 in many cell types, including podocytes (59-62). More compellingly, APOL1 variants induced to high levels specifically in mouse podocytes in vivo leads to proteinuria and glomerular pathology resembling human focal segmental glomerulosclerosis (59).
[0852] A variety of putative mechanisms have been proposed to explain APOL1 variant-dependent cytotoxicity, all involving different subcellular compartments (55). These include endoplasmic reticulum (ER) stress; mitochondrial dysfunction (63-64, 72); enhanced cell surface suPAR/integrin binding (65); surface cation efflux channel activity (62, 66); cholesterol accumulation (67) and defects in endosomal maturation, autophagosome flux or lysosomal permeability (59, 60, 62, 68, 69, 70). Accordingly, APOL1 has been variously immunolocalized to the ER (63, 71, 72), mitochondria (63, 64, 73), lipid droplets (74), early and late endosomes (59, 73, 75) and by biochemistry to the plasma membrane (66). However, most studies used overexpressed APOL1, which may not traffic normally, and the antibodies were not characterized for cross-reactivity with related APOL family members. Those antibodies reportedly stained endogenous APOL1 in podocytes, endothelial cells and proximal tubules of human kidneys (76, 77), but we found they also recognize APOL2, thereby calling into question whether APOL1 is truly expressed there.
[0853] Here we characterized 80 antibodies specific to APOL1 by immunofluorescence and demonstrate that APOL1 is expressed in endothelial cells and podocytes, specifically in the podocyte ER and plasma membrane, although two N-terminal splice isoforms are cytoplasmic. Our data thus potentially favor the ER stress or surface cation channel models of cytotoxicity.
[0854] Methods
[0855] Cell Culture
[0856] Human immortalized podocytes (AB 8/13) were obtained under license from Moin Saleem (81) and were not genetically confirmed in our laboratory, although we periodically verified that they stained normally by immunofluorescence for podocin and synaptopodin after differentiating at 38° C. for 14-15 days. They were grown at 33° C., feeding 3× a week with fresh growth medium (RPMI with 10% FBS (Seradigm IXL9/06807/GEN), 1% glutamine, 1% pen/strep (Gibco 15140-122), 1% insulin, transferrin, selenium (Gibco 41400-045) and discarded after passage 29 due to loss of APOL1 expression with time. APOL1 CRISPR knockout podocytes and generation of doxycycline-inducible iAPOL1-G0, G1 and G2 podocyte and CHO stables are described in Example 1. The same methods were used to generate iAPOL1 podocytes stably transfected with inducible (non-spliceable) cDNAs for each N-terminal isoform (see Table 5). These podocytes require tetracycline-free FBS and 5 μg/ml puromycin in the medium.
[0857] STR-validated COS7 cells were obtained from Genentech, Inc. and maintained in high glucose DMEM, 10% FBS, 1% glutamine, 1% non-essential amino acids (Sigma M7145). Transfection of APOL DNAs (listed in Table 3) was achieved by plating 0.9×10.sup.4 COS7 cells/well in 8-well LabTekII slides for 24 h, then adding pre-mixed 0.7 μl Fugene HD (Promega E231A) with 0.25 μg DNA per well for 2 days. JHH-1 cells were cultured as in Example 1.
[0858] APOL1 cDNA Cloning
[0859] All available APOL cDNAs were obtained as summarized in Table 5 below (APOL5 was unavailable). Where indicated, sub-cloning into mammalian expression vectors with C-terminal myc-FLAG tags (Origene; or C-terminal myc only for APOL4) was achieved using EcoRI and XhoI restriction sites. The APOL1 splice isoforms were all untagged. All constructs were verified by Sanger sequencing.
[0860] Commercial Antibodies
[0861] Commercial anti-APOL1 antibodies were rabbit polyclonals from Sigma (HPA018885, lots E103963 and E105900, used at 0.4 μg/ml for IF and 2 μg/ml for western); and Proteintech (11486-2-AP, lot 00048412, used at 1 μg/ml for IF and 0.44 μg/ml for western); and rabbit monoclonal EPR2907(2) lot GR145110-2 from Epitomics at 2 μg/ml for both IF and western). Compartment marker antibodies were rabbit anti-calnexin (Abcam Ab25595, 0.25 μg/ml [validated in our lab by colocalization with GFP-Calnexin (data not shown) and subsequently shown by Abcam to give no signal in calnexin knockout cells]); rabbit anti-PDI (protein disulfide isomerase; 1:200 Stressgen SPA-890 [validated by colocalization with calnexin]); mouse anti-transferrin receptor H68.4 (1:250 Invitrogen 13-6800 [validated by colocalization with internalized Alexa488-transferrin ligand (data not shown)]); rabbit anti-perilipin-2 (Proteintech 15294-1-AP at 1.74 μg/ml for IF and 0.08 μg/ml for western [validated in
[0862] Anti-APOL1 Mouse Monoclonal Antibody Generation
[0863] Mouse monoclonals were generated to his.sub.6-APOL1 (aa 61-398 of NM_003661) as described in Example 1 above. The best 35 mouse monoclonals were sequenced and cloned into a murine IgG.sub.2a expression vector with effectorless L234A, L235A, P329G (LALAPG) mutations as previously described (103-104), with 22 cloned antibodies successfully recognizing APOL1. To enable triple labeling with other species, the Fab regions of some of the best cloned antibodies were sub-cloned into rabbit IgG and/or rat IgG.sub.2b backbones for expression in CHO cells and purification by protein-A affinity chromatography. The unpaired cysteines in the reformatted rabbit antibodies were paired by mutation of residue 80 to cysteine (P80C in rabbit 3.7D6, and A80C in rabbit 3.1C1 and 3.1C7).
[0864] Anti-APOL1 Rabbit Monoclonal (Rabmab) Antibody Generation (Method #5)
[0865] Two rabbits were immunized 5 times each (at Lampire Biological Laboratories) with 0.5 mg of the above his.sub.6-APOL1 antigen, except the 4.sup.th and 5.sup.th boosts were with fixed antigen in order to maximize immunofluorescence reactivity. For fixation, paraformaldehyde from a 16% stock was diluted into 1 mg of his.sub.6-APOL1 to 3% final for 20 min at room temperature and 10 min on ice, then PFA was removed by dialysis in APOL1 buffer (20 mM Tris-Cl pH 7.5, 150 mM NaCl, 0.1% DDM (n-Dodecyl-β-D-maltoside)) in a 10,000 MWCO membrane (Pierce).
[0866] Rabbit monoclonals were generated from APOL1-immunized rabbits by the B-cell cloning technology. Peripheral blood mononuclear cells (PBMCs) were isolated from rabbit whole blood after Ficoll density centrifugation. The PBMCs were washed in PBS, then resuspended in FACS buffer (2% FCS in PBS) and stained with FITC-labeled anti-rabbit IgG (AbD Serotec, BioRad). After washing, the cells were resuspended in FACS buffer containing Propidium Iodide. Live single IgG-positive B cells were sorted into 96-well culture plates using a FACSAria sorter (BD Biosciences). After the B cells were cultured in B cell culture medium (Genentech) for a week, the supernatants were screened by ELISA for APOL1 binding. The B cells in each well were lysed in 100 μl RLT buffer (Qiagen, Hilden, Germany) and immediately frozen at −80° C. for storage until molecular cloning. Variable regions (VH and VL) of each ELISA-positive monoclonal antibody were cloned into expression vectors from extracted mRNA as previously described (105). Individual rabbit antibodies were recombinantly expressed in 1 ml Expi293 cells and were subsequently purified with a protein A type resin in a high throughput manner. IF-positive clones were selected for scale up (30 m1) and were purified on a protein A column followed by size exclusion chromatography to remove any protein aggregates.
[0867] Antibodies were screened for immunofluorescence by testing at 1 μg/ml on COS cells transiently expressing APOL1 or APOL2 with the methanol protocol and the positives re-tested with PFA/Triton X-100. To rank the antibodies by sensitivity, lower expressing iAPOL1-CHO stables (see Example 1) were stained with the PFA/Saponin method. The strongest few were used to stain endogenous APOL1 in podocytes.
[0868] RT-PCR
[0869] Flash frozen normal post-mortem human kidneys were obtained under agreement from the University of Michigan (3 females, aged 47, 50 and 62; and two males aged 62 and 63). Total RNA was extracted from tissue or cells using RNeasy mini kit (Qiagen, Valencia, Calif.). On-column genomic DNA digestion was performed during purification using RNAse-free DNAse set (Qiagen) and cDNA synthesis was done using the High Capacity Reverse Transcription Kit (Applied Biosystems, Foster City, Calif.) with the provided random hexamer primers. Quantitative PCR reactions were performed by Taqman analysis in triplicate, using APOL-specific probes (ThermoFisher Scientific) on an ABI PRISM sequence detection system (Applied Biosystems). We validated the APOL family probe specificities (catalog numbers: L1 is Hs1066280_m1; L2 is Hs00603146_m1; L3 is Hs00600896_m1; L4 is Hs00540930_m1; L5 is Hs00229052_m1; and L6 is Hs00229051_m1) on cDNAs encoding all the family members (
[0870] In-Situ Hybridization
[0871] FFPE fixed normal post-mortem male (aged 47 and 59) human kidneys were obtained under agreement from the MT group (Van Nuys, Calif.) with ethics committee approval and informed consent. Kidneys or cell pellets sectioned onto slides at 5 μm were loaded into a Leica BondRx autostainer and baked and dewaxed. Slides were pre-treated with ER2 at 95° C. for 15 min and Leica Enzyme at 40° C. for 15 min. Probes (all RNAScope® LS 2.5 probes from Advanced Cell Diagnostics) were hybridized at 42° C. for 120 min: APOL1 (Hs-APOL1-02-C2, cat #569168-C2, nt 768-1431 of NM_003661.3, 10zz); Hs-NPHS2 (cat #556538, nt 268-1172 of NM_014625.3, 20zz); Hs-EGLF7 (cat #314008, nt 14-1356 of NM_016215.4, 14zz). RNAScope 2.5 LS Duplex Reagent kit (cat #2005835) was used for detecting signal. We verified that the APOL1 probe did not cross-react with APOL2 and was capable of detecting endogenous APOL1 in podocytes (
[0872] Immunohistochemistry
[0873] For antibody screening, a mini array of FFPE cell pellets was generated, including untransfected CHO cells, iAPOL1-G0 CHO stables (see Example 1), transiently transfected APOL2 CHO cells, WT podocytes without and with IFNγ stimulation (26 h at 100 ng/ml) and IFNγ-stimulated APOL1 KO podocytes. To generate the cell pellets ten 15 cm dishes of CHO cells were Lipofectamine transfected with 12 μg APOL2 DNA per dish for 48 h; or doxycycline-induced iAPOL1-CHO stable cell lines were used. Cells were detached with 5 mM EDTA in PBS, pelleted, then formalin fixed and paraffin embedded (FFPE) using standard methods. The generation of APOL1-G0 BAC transgenic C57BL/6 mice (under the human APOL1 promoter, which express APOL1 similarly to humans in liver, kidney and lung) will be described elsewhere (see also ref 106). All the murine hybridoma supernatants and cloned rabmabs were screened at 5 μg/ml on the Thermo Fisher AutoStainer with DAKO Target Retrieval solution and ABC-HRP detection.
[0874] The optimized protocol for IHC was performed on a Thermo Fisher AutoStainer. After 20 minutes of heat induced antigen retrieval at 99° C. in DAKO Target Retrieval solution, primary anti-APOL1 rabmab 5.17D12 was incubated at 0.5 μg/ml for 60 min at room temperature, followed by a secondary biotinylated donkey anti-rabbit antibody (Jackson ImmunoResearch 711-066-152) at 5 μg/ml for 30 minutes, then Streptavidin-HRP for 30 minutes and a 3 min amplification step with TSA (Perkin Elmer). The chromogen was DAB. FFPE normal human kidneys were obtained under agreement from Folio and Cureline from 2 females and 3 males, aged 64-89.
[0875] Immunofluorescence
[0876] Cells were plated on LabTekII (Nalge Nunc 154534) slides and fixed at 70-100% confluency. For mAb screening, cells were fixed/permeabilized for 5 min in −20° C. methanol (EMD MX0485-6). For all other experiments, cells were fixed in 3% paraformaldehyde in PBS (EMS 15710) for 20 mins at room temperature, quenched with 50 mM NH.sub.4Cl in PBS for 10 mins, then permeabilized with 0.1% TX-100 in PBS for 4 mins or for 1h in saponin buffer [0.4% saponin (Sigma S7900), 1% bovine serum albumin (BSA; Sigma A2153), 2% fetal bovine serum (Seradigm) in PBS]. First antibodies (stored sterile at 4° C.) were applied for 1 h at room temperature, at 1 μg/ml for screening on transfected cells or at subsequently optimized concentrations for detecting endogenous APOL1. After 3×10 min washes in PBS (for Methanol or TX-100 protocols) or saponin buffer (saponin protocol), secondary antibodies were applied at 1.88 μg/ml for 1 h at room temperature, washed 3× and mounted under No. 1.5 coverslips in ProLong Gold with DAPI (4′,6-diamidino-2-phenylindole; Life Technologies P36931). Secondary antibodies (stored at −20° C. in 50% glycerol), all highly cross-adsorbed donkey F(ab′).sub.2 anti H&L from Jackson Immunoresearch, included Alexa488 anti-mouse (715-546-150), Alexa488 anti-mouse additionally cross-adsorbed against rat (715-546-151), Alexa488 anti-rabbit (711-546-152), Cy3 anti-mouse (715-166-150), Cy3 anti-rabbit (711-166-152), Cy3 anti-rat (minimally cross-reactive with mouse, 712-166-153), Cy3 anti-goat (705-166-147), Alexa647 anti-rabbit (711-606-152), Dy649 anti-rabbit (712-496-153), Alexa647 anti-mouse (715-606-150 or 715-606-151 for co-staining with rat antibodies). For triple labeling of ER and mitochondria, isotype-specific mouse secondaries were employed: Alexa488 anti-IgG.sub.2a (Invitrogen A21131) for murine 4.17A5 and Alexa555 anti-IgG.sub.1 (Invitrogen A21127) for cytochrome c and Alexa649 anti-rabbit for calnexin. Alternatively rat 4.17A5 and Cy3 anti-rat were used (
[0877] For selective permeabilization of the plasma membrane the concentration of digitonin was first optimized by ensuring free GFP leached out of the cells pre-fixation, while ER-targeted GFP-Calnexin with luminal GFP (101) was only detectable by GFP fluorescence and not anti-GFP antibodies in the red channel (data not shown). The optimal concentration for COS cells was 0.0025% (20 μM) and was applied for 4 min in place of TX-100 in KHM buffer (110 mM potassium acetate, 20 mM Hepes pH 7.4, 2 mM MgCl.sub.2) (84).
[0878] COS cells were imaged on an AxioM2 imaging system (Zeiss) with a 60× PlanAPO NA 1.4 objective, standard DAPI/FITC/Cy3/Cy5 filter sets and a PhotoMetrics HQ2 camera managed by SlideBook (v5.5). Podocyte and CHO cells were imaged by spinning disc confocal microscopy (3i W, Zeiss AxioObserver M1 microscope with Yokogawa W1 spinning disc) with a 63× PlanAPO N.A. 1.4 oil objective and 405, 488, 561 and 640 nm lasers powered by SlideBook (v6). The camera was a Hamamatsu FLASH 4.0 sCMOS.
[0879] Electron Microscopy
[0880] For iEM, 1.4×10.sup.6 HEK-293 cells in T25 flasks were reverse transfected with 5.4 μg APOL1 or APOL2 cDNA with 12 μl Fugene 6 (Roche 11814443001) for 50 h or 65 h, respectively. Podocytes and transiently transfected HEK-293 cells were fixed with 4% paraformaldehyde in 0.1M phosphate buffer (PB), pH 7.4, for 2 h at room temperature, then overnight at 4° C., and with 2% paraformaldehyde, 0.2% glutaraldehyde in 0.1 M phosphate buffer (PB), pH 7.4, for 2 h at room temperature, respectively. Fixations were continued in 1% PFA in 0.1 M PB at 4° C. for several days. The cells were scraped, pelleted, embedded in 12% gelatin, cryoprotected with 2.3 M sucrose, mounted on aluminum pins and frozen in liquid nitrogen. Ultrathin cryosections were cut at −120° C. and stained with anti-APOL1 antibodies followed by protein-A gold particles (10 nm). For quantitation, random images of APOL1/2 expressing HEK-293 cells and podocytes were made. The positions of at least 50 gold particles per antibody were scored as either (i) OMF: overlapping on outer ER membrane surface and cytosol, or located in the cytosol at a distance ≤15 nm between outer ER membrane surface and the 10 nm gold particle surface; (ii) IMF: overlapping on inner ER membrane surface and ER lumen, or located in the lumen at a distance ≤15 nm between inner ER membrane surface and gold particle surface; or (iii) Lumen: within the ER lumen, with a distance >15 nm between the 10 nm gold particle surface and the nearest inner ER membrane surface. Two investigators independently performed the quantification procedure. Their percent scores of gold particles on the ER were averaged and the results were plotted as a line chart for each antibody.
[0881] Flow Cytometry
[0882] Live cells were stained on ice with 1 μg/ml 3.6D12 for 1 h, washed and detected with 1 μg/ml Alexa488 anti-mouse (Invitrogen A11029). Flow cytometry was performed as in Example 1.
[0883] Western Blotting
[0884] Cells were lysed in native RIPA (1% NP-40 buffer) as in Example 1, except they were run on 10%, 12% or 4-20% Tris-Glycine gels with See Blue Plus 2 molecular weight markers (Invitrogen LC5925); or on 4-12% Bis-Tris gels in MOPS buffer with Precision Plus protein Kaleidoscope markers (BioRad #1610375). The best anti-APOL1 antibody was a mixture of cloned rabbit 3.1C1 and 3.7D6 (at 0.05 μg/ml each).
[0885] Podocyte Fractionation
[0886] 150×15 cm dishes of IFNγ-induced WT podocytes were harvested by trypsinization, manually homogenized in 10 ml (in 5×2 ml batches) IB.sub.cells-1 buffer (225 mM mannitol, 75 mM sucrose, 30 mM Tris-Cl, 0.1 mM EGTA, pH 7.4) with 50 strokes of a Teflon Potter-Elvehjem #22 tissue grinder, sonicated (3×10 sec at speed 3.5 in Branson 450 sonifier), then fractionated according to the protocol of Wieckowski et al (107). Briefly, the crude mitochondria from the 10,000 g pellet were separated from the MAM by fractionation on a 30% Percoll gradient at 95,000 g for 30 mins; while the ER was collected from the mitochondrial supernatant by centrifugation at 100,000 g. 10 μg of each fraction (judged by the BCA assay, Pierce) was loaded on 4-20% Tris-Glycine gels and probed with suitable compartment markers.
[0887] Results
[0888] Kidney Podocytes Express APOLs 1, 2, and 6
[0889] APOL1 is the only secreted member of the human APOL family, comprising APOL1-APOL6 (78-80), and is most closely related to APOL2 (53% protein identity; Table 3). RT-PCR confirmed that APOLs 1,2,3 and 6, but not APOL4 or 5, mRNAs are expressed in normal human kidneys (
TABLE-US-00004 TABLE 3 c) APOL gene homologies and plasmid sources Antigen % ID with APOL C-term Source of % ID equivalent ApoL1 % similarity gene Tag Vector cDNA Accession FLS* aa antigen with antigen APOL1 none.sup.@ pCMV6- Origene NM_003661.sup.# 100 61-398 100 100 XL5 SC109941 NP_003652 APOL2 none.sup.@ pCMV6- Origene NM_145637.sup.& 53 1-337 61 65 XL4 SC124549 NP_663612 APOL3.v2 Myc-FLAG pCMV6- Origene NM_014349 40 1-331 47 53 Entry RC208325 NP_663614 APOL4.v1 Myc pReceiver- Genecopoeia NM_030643 36 24-348 39 43 M09 Z4913 NP_085146 APOL5 n/a n/a n/a NP_085145 20 16-358 25 21 (of 433) APOL6 Myc-FLAG pCMV6- Origene NM_030641 24 1-298 30 31 Entry RC208481 NP_085144 (of 343) *abbreviations: FLS, full length sequence; ID, identity; n/a, DNA clone not available. .sup.#The APOL1 (v1) antigen (in a baculovirus vector) comprising amino acids 61-298 of APOL1 G0 isoform A (actual refseq NM_003661) with an N-terminal his.sub.6 tag was used for immunization. DNA sequencing of the Origene purported NM_003661 isoform A clone in pCMV6-XL5, on which antibodies were screened by IF, revealed it to actually be sequence BC1430381, containing three common SNPs: E150K (rs2239785), M228I (rs136175) and R255K (rs136176) (refs. 110-112) .sup.&The sequenced Origene APOL2 clone has an I245V change (rs132760) from the expected NM_145637 sequence. .sup.@We also sub-cloned APOL1 and APOL2 into myc-FLAG/pCMV6-Entry (tagged at C-terminus) in place of APOL3 by PCR using EcoR1 and Xho1 sites. n/a: No commercially available cDNA was found for APOL5, but it is closely related to APOL6, which was negative with all antibodies tested.
[0890] In differentiated immortalized human podocytes (81), only APOL1 and APOL2 mRNAs were detected (
[0891] Many Anti-APOL1 Antibodies Cross-React with APOL2
[0892] Unfortunately, all three commercial rabbit antibodies used in previous reports (59, 72, 73, 76, 77) do cross-react with APOL2 (
[0893] The most sensitive APOL1-specific antibodies for IF were rabmab 5.17D12, and mAbs 4.17A5 and 3.7D6 (
TABLE-US-00005 TABLE 4 d) Anti-APOL1 antibody crossreactivities by immunofluorescence Antibody Species* Domain.sup.$ APOL1 APOL2 APOL3 APOL4 APOL6 5.17D12 Rabmab PFD +++ — — — — 3.7D6 Mouse, rabbit PFD +++ — — — — (P80C), rat 4.17A5 Mouse, rat PFD ++++ — — + — 3.6D12 Mouse PFD ++++ +++ + + — 5.17H8 Rabmab PFD ++++ ++ ± ± — 3.5C10 Mouse PFD ++++ +++ + + — 3.3A8 Mouse MAD +++ ++ — — — 4.2C4 Mouse PFD +++ # — — — 3.6E10 Mouse SRA-ID +++ — — — — linker 3.1C1 Mouse, rabbit SRA-ID ++ — — — — (A80C) rat linker 3.1C7 Mouse, rabbit SRA-ID ++ — ± — — (A80C) rat linker 4.12E5 Mouse SRA-ID.sup.& ++ — — — — Sigma Rabbit MAD- ++ +{circumflex over ( )} — — — HPA018885 SRA-ID Epitomics Rabmab SRA-ID ++ ++ — — — EPR2907(2) Proteintech Rabbit PFD ++++ ++++ ++ ± — 11486-2-AP * The first listed species is the original; any subsequent ones were sub-cloned. The subcloned rabbit antibodies were mutated to cysteine at residue 80 to avoid unpaired cysteines. .sup.$See Gupta et al. for domain mapping. PFD, pore-forming domain (aa 60-235); MAD, membrane addressing domain (aa 240-303); SRA-ID, SRA-interacting domain (aa 305-398, including MAD-SRA-ID linker). # 4.2C4 cross-reacts with APOL2 with PFA/Saponin and by immunoelectron microscopy (but not with PFA/Triton X-100, shown in FIGS. 31A-B). .sup.&4.12E5 does not recognize APOL1-G2 very well by FACS or Western (although it does to a certain extent by IF and IHC (data not shown)) {circumflex over ( )}Sigma antibody only cross-reacts with APOL2 with PFA, not methanol fixation. ++++, very strong; +++ strong; ++ moderate; + weak; ± only cross-reacts with very high over-expressers; n.d., not determined.
[0894] APOL1-Specific Antibodies Reveal APOL1 is in Podocytes, Mainly Restricted to the ER
[0895] Of 170 antibodies screened for APOL1-specificity by immunohistochemistry, 5.17D12 was the best (
[0896] Subcellularly, APOL1-G0, G1 and G2 expressed transiently in COS cells appeared almost exclusively in the endoplasmic reticulum (ER), including the nuclear envelope, with all 130 IF-positive antibodies, colocalizing with the ER-specific marker calnexin, but not other compartments (
[0897] Importantly, ER-localized APOL1 was not merely an overexpression artifact because endogenous APOL1 was similarly ER-localized in both differentiated and undifferentiated podocytes (
[0898] APOL1, but not APOL2, is on the Extracellular Face of the Plasma Membrane
[0899] Despite not detecting APOL1 at the plasma membrane by IF in any of these (permeabilized) cell lines, most antibodies recognized surface APOL1 by flow cytometry of unpermeabilized WT (but not APOL1-KO) podocytes and stable cell lines (Example 1). APOL2-cross reactive 3.6D12 likewise did not shift on APOL1 KO podocytes (which retain APOL2), indicating that APOL2, is not found on the cell surface (
[0900] APOL1 and APOL2 Localize to Opposite Faces of the ER Membrane
[0901] Since only APOL1 was found on the cell surface, but both APOL1 and APOL2 appeared ER-localized, we examined whether APOL2 localizes to the outer (cytoplasmic) face of the ER by permeabilizing APOL2-transfected COS cells with digitonin, which selectively permeabilizes the plasma membrane, leaving the ER membrane intact (84) (
[0902] By contrast, all 80 APOL1-specific antibodies gave nuclear membrane (plus plasma membrane if high affinity) instead of ER signal with digitonin permeabilization (
[0903] Significantly, endogenous APOL1 and APOL2 were also on the luminal and cytoplasmic faces of the ER, respectively, in digitonin permeabilized podocytes (
[0904] APOL1 Isoforms have Different ER Topologies
[0905] It has been proposed that APOL1 risk variants bind less well than G0 to the vesicle-SNARE VAMPS, resulting in inhibition of endosomal trafficking as a putative mechanism of risk variant pathology (73). However, vesicle-SNAREs are all cytoplasmically oriented, whereas we clearly showed above that APOL1 is not. A caveat is that we likely detected the major reference isoform (vA or v1), whereas IFNγ stimulation of podocytes renders three minor splice variants of APOL1 (isoforms vB1, vB3 and vC) (61, 85) detectable. These differ in their N-termini, so may not all be secreted, meaning they might be cytoplasmic and accessible to VAMPS, thus needed evaluating (
TABLE-US-00006 TABLE 5 e) APOL1 isoform information and signal sequence predictions Signal P-4.1 iPSORT score D-score Predicted Luminal APOL1 Vector/ FLS* (cutoff = (cutoff = Secretome ss mature by IF? isoform Form Source Accession aa 0.953).sup.& 0.45) .sup.$ P2.0.sup.@ (aa) MW (Da) Ψ vA (v1) RefSeq pCMV6-XL5 NM_003661.sup.# 398 Yes (2.007) Yes (0.853) Yes 27 41,111 Yes (Origene NP_003652 (Δss) SC109941) vV1 (v2) + pcDNA3.1 NM_145343 414 No (−0.8) No (0.36) Yes 43 41,111 Yes Exon2 (GenScript) NP_663318 (Δss) vB3 (v2-3) + pcDNA3.1 KX192151.sup.# 396 No (−0.8) No (0.22) No 0 44,084 No Exon2 (GenScript) APY18924 ΔExon4 vC (v4) ΔExon4 pcDNA3.1 NM_001136541 380 Yes (1.233) Yes (0.467) Yes 0 or 42,140 Yes & (Genscript) NP_001130013 21 39,831 No (Δss) *abbreviations: FLS, full length sequence; aa, amino acids; ss, signal sequence; IF, immunofluorescence; MW, molecular weight; Δss, after removal of signal sequence. .sup.#DNA contains the three common SNPs E150K (rs2239785), M228I (rs136175) and R255K (rs136176). .sup.&iPSORT prediction for presence of N-terminal signal sequence (63). Values above 0.953 are predicted to have a signal sequence (Yes). Note that this algorithm only considers the first 30 aa of the protein, thus APOL1.vB1 is wrongly predicted as non-secreted because its signal sequence is 43 aa. .sup.$ Signal P-4.1 prediction for N-terminal signal sequence (64). This algorithm evaluates the first 70 aa of the protein. .sup.@Secretome P2.0a for non-classical mammalian protein secretion- yes or no refers to a warning given for prediction of a classical signal sequence (65). Ψ Luminal (right hand column and FIGS. 27A-D) refers to the results of whether the protein is in the ER lumen as deciphered by IF with digitonin (and not on the plasma membrane by FACS) and show that the signal prediction programs were partly correct, but failed to recognize the abnormally long 43aa signal sequence in vB1 and predicted vC as secretory, when in fact only a small proportion is luminal, the majority being cytoplasmic.
[0906] It has been shown that all four isoforms are secreted into the media upon transient overexpression in HEK-293 cells (85). However, as the authors suggested (85), this may be an overexpression artifact, since we obtained the same result in transiently transfected COS cells, but not in stable cell lines. In iAPOL1 podocytes individually expressing each of the APOL1 isoforms (all of which localized to the ER,
[0907] The ER-luminal localization of stable APOL1.vB1 in podocytes agrees with its identical size to vA by western blot (
[0908] WT podocytes were western blotted to determine which endogenous APOL1 isoforms are detectable. The major band is the size of vA, as expected, but longer exposures revealed a minor upper band uniquely after IFNγ treatment, which could only represent vB3 if it were a splice isoform, and is indeed similar in size (
[0909] Discussion of Results
[0910] We characterized multiple APOL1-specific antibodies to investigate the localization of APOL1. At the tissue level, in agreement with previous reports (59, 73, 76, 77, 86) we found APOL1 mRNA and protein in liver hepatocytes and podocytes of kidneys, but think it is biosynthetic (secretory) rather than endocytic. By contrast, we found no APOL1 protein or mRNA in proximal tubules, suggesting proximal tubule staining with the commercial polyclonals (73, 77) may be APOL2 cross-reactivity or simply non-specific (
[0911] Subcellularly, the major (reference) isoform, APOL1.vA, was consistently (endogenously, transiently and stably expressed) found within the ER, with a small proportion (<20% estimated by comparative FACS of permeabilized and unpermeabilized cells;
[0912] Since in trypanosomes (88) and in lipid membranes in vitro (89-90), APOL1 only inserts into membranes at acidic pH, we expected APOL1 to be soluble in the neutral (91) ER lumen. However, quantitative iEM revealed APOL1.vA is on the inner ER membrane, although some was released into the cytosolic fraction by sonication (
[0913] There was no significant overlap by either IF or iEM of endogenous podocyte APOL1 or transfected APOL1.vA with mitochondria, lipid droplets, or endosomes, organelles reported by others to harbor APOL1 (59, 64, 73, 74). This suggests the more abundant APOL2 and/or inappropriate staining procedures, epitope tags, transfection artifacts or different cell types may have contributed to those results. APOL1 was recently found in crude mitochondrial pellets, dependent on the mitochondrial import machinery (94). We suspect those “mitochondria” may actually be the MAM (a sub-domain of the ER closely apposed to mitochondria (83), since in our hands mitochondria purified away from the MAM contain no detectable APOL1 (
[0914] GFP-APOL1 (without a signal sequence (Δss)) previously localized to the ER was interpreted as signal-sequence independent ER targeting (63), but we show that APOL1 Δss (as well as isoforms vB3, vC and APOL2) is topologically distinct, associating with the outer, not inner, ER membrane (
[0915] Our localization data favor either the ER stress (72, 100) or cell surface cation channel models (62, 66) for APOL1-variant mediated cytotoxicity. There was no differential localization between variants, in agreement with other studies (63, 64, 73), so the function or magnitude of variant effects presumably differ. Determining where APOL1 resides within podocytes in vivo will be important; for example, whether it colocalizes with basement membrane integrins (65). Studying the subcellular localization of APOL1 in primary podocytes from APOL1 nephropathy patients that have sustained a “second hit” and establishing if APOL1 protein is upregulated in APOL1 risk variant kidneys would also be informative.
[0916] In summary, we have generated the first APOL1-specific antibodies sensitive enough to detect endogenous podocyte APOL1. These will be useful tools for future investigations of APOL1 localization and identification of interaction partners without interference from APOL2 binding that has plagued previous studies.
REFERENCES FOR EXAMPLE 2
[0917] 52. Genovese, G.; Friedman, D. J.; Ross, M. D.; Lecordier, L.; Uzureau, P.; Freedman, B. I.; Bowden, D. W.; Langefeld, C. D.; Oleksyk, T. K.; Uscinski Knob, A. L.; Bernhardy, A. J.; Hicks, P. J.; Nelson, G. W.; Vanhollebeke, B.; Winkler, C. A.; Kopp, J. B.; Pays, E.; Pollak, M. R., Association of trypanolytic ApoL1 variants with kidney disease in African Americans. Science 2010, 329 (5993), 841-5. [0918] 53. Tzur, S.; Rosset, S.; Shemer, R.; Yudkovsky, G.; Selig, S.; Tarekegn, A.; Bekele, E.; Bradman, N.; Wasser, W. G.; Behar, D. M.; Skorecki, K., Missense mutations in the APOL1 gene are highly associated with end stage kidney disease risk previously attributed to the MYH9 gene. Hum Genet 2010, 128 (3), 345-50. [0919] 54. Heymann, J.; Winkler, C. A.; Hoek, M.; Susztak, K.; Kopp, J. B., Therapeutics for APOL1 nephropathies: putting out the fire in the podocyte. Nephrol Dial Transplant 2017, 32 (suppl_1), i65-i70. [0920] 55. Kruzel-Davila, E.; Skorecki, K., Dilemmas and challenges in apolipoprotein L1 nephropathy research. Curr Opin Nephrol Hypertens 2019, 28 (1), 77-86. [0921] 56. Kopp, J. B.; Heymann, J.; Winkler, C. A., APOL1 Renal Risk Variants: Fertile Soil for HIV-Associated Nephropathy. Semin Nephrol 2017, 37 (6), 514-519. [0922] 57. Shukha, K.; Mueller, J. L.; Chung, R. T.; Curry, M. P.; Friedman, D. J.; Pollak, M. R.; Berg, A. H., Most ApoL1 Is Secreted by the Liver. J Am Soc Nephrol 2017, 28 (4), 1079-1083. [0923] 58. Aghajan, M.; Booten, S. L.; Althage, M.; Hart, C. E.; Ericsson, A.; Maxvall, I.; Ochaba, J.; Menschik-Lundin, A.; Hartleib, J.; Kuntz, S.; Gattis, D.; Ahlstrom, C.; Watt, A. T.; Engelhardt, J. A.; Monia, B. P.; Magnone, M. C.; Guo, S., Antisense oligonucleotide treatment ameliorates IFN-gamma-induced proteinuria in APOL1-transgenic mice. JCI Insight 2019, 4 (12). [0924] 59. Beckerman, P.; Bi-Karchin, J.; Park, A. S.; Qiu, C.; Dummer, P. D.; Soomro, I.; Boustany-Kari, C. M.; Pullen, S. S.; Miner, J. H.; Hu, C. A.; Rohacs, T.; Inoue, K.; Ishibe, S.; Saleem, M. A.; Palmer, M. B.; Cuervo, A. M.; Kopp, J. B.; Susztak, K., Transgenic expression of human APOL1 risk variants in podocytes induces kidney disease in mice. Nat Med 2017, 23 (4), 429-438. [0925] 60. Lan, X.; Jhaveri, A.; Cheng, K.; Wen, H.; Saleem, M. A.; Mathieson, P. W.; Mikulak, J.; Aviram, S.; Malhotra, A.; Skorecki, K.; Singhal, P. C., APOL1 risk variants enhance podocyte necrosis through compromising lysosomal membrane permeability. Am J Physiol Renal Physiol 2014, 307 (3), F326-36. [0926] 61. Nichols, B.; Jog, P.; Lee, J. H.; Blackler, D.; Wilmot, M.; D'Agati, V.; Markowitz, G.; Kopp, J. B.; Alper, S. L.; Pollak, M. R.; Friedman, D. J., Innate immunity pathways regulate the nephropathy gene Apolipoprotein L1. Kidney Int 2015, 87 (2), 332-42. [0927] 62. Olabisi, 0. A.; Zhang, J. Y.; VerPlank, L.; Zahler, N.; DiBartolo, S., 3rd; Heneghan, J. F.; Schlondorff, J. S.; Suh, J. H.; Yan, P.; Alper, S. L.; Friedman, D. J.; Pollak, M. R., APOL1 kidney disease risk variants cause cytotoxicity by depleting cellular potassium and inducing stress-activated protein kinases. Proc Natl Acad Sci USA 2016, 113 (4), 830-7. [0928] 63. Granado, D.; Muller, D.; Krausel, V.; Kruzel-Davila, E.; Schuberth, C.; Eschborn, M.; Wedlich-Soldner, R.; Skorecki, K.; Pavenstadt, H.; Michgehl, U.; Weide, T., Intracellular APOL1 Risk Variants Cause Cytotoxicity Accompanied by Energy Depletion. J Am Soc Nephrol 2017, 28 (11), 3227-3238. [0929] 64. Ma, L.; Chou, J. W.; Snipes, J. A.; Bharadwaj, M. S.; Craddock, A. L.; Cheng, D.; Weckerle, A.; Petrovic, S.; Hicks, P. J.; Hemal, A. K.; Hawkins, G. A.; Miller, L. D.; Molina, A. J.; Langefeld, C. D.; Murea, M.; Parks, J. S.; Freedman, B. I., APOL1 Renal-Risk Variants Induce Mitochondrial Dysfunction. J Am Soc Nephrol 2017, 28 (4), 1093-1105. [0930] 65. Hayek, S. S.; Koh, K. H.; Grams, M. E.; Wei, C.; Ko, Y. A.; Li, J.; Samelko, B.; Lee, H.; Dande, R. R.; Lee, H. W.; Hahm, E.; Peev, V.; Tracy, M.; Tardi, N. J.; Gupta, V.; Altintas, M. M.; Garborcauskas, G.; Stojanovic, N.; Winkler, C. A.; Lipkowitz, M. S.; Tin, A.; Inker, L. A.; Levey, A. S.; Zeier, M.; Freedman, B. I.; Kopp, J. B.; Skorecki, K.; Coresh, J.; Quyyumi, A. A.; Sever, S.; Reiser, J., A tripartite complex of suPAR, APOL1 risk variants and alphavbeta3 integrin on podocytes mediates chronic kidney disease. Nat Med 2017, 23 (8), 945-953. [0931] 66. O'Toole, J. F.; Schilling, W.; Kunze, D.; Madhavan, S. M.; Konieczkowski, M.; Gu, Y.; Luo, L.; Wu, Z.; Bruggeman, L. A.; Sedor, J. R., ApoL1 Overexpression Drives Variant-Independent Cytotoxicity. J Am Soc Nephrol 2018, 29 (3), 869-879. [0932] 67. Ryu, J. H.; Ge, M.; Merscher, S.; Rosenberg, A. Z.; Desante, M.; Roshanravan, H.; Okamoto, K.; Shin, M. K.; Hoek, M.; Fornoni, A.; Kopp, J. B., APOL1 renal risk variants promote cholesterol accumulation in tissues and cultured macrophages from APOL1 transgenic mice. PLoS One 2019, 14 (4), e0211559. [0933] 68. Fu, Y.; Zhu, J. Y.; Richman, A.; Zhang, Y.; Xie, X.; Das, J. R.; Li, J.; Ray, P. E.; Han, Z., APOL1-G1 in Nephrocytes Induces Hypertrophy and Accelerates Cell Death. J Am Soc Nephrol 2017, 28 (4), 1106-1116. [0934] 69. Kruzel-Davila, E.; Shemer, R.; Ofir, A.; Bavli-Kertselli, I.; Darlyuk-Saadon, I.; Oren-Giladi, P.; Wasser, W. G.; Magen, D.; Zaknoun, E.; Schuldiner, M.; Salzberg, A.; Kornitzer, D.; Marelja, Z.; Simons, M.; Skorecki, K., APOL1-Mediated Cell Injury Involves Disruption of Conserved Trafficking Processes. J Am Soc Nephrol 2017, 28 (4), 1117-1130. [0935] 70. Wan, G.; Zhaorigetu, S.; Liu, Z.; Kaini, R.; Jiang, Z.; Hu, C. A., Apolipoprotein L1, a novel Bc1-2 homology domain 3-only lipid-binding protein, induces autophagic cell death. J Biol Chem 2008, 283 (31), 21540-9. [0936] 71. Cheng, D.; Weckerle, A.; Yu, Y.; Ma, L.; Zhu, X.; Murea, M.; Freedman, B. I.; Parks, J. S.; Shelness, G. S., Biogenesis and cytotoxicity of APOL1 renal risk variant proteins in hepatocytes and hepatoma cells. J Lipid Res 2015, 56 (8), 1583-93. [0937] 72. Wen, H.; Kumar, V.; Lan, X.; Shoshtari, S. S. M.; Eng, J. M.; Zhou, X.; Wang, F.; Wang, H.; Skorecki, K.; Xing, G.; Wu, G.; Luo, H.; Malhotra, A.; Singhal, P. C., APOL1 risk variants cause podocytes injury through enhancing endoplasmic reticulum stress. Biosci Rep 2018, 38 (4). [0938] 73. Madhavan, S. M.; O'Toole, J. F.; Konieczkowski, M.; Barisoni, L.; Thomas, D. B.; Ganesan, S.; Bruggeman, L. A.; Buck, M.; Sedor, J. R., APOL1 variants change C-terminal conformational dynamics and binding to SNARE protein VAMPS. JCI Insight 2017, 2 (14). [0939] 74. Chun, J.; Zhang, J. Y.; Wilkins, M. S.; Subramanian, B.; Riella, C.; Magraner, J. M.; Alper, S. L.; Friedman, D. J.; Pollak, M. R., Recruitment of APOL1 kidney disease risk variants to lipid droplets attenuates cell toxicity. Proc Natl Acad Sci USA 2019, 116 (9), 3712-3721. [0940] 75. Mikulak, J.; Oriolo, F.; Portale, F.; Tentorio, P.; Lan, X.; Saleem, M. A.; Skorecki, K.; Singhal, P. C.; Mavilio, D., Impact of APOL1 polymorphism and IL-1beta priming in the entry and persistence of HIV-1 in human podocytes. Retrovirology 2016, 13 (1), 63. [0941] 76. Ma, L.; Shelness, G. S.; Snipes, J. A.; Murea, M.; Antinozzi, P. A.; Cheng, D.; Saleem, M. A.; Satchell, S. C.; Banas, B.; Mathieson, P. W.; Kretzler, M.; Hemal, A. K.; Rudel, L. L.; Petrovic, S.; Weckerle, A.; Pollak, M. R.; Ross, M. D.; Parks, J. S.; Freedman, B. I., Localization of APOL1 Protein and mRNA in the Human Kidney: Nondiseased Tissue, Primary Cells, and Immortalized Cell Lines. Journal of the American Society of Nephrology 2014, 26 (2), 339-348. [0942] 77. Madhavan, S. M.; O'Toole, J. F.; Konieczkowski, M.; Ganesan, S.; Bruggeman, L. A.; Sedor, J. R., APOL1 localization in normal kidney and nondiabetic kidney disease. J Am Soc Nephrol 2011, 22 (11), 2119-28. [0943] 78. Duchateau, P. N.; Pullinger, C. R.; Cho, M. H.; Eng, C.; Kane, J. P., Apolipoprotein L gene family: tissue-specific expression, splicing, promoter regions; discovery of a new gene. J Lipid Res 2001, 42 (4), 620-30. [0944] 79. Monajemi, H.; Fontijn, R. D.; Pannekoek, H.; Horrevoets, A. J., The apolipoprotein L gene cluster has emerged recently in evolution and is expressed in human vascular tissue. Genomics 2002, 79 (4), 539-46. [0945] 80. Page, N. M.; Butlin, D. J.; Lomthaisong, K.; Lowry, P. J., The human apolipoprotein L gene cluster: identification, classification, and sites of distribution. Genomics 2001, 74 (1), 71-8. [0946] 81. Saleem, M. A.; O'Hare, M. J.; Reiser, J.; Coward, R. J.; Inward, C. D.; Farren, T.; Xing, C. Y.; Ni, L.; Mathieson, P. W.; Mundel, P., A conditionally immortalized human podocyte cell line demonstrating nephrin and podocin expression. J Am Soc Nephrol 2002, 13 (3), 630-8. [0947] 82. Rizzuto, R.; Pinton, P.; Carrington, W.; Fay, F. S.; Fogarty, K. E.; Lifshitz, L. M.; Tuft, R. A.; Pozzan, T., Close contacts with the endoplasmic reticulum as determinants of mitochondrial Ca2+ responses. Science 1998, 280 (5370), 1763-6. [0948] 83. van Vliet, A. R.; Verfaillie, T.; Agostinis, P., New functions of mitochondria associated membranes in cellular signaling. Biochim Biophys Acta 2014, 1843 (10), 2253-62. [0949] 84. Lorenz, H.; Hailey, D. W.; Lippincott-Schwartz, J., Addressing membrane protein topology using the fluorescence protease protection (FPP) assay. Methods Mol Biol 2008, 440, 227-33. [0950] 85 Khatua, A. K.; Cheatham, A. M.; Kruzel, E. D.; Singhal, P. C.; Skorecki, K.; Popik, W., Exon 4-encoded sequence is a major determinant of cytotoxicity of apolipoprotein L1. Am J Physiol Cell Physiol 2015, 309 (1), C22-37. [0951] 86. Kotb, A. M.; Simon, 0.; Blumenthal, A.; Vogelgesang, S.; Dombrowski, F.; Amann, K.; Zimmermann, U.; Endlich, K.; Endlich, N., Knockdown of ApoL1 in Zebrafish Larvae Affects the Glomerular Filtration Barrier and the Expression of Nephrin. PLoS One 2016, 11 (5), e0153768. [0952] 87. Parks, J. S.; Chung, S.; Shelness, G. S., Hepatic ABC transporters and triglyceride metabolism. Curr Opin Lipidol 2012, 23 (3), 196-200. [0953] 88. Pays, E.; Vanhollebeke, B.; Vanhamme, L.; Paturiaux-Hanocq, F.; Nolan, D. P.; Perez-Morga, D., The trypanolytic factor of human serum. Nat Rev Microbiol 2006, 4 (6), 477-86. [0954] 89. Bruno, J.; Pozzi, N.; Oliva, J.; Edwards, J. C., Apolipoprotein L1 confers pH-switchable ion permeability to phospholipid vesicles. J Biol Chem 2017, 292 (44), 18344-18353. [0955] 90. Thomson, R.; Finkelstein, A., Human trypanolytic factor APOL1 forms pH-gated cation-selective channels in planar lipid bilayers: relevance to trypanosome lysis. Proc Natl Acad Sci USA 2015, 112 (9), 2894-9. [0956] 91. Paroutis, P.; Touret, N.; Grinstein, S., The pH of the secretory pathway: measurement, determinants, and regulation. Physiology (Bethesda) 2004, 19, 207-15. [0957] 92. Thomson, R.; Genovese, G.; Canon, C.; Kovacsics, D.; Higgins, M. K.; Carrington, M.; Winkler, C. A.; Kopp, J.; Rotimi, C.; Adeyemo, A.; Doumatey, A.; Ayodo, G.; Alper, S. L.; Pollak, M. R.; Friedman, D. J.; Raper, J., Evolution of the primate trypanolytic factor APOL1. Proc Natl Acad Sci USA 2014, 111 (20), E2130-9. [0958] 93. Di Paolo, G.; De Camilli, P., Phosphoinositides in cell regulation and membrane dynamics. Nature 2006, 443 (7112), 651-7. [0959] 94. Shah, S. S.; Lannon, H.; Dias, L.; Zhang, J. Y.; Alper, S. L.; Pollak, M. R.; Friedman, D. J., APOL1 Kidney Risk Variants Induce Cell Death via Mitochondrial Translocation and Opening of the Mitochondrial Permeability Transition Pore. J Am Soc Nephrol 2019, 30 (12), 2355-2368. [0960] 95. Neupert, W., Protein import into mitochondria. Annu Rev Biochem 1997, 66, 863-917. [0961] 96. Olzmann, J. A.; Carvalho, P., Dynamics and functions of lipid droplets. Nat Rev Mol Cell Biol 2019, 20 (3), 137-155. [0962] 97. Advani, R. J.; Bae, H. R.; Bock, J. B.; Chao, D. S.; Doung, Y. C.; Prekeris, R.; Yoo, J. S.; Scheller, R. H., Seven novel mammalian SNARE proteins localize to distinct membrane compartments. J Biol Chem 1998, 273 (17), 10317-24. [0963] 98. Behrendorff, N.; Dolai, S.; Hong, W.; Gaisano, H. Y.; Thorn, P., Vesicle-associated membrane protein 8 (VAMPS) is a SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) selectively required for sequential granule-to-granule fusion. J Biol Chem 2011, 286 (34), 29627-34. [0964] 99. Wong, S. H.; Zhang, T.; Xu, Y.; Subramaniam, V. N.; Griffiths, G.; Hong, W., Endobrevin, a novel synaptobrevin/VAMP-like protein preferentially associated with the early endosome. Mol Biol Cell 1998, 9 (6), 1549-63. [0965] 100. Hague, S.; Patil, G.; Mishra, A.; Lan, X.; Popik, W.; Malhotra, A.; Skorecki, K.; Singhal, P. C., Effect of APOL1 disease risk variants on APOL1 gene product. Biosci Rep 2017, 37 (2). [0966] 101. Austin, C. D.; Wen, X.; Gazzard, L.; Nelson, C.; Scheller, R. H.; Scales, S. J., Oxidizing potential of endosomes and lysosomes limits intracellular cleavage of disulfide-based antibody-drug conjugates. Proc Natl Acad Sci USA 2005, 102 (50), 17987-92. [0967] 102. Chandra, D.; Liu, J. W.; Tang, D. G., Early mitochondrial activation and cytochrome c up-regulation during apoptosis. J Biol Chem 2002, 277 (52), 50842-54. [0968] 103. Lo, M.; Kim, H. S.; Tong, R. K.; Bainbridge, T. W.; Vernes, J. M.; Zhang, Y.; Lin, Y. L.; Chung, S.; Dennis, M. S.; Zuchero, Y. J.; Watts, R. J.; Couch, J. A.; Meng, Y. G.; Atwal, J. K.; Brerski, R. J.; Spiess, C.; Ernst, J. A., Effector-attenuating Substitutions That Maintain Antibody Stability and Reduce Toxicity in Mice. J Biol Chem 2017, 292 (9), 3900-3908. [0969] 104. Schlothauer, T.; Herter, S.; Koller, C. F.; Grau-Richards, S.; Steinhart, V.; Spick, C.; Kubbies, M.; Klein, C.; Umana, P.; Mossner, E., Novel human IgG.sub.1 and IgG.sub.4 Fc-engineered antibodies with completely abolished immune effector functions. Protein Eng Des Sel 2016, 29 (10), 457-466. [0970] 105. Seeber, S.; Ros, F.; Thorey, I.; Tiefenthaler, G.; Kaluza, K.; Lifke, V.; Fischer, J. A.; Klostermann, S.; Endl, J.; Kopetzki, E.; Pashine, A.; Siewe, B.; Kaluza, B.; Platzer, J.; Offner, S., A robust high throughput platform to generate functional recombinant monoclonal antibodies using rabbit B cells from peripheral blood. PLoS One 2014, 9 (2), e86184. [0971] 106. Grant Wilson, D.; Foreman, 0.; Peterson, A. S.; Wen, X.; Scales, S. J. Animal model for nephropathy and agents for treating the same. 2014. [0972] 107. Wieckowski, M. R.; Giorgi, C.; Lebiedzinska, M.; Duszynski, J.; Pinton, P., Isolation of mitochondria-associated membranes and mitochondria from animal tissues and cells. Nat Protoc 2009, 4 (11), 1582-90. [0973] 108. Ohsaki, Y.; Maeda, T.; Fujimoto, T., Fixation and permeabilization protocol is critical for the immunolabeling of lipid droplet proteins. Histochem Cell Biol 2005, 124 (5), 445-52. [0974] 109. Yang, Y.; Yang, Q.; Yang, J.; Ma, Y.; Ding, G., Angiotensin II induces cholesterol accumulation and injury in podocytes. Sci Rep 2017, 7 (1), 10672. [0975] 110. Bannai, H.; Tamada, Y.; Maruyama, 0.; Nakai, K.; Miyano, S., Extensive feature detection of N-terminal protein sorting signals. Bioinformatics 2002, 18 (2), 298-305. [0976] 111. Petersen, T. N.; Brunak, S.; von Heijne, G.; Nielsen, H., SignalP 4.0: discriminating signal peptides from transmembrane regions. Nat Methods 2011, 8 (10), 785-6. [0977] 112. Bendtsen, J. D.; Jensen, L. J.; Blom, N.; Von Heijne, G.; Brunak, S., Feature-based prediction of non-classical and leaderless protein secretion. Protein Eng Des Sel 2004, 17 (4), 349-56.
[0978] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, the descriptions and examples should not be construed as limiting the scope of the invention. The disclosures of all patent and scientific literature cited herein are expressly incorporated in their entirety by reference.
TABLE-US-00007 IV. Table of Certain Sequences SEQ ID NO Description Sequence 1 Human APOL1 MEGAALLRVS VLCIWMSALF LGVGVRAEEA GARVQQNVPS GTDTGDPQSK (with leader PLGDWAAGTM DRESSIFIED AIKYFKEKVS TQNLLLLLTD NEAWNGFVAA sequence) AELPRNEADE LRKALDNLAR QMIMKDKNWH DKGQQYRNWF LKEFPRLKSE G0 form EMR LEDNIRRLRA LADGVQKVHK GTTIANVVSG SLSISSGILT LVGMGLAPFT variant EGGSLVLLEP GMELGITAAL TGITSSTMDY GKKWWTQAQA HDLVIKSLDK Accession LKEVREFLGE NISNFLSLAG NTYQLTRGIG KDIRALRRAR ANLQSVPHAS no. NP003652 ASRPRVTEPI SAESGEQVER VNEPSILEMS RGVKLTDVAP VSFFLVLDW YLVYESKHLH EGAKSETAEE LKKVAQELEE KLNILNNNYK ILQADQEL 2 Human APOL1 EA GARVQQNVPS GTDTGDPQSK without PLGDWAAGTM DRESSIFIED AIKYFKEKVS TQNLLLLLTD NEAWNGFVAA leader AELPRNEADE LRKALDNLAR QMIMKDKNWH DKGQQYRNWF LKEFPRLKSE sequence - LEDNIRRLRA LADGVQKVHK GTTIANVVSG SLSISSGILT LVGMGLAPFT G0 form EMR EGGSLVLLEP GMELGITAAL TGITSSTMDY GKKWWTQAQA HDLVIKSLDK variant LKEVREFLGE NISNFLSLAG NTYQLTRGIG KDIRALRRAR ANLQSVPHAS NP003652 ASRPRVTEPI SAESGEQVER VNEPSILEMS RGVKLTDVAP VSFFLVLDW YLVYESKHLH EGAKSETAEE LKKVAQELEE KLNILNNNYK ILQADQEL 3 3.6D12 VH CDR1 RCAMS 4 3.6D12 VH CDR2 AISRDSTYTYYSDSVKG 5 3.6D12 VH CDR3 QIDDYYVDALDY 6 3.6D12 VL CDR1 RASKIISKYLA 7 3.6D12 VL CDR2 SGFTLQS 8 3.6D12 VL CDR3 QQHNEYPLT 9 3.6D12 VH EVMLVESGGGLVRPGGSLKLSCTASGFTFSRCAMSWVRQTPEKRLEWVSAISRDSTYTY YSDSVKGRFTVSRDNAKNTLYLQMSSLRSEDTAMYYCARQIDDYYVDALDYWGQGTSV 10 3.6D12 VL DVQITQSPSYLAASPGETITINCRASKIISKYLAWYQEKPGKTIKLLIYSGFTLQSGIP SRFSGSGSGTDFTLTISSLEPEDFAMYYCQQHNEYPLTFGA 11 3.6D12 HC MGWSCIILFLVATATGAYAEVMLVESGGGLVRPGGSLKLSCTASGFTFSRCAMSWVRQT LALAPG mIgG2a PEKRLEWVSAISRDSTYTYYSDSVKGRFTVSRDNAKNTLYLQMSSLRSEDTAMYYCARQ IDDYYVDALDYWGQGTSVTVSSASTKGPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPV TLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKK IEPRGPTIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPD VQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLGAP IERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELN YKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSWHEGLHNHHTTKSFSRTPGK 12 3.6D12 LC MGWSCIILFLVATATGVHSDVQITQSPSYLAASPGETITINCRASKIISKYLAWYQEKP LALAPG mIgG2a GKTIKLLIYSGFTLQSGIPSRFSGSGSGTDFTLTISSLEPEDFAMYYCQQHNEYPLTFG AGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERONG VLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 13 3.3B6 VH CDR1 SHWMQ 14 3.3B6 VH CDR2 AIYPGDGDTKFTQKFKD 15 3.3B6 VH CDR3 NLYGYYFDY 16 3.3B6 VL CDR1 RSSTGAVTSGNFAN 17 3.3B6 VL CDR2 GADNRAP 18 3.3B6 VL CDR3 ALWYSDHWV 19 3.3B6 VH QVQLQQSGAELARPGASVKLSCKASGYTFTSHWMQWLKQRPGQGLEWIGAIYPGDGDTK FTQKFKDKATLTADKSSTTAYMQLSSLASEDSAVYYCARENLYGYYFDYWGQGTTL 20 3.3B6 VL QAVVTQESALTTSPGETVTLTCRSSTGAVTSGNFANWVQEKPDHLFTGLIGGADNRAPG VPARFSGSLIGDKAALIITGAQTEDEAIYFCALWYSDHWVFGG 21 3.3B6 HC MGWSCIILFLVATATGAYAQVQLQQSGAELARPGASVKLSCKASGYTFTSHWMQWLKQR LALAPG mIgG2a PGQGLEWIGAIYPGDGDTKFTQKFKDKATLTADKSSTTAYMQLSSLASEDSAVYYCARE NLYGYYFDYWGQGTTLTVSSASTKGPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTL TWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE PRGPTIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPDVQ ISWFVNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAPIE RTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYK NTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 22 3.3B6 LC MGWSCIILFLVATATGVHSQAWTQESALTTSPGETVTLTCRSSTGAVTSGNFANWVQE LALAPG mIgG2a KPDHLFTGLIGGADNRAPGVPARFSGSLIGDKAALIITGAQTEDEAIYFCALWYSDHWV FGGGTKLTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPI TQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSRADCL 23 3.7D6 VH CDR1 NYGVN 24 3.7D6 VH CDR2 WINTNTGQTTYAEEFRG 25 3.7D6 VH CDR3 LIYDGDYISSDF 26 3.7D6 VL CDR1 GASENIYGALN 27 3.7D6 VL CDR2 GATNLAD 28 3.7D6 VL CDR3 QNALSMPYT 29 3.7D6 VH QIQLVQSGPDLKKPGETVKISCRTSGYAFTNYGVNWVKQAPGKGLKWMGWINTNTGQTT YAEEFRGRFAISLETSASTAFLTISNLKNEDSATYFCARLIYDGDYISSDFWGQGTTL 30 3.7D6 VL DIQMTQSPDSLSASVGETVTITCGASENIYGALNWYQRKQGKSPQLLIYGATNLADGMS SRFSGSRSGRQYSLKISSLHPDDVATYYCQNALSMPYTFGG 31 3.7D6 HC MGWSCIILFLVATATGAYAQIQLVQSGPDLKKPGETVKISCRTSGYAFTNYGVNWVKQA LALAPG mIgG2a PGKGLKWMGWINTNTGQTTYAEEFRGRFAISLETSASTAFLTISNLKNEDSATYFCARL IYDGDYISSDFWGQGTTLTVSSASTKGPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPV TLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKK IEPRGPTIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPD VQISWFVNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAP IERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELN YKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 32 3.7D6 LC MGWSCIILFLVATATGVHSDIQMTQSPDSLSASVGETVTITCGASENIYGALNWYQRKQ LALAPG mIgG2a GKSPQLLIYGATNLADGMSSRFSGSRSGRQYSLKISSLHPDDVATYYCQNALSMPYTFG GGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNG VLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 33 3.3A8 VH CDR1 NYEIH 34 3.3A8 VH CDR2 AIHPGNGVTAYNQMFKG 35 3.3A8 VH CDR3 NFDY 36 3.3A8 VL CDR1 RSSQSLTNSYGITYLS 37 3.3A8 VL CDR2 EISNRFS 38 3.3A8 VL CDR3 LQGTHQPFT 39 3.3A8 VH QVQFQQSGAELVRPGASVKVTCKALGYTFSNYEIHWVRQPPVHGLEWIGAIHPGNGVTA YNQMFKGRATLAADKSSSTAYMELSSLTSEDSAVYYCTENFDYWGQGTAL 40 3.3A8 VL DVVVTQTPLSLPVSFGDQVSISCRSSQSLTNSYGITYLSWFLLKPGQSPQLLIYEISNR FSGVPDRFSGSGSGTDFTLKISTIKPEDLGVYFCLQGTHQPFTFGA 41 3.3A8 HC MGWSCIILFLVATATGAYAQVQFQQSGAELVRPGASVKVTCKALGYTFSNYEIHWVRQP LALAPG mIgG2a PVHGLEWIGAIHPGNGVTAYNQMFKGRATLAADKSSSTAYMELSSLTSEDSAVYYCTEN FDYWGQGTALTVSSASTKGPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGS LSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTI KPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPDVQISWFVN NVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAPIERTISKP KGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVL DSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 42 3.3A8 LC MGWSCIILFLVATATGVHSDVWTQTPLSLPVSFGDQVSISCRSSQSLTNSYGITYLSW LALAPG mIgG2a FLLKPGQSPQLLIYEISNRFSGVPDRFSGSGSGTDFTLKISTIKPEDLGVYFCLQGTHQ PFTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASWCFLNNFYPKDINVKWKIDGS ERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN EC 43 3.2C11 VH CDR1 DYEIH 44 3.2C11 VH CDR2 GIHPGNGGTAYNPKFKG 45 3.2C11 VH CDR3 WVDY 46 3.2C11 VL CDR1 RSSQSLVNRHGITYLS 47 3.2C11 VL CDR2 EISNRFS 48 3.2C11 VL CDR3 FQGTHQPFT 49 3.2C11 VH QVQLQQSGAELVRPGASVKLSCKALGYTFTDYEIHWVKQTPVHGLEWIGGIHPGNGGTA YNPKFKGKATLTADTSSSTASMELSSLTSEDSAVYYCTDWVDYWGQGTTL 50 3.2C11 VL DVVVTQTPLSLPVNFGDQVSISCRSSQSLVNRHGITYLSWYLHKPGQSPQLLIYEISNR FSGVPDRFSGSGSGTDFTLKISTIKPEDLGMYYCFQGTHQPFTFGG 51 3.2C11 HC MGWSCIILFLVATATGVHSQVQLQQSGAELVRPGASVKLSCKALGYTFTDYEIHWVKQT LALAPG mIgG2a PVHGLEWIGGIHPGNGGTAYNPKFKGKATLTADTSSSTASMELSSLTSEDSAVYYCTDW VDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGS LSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTI KPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPDVQISWFVN NVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAPIERTISKP KGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVL DSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 52 3.2C11 LC MGWSCIILFLVATATGVHSDVVVTQTPLSLPVNFGDQVSISCRSSQSLVNRHGITYLSW LALAPG mIgG2a YLHKPGQSPQLLIYEISNRFSGVPDRFSGSGSGTDFTLKISTIKPEDLGMYYCFQGTHQ PFTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASWCFLNNFYPKDINVKWKIDGS ERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN EC 53 3.1C1 VH CDR1 NYFIH 54 3.1C1 VH CDR2 WINPGNLNTKYTEEFKG 55 3.1C1 VH CDR3 GNPFVY 56 3.1C1 VL CDR1 KSSQSLLNSGNQKKYLT 57 3.1C1 VL CDR2 WTSTRDS 58 3.1C1 VL CDR3 QNDYSYPLT 59 3.1C1 VH QVQLQQSGPELVKPGASVRISCKASGYTFTNYFIHWVKQRPGQGLEWIGWINPGNLNTK YTEEFKGKATLTADKSSSTAYIQLNSLTSEDSAVYFCVNGNPFVYWGQGTLV 60 3.1C1 VL DIVMTQSPSSLTVIAGEKVTLNCKSSQSLLNSGNQKKYLTWLQQKPGQPPKLLIYWTST RDSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGA 61 3.1C1 HC MGWSCIILFLVATATGAYAQVQLQQSGPELVKPGASVRISCKASGYTFTNYFIHWVKQR LALAPG mIgG2a PGQGLEWIGWINPGNLNTKYTEEFKGKATLTADKSSSTAYIQLNSLTSEDSAVYFCVNG NPFVYWGQGTLVTVSAASTKGPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNS GSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP TIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPDVQISWF VNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAPIERTIS KPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEP VLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 62 3.1C1 LC MGWSCIILFLVATATGVHSDIVMTQSPSSLTVIAGEKVTLNCKSSQSLLNSGNQKKYLT LALAPG mIgG2a WLQQKPGQPPKLLIYWTSTRDSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYS YPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASWCFLNNFYPKDINVKWKIDG SERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR NEC 63 3.1C7 VH CDR1 SYWMH 64 3.1C7 VH CDR2 AIYPGKSDIKYNQKFKD 65 3.1C7 VH CDR3 SIPFVY 66 3.1C7 VL CDR1 KSSQSLLNSENQKKYLT 67 3.1C7 VL CDR2 WTSTRYS 68 3.1C7 VL CDR3 QNDYSYPLT 69 3.1C7 VH EVQLQQSGTVLSRPGASVKMSCKASGYTMTSYWMHWIKQRPGQGLEWIGAIYPGKSDIK YNQKFKDKAKLTAVTATSTAYMEINSLTNEDSAVYYCTNSIPFVYWGQGTLI 70 3.1C7 VL DIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSENQKKYLTWFQQKPGQPPKLLIYWTST RYSGIPDRFTGSGSGTVFTLTISSVQADDLAVYYCQNDYSYPLTFGG 71 3.1C7 HC MGWSCIILFLVATATGAYAEVQLQQSGTVLSRPGASVKMSCKASGYTMTSYWMHWIKQR LALAPG mIgG2a PGQGLEWIGAIYPGKSDIKYNQKFKDKAKLTAVTATSTAYMEINSLTNEDSAVYYCTNS IPFVYWGQGTLITVSAASTKGPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNS GSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP TIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPDVQISWF VNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAPIERTIS KPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEP VLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 72 3.1C7 LC MGWSCIILFLVATATGVHSDIVMTQSPSSLTVTAGEKVTMSCKSSQSLLNSENQKKYLT mIgG2a WFQQKPGQPPKLLIYWTSTRYSGIPDRFTGSGSGTVFTLTISSVQADDLAVYYCQNDYS YPLTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDG SERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR NEC 73 3.4G10 VH CDR1 SGESWH 74 3.4G10 VH CDR2 FIHYSGSANYNPSLKS 75 3.4G10 VH CDR3 SVYNYDGAWFPY 76 3.4G10 VL CDR1 SASSSVSSSYLN 77 3.4G10 VL CDR2 RTSNLAS 78 3.4G10 VL CDR3 HQWSAYPPT 79 3.4G10 VH DVQLQESGPDLVKPSQSLSLTCTVTGYSITSGESWHWIRHFPGNELEWMGFIHYSGSAN YNPSLKSRISITRDTSKNQFFLQLLSVTTDDTATYYCARSVYNYDGAWFPYWGQGTLV 80 3.4G10 VL QIVLTQSPVIMSASPGERVTLTCSASSSVSSSYLNWYQLKPGSSPKVWIYRTSNLASGV PARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSAYPPTFGG 81 3.4G10 HC MGWSCIILFLVATATGAYADVQLQESGPDLVKPSQSLSLTCTVTGYSITSGESWHWIRH LALAPG mIgG2a FPGNELEWMGFIHYSGSANYNPSLKSRISITRDTSKNQFFLQLLSVTTDDTATYYCARS VYNYDGAWFPYWGQGTLVTVSAASTKGPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPV TLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKK IEPRGPTIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPD VQISWFVNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAP IERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELN YKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 82 3.4G10 LC MGWSCIILFLVATATGVHSQIVLTQSPVIMSASPGERVTLTCSASSSVSSSYLNWYQLK LALAPG mIgG2a PGSSPKVWIYRTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSAYPPTF GGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASWCFLNNFYPKDINVKWKIDGSERQN GVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 83 3.6E10 VH CDR1 SYYLH 84 3.6E10 VH CDR2 YINPNTGYTEYTQNFKD 85 3.6E10 VH CDR3 GNPFVY 86 3.6E10 VL CDR1 RSSQSLLNSGNQKNYLT 87 3.6E10 VL CDR2 WTSTRYS 88 3.6E10 VL CDR3 QNDYSYPLT 89 3.6E10 VH QVQLQQSGAELAKPGASVKMSCKASGYIFTSYYLHWVKQRPGQGLEWIGYINPNTGYTE YTQNFKDRATLTADKSSSTAYMQLTSLTSEDSAVYFCVNGNPFVYWGQGTLV 90 3.6E10 VL DIVMTQSPSSLTVTTGEKVTMTCRSSQSLLNSGNQKNYLTWFQQKPGQPPKLLIYWTST RYSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSYPLTFGA 91 3.6E10 HC MGWSCIILFLVATATGAYAQVQLQQSGAELAKPGASVKMSCKASGYIFTSYYLHWVKQR LALAPG mIgG2a PGQGLEWIGYINPNTGYTEYTQNFKDRATLTADKSSSTAYMQLTSLTSEDSAVYFCVNG NPFVYWGQGTLVTVSAASTKGPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNS GSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP TIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPDVQISWF VNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAPIERTIS KPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEP VLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 92 3.6E10 LC MGWSCIILFLVATATGVHSDIVMTQSPSSLTVTTGEKVTMTCRSSQSLLNSGNQKNYLT LALAPG mIgG2a WFQQKPGQPPKLLIYWTSTRYSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYS YPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASWCFLNNFYPKDINVKWKIDG SERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR NEC 93 3.3F7 VH CDR1 TYGVH 94 3.3F7 VH CDR2 VIWRGGNTDYNAAFMS 95 3.3F7 VH CDR3 SSYGYHYTMDY 96 3.3F7 VL CDR1 KASQNVGTAVA 97 3.3F7 VL CDR2 WASTRHT 98 3.3F7 VL CDR3 QRYNNFPFT 99 3.3F7 VH QVQLKQSGPSLVQPSQSLSITCTVSGFSLTTYGVHWVRQSPGKGLEWLGVIWRGGNTDY NAAFMSRLSITKDNSQSQVFFKMNSLQADDTAIYYCAKSSYGYHYTMDYWGHGTSV 100 3.3F7 VL DIVVTQSHRFMSTSVGDRVIITCKASQNVGTAVAWYQQKPGQSPKLLIYWASTRHTGVP DRFTGSGSGTDFTLTISNVQSEDLADYFCQRYNNFPFTFGS 101 3.3F7 HC MGWSCIILFLVATATGAYAQVQLKQSGPSLVQPSQSLSITCTVSGFSLTTYGVHWVRQS LALAPG mIgG2a PGKGLEWLGVIWRGGNTDYNAAFMSRLSITKDNSQSQVFFKMNSLQADDTAIYYCAKSS YGYHYTMDYWGHGTSVTVSSASTKGPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTL TWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE PRGPTIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPDVQ ISWFVNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAPIE RTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYK NTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 102 3.3F7 LC MGWSCIILFLVATATGVHSDIWTQSHRFMSTSVGDRVIITCKASQNVGTAVAWYQQKP LALAPG mIgG2a GQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQRYNNFPFTFG SGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNG VLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 103 4.17A5 VH CDR1 NSWIN 104 4.17A5 VH CDR2 RIYPGDGDTKYNGKFKG 105 4.17A5 VH CDR3 FPFGKYEGPGAMDY 106 4.17A5 VL CDR1 RASQDISSYLN 107 4.17A5 VL CDR2 YTSRLHS 108 4.17A5 VL CDR3 QQGNTLPYT 109 4.17A5 VH QVQLQQSGPELLKPGASVKISCKGSGYAFSNSWINWVKLRPGQGLEWIGRIYPGDGDTK YNGKFKGKATLTADKSSSTAHMQLRSLTSVDSAVYFCARFPFGKYEGPGAMDYWGQGTS V 110 4.17A5 VL DIQMTQTTSSLSASLGDRVTISCRASQDISSYLNWYQQKPDGTIKLLIYYTSRLHSGVP SRFSGSGSGTDFSLTISNLEQEDIATYFCQQGNTLPYTFGG 111 4.17A5 HC MGWSCIILFLVATATGVHSQVQLQQSGPELLKPGASVKISCKGSGYAFSNSWINWVKLR LALAPG mIgG2a PGQGLEWIGRIYPGDGDTKYNGKFKGKATLTADKSSSTAHMQLRSLTSVDSAVYFCARF PFGKYEGPGAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPE PVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVD KKIEPRGPTIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDD PDVQISWFVNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLG APIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTE LNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 112 4.17A5 LC MGWSCIILFLVATATGVHSDIQMTQTTSSLSASLGDRVTISCRASQDISSYLNWYQQKP LALAPG mIgG2a DGTIKLLIYYTSRLHSGVPSRFSGSGSGTDFSLTISNLEQEDIATYFCQQGNTLPYTFG GGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERONG VLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 113 4.2C4 VH CDR1 DYVIS 114 4.2C4 VH CDR2 EMFPGSGTTYYTEKFRG 115 4.2C4 VH CDR3 GTTADY 116 4.2C4 VL CDR1 RASSSVNYMY 117 4.2C4 VL CDR2 YTSNLAP 118 4.2C4 VL CDR3 QQFTSSPYT 119 4.2C4 VH QVQLQQSGPELVKPGASVKMSCKASGYTFTDYVISWVKQRTGQGLEWIGEMFPGSGTTY YTEKFRGKATLTADKSSNTAYMQLSSLTSEDSAVYFCARGTTADYWGQGTTL 120 4.2C4 VL ENVLTQSPAIMSASLGEKVTMSCRASSSVNYMYWYQQKSDASPKLWIYYTSNLAPGVPA RFSGSGSGNSYSLTISSMEGEDAATYYCQQFTSSPYTFGG 121 4.2C4 HC MGWSCIILFLVATATGVHSQVQLQQSGPELVKPGASVKMSCKASGYTFTDYVISWVKQR LALAPG mIgG2a TGQGLEWIGEMFPGSGTTYYTEKFRGKATLTADKSSNTAYMQLSSLTSEDSAVYFCARG TTADYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNS GSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP TIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPDVQISWF VNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAPIERTIS KPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEP VLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 122 4.2C4 LC MGWSCIILFLVATATGVHSENVLTQSPAIMSASLGEKVTMSCRASSSVNYMYWYQQKSD LALAPG mIgG2a ASPKLWIYYTSNLAPGVPARFSGSGSGNSYSLTISSMEGEDAATYYCQQFTSSPYTFGG GTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGV LNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 123 4.12E5 VH CDR1 GYFMH 124 4.12E5 VH CDR2 YISCYNGASVYNQRFKG 125 4.12E5 VH CDR3 DVLRYPRYAVDY 126 4.12E5 VL CDR1 KSSQSLLDSDGKTYLN 127 4.12E5 VL CDR2 LVSNLDS 128 4.12E5 VL CDR3 WQGSHFPFT 129 4.12E5 VH EVQLQQSGPELVKTGASVKISCKASGYSFTGYFMHWVKQSHGKSLEWIGYISCYNGASV YNQRFKGKATFTIDTSSSTAYMQFNSLTSEDSAVYYCARDVLRYPRYAVDYWGQGTSV 130 4.12E5 VL DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSNL DSGVPARFTGSGSGTDFTLKISRVEAEDLGVYYCWQGSHFPFTFGS 131 4.12E5 HC MGWSCIILFLVATATGVHSEVQLQQSGPELVKTGASVKISCKASGYSFTGYFMHWVKQS LALAPG mIgG2a HGKSLEWIGYISCYNGASVYNQRFKGKATFTIDTSSSTAYMQFNSLTSEDSAVYYCARD VLRYPRYAVDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPV TLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKK IEPRGPTIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPD VQISWFVNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAP IERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELN YKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 132 4.12E5 LC MGWSCIILFLVATATGVHSDVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNW LALAPG mIgG2a LLQRPGQSPKRLIYLVSNLDSGVPARFTGSGSGTDFTLKISRVEAEDLGVYYCWQGSHF PFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASWCFLNNFYPKDINVKWKIDGS ERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN EC 133 4.11A10 VH CDR1 GYFMH 134 4.11A10 VH CDR2 YISCYNGVSVYNQRFKG 135 4.11A10 VH CDR3 DVLRYPRYAVDY 136 4.11A10 VL CDR1 KSSQSLLDSDGKTYLN 137 4.11A10 VL CDR2 LVSNLDS 138 4.11A10 VL CDR3 WQGSHFPFT 139 4.11A10 VH EVQLQQSGPELVKTGASVKISCKASGYSFTGYFMHWVKQSHGKSLEWIGYISCYNGVSV YNQRFKGKATFTIDTSSSTAYMQFNSLTSEDSAVYYCARDVLRYPRYAVDYWGQGTSV 140 4.11A10 VL DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSNL DSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGSHFPFTFGS 141 4.11A10 HC MGWSCIILFLVATATGVHSEVQLQQSGPELVKTGASVKISCKASGYSFTGYFMHWVKQS LALAPG mIgG2a HGKSLEWIGYISCYNGVSVYNQRFKGKATFTIDTSSSTAYMQFNSLTSEDSAVYYCARD VLRYPRYAVDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPV TLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKK IEPRGPTIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPD VQISWFVNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAP IERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELN YKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 142 4.11A10 LC MGWSCIILFLVATATGVHSDVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNW LALAPG mIgG2a LLQRPGQSPKRLIYLVSNLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGSHF PFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASWCFLNNFYPKDINVKWKIDGS ERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN EC 143 4.11H11 VH CDR1 VYTMN 144 4.11H11 VH CDR2 LINPYNGGTIYNRKFKG 145 4.11H11 VH CDR3 GALYRYEGAMDY 146 4.11H11 VL CDR1 RASSSVIYVH 147 4.11H11 VL CDR2 ATSNLAS 148 4.11H11 VL CDR3 QQWSSNPLT 149 4.11H11 VH EVQVQQSGPELVKPGASMKISCKASGYSFIVYTMNWVKQSHGKNLEWIGLINPYNGGTI YNRKFKGKATLTVDKSSSTAYLELLSLTSEDSAVYYCARGALYRYEGAMDYWGQGTSVI 150 4.11H11 VL QIVLSQFPAILSASPGEKVTMTCRASSSVIYVHWYQQKPGSSPKPWIYATSNLASGVPA RFSGSGSGTSHSLTISRLEAEDTATYYCQQWSSNPLTFGA 151 4.11H11 HC MGWSCIILFLVATATGVHSEVQVQQSGPELVKPGASMKISCKASGYSFIVYTMNWVKQS LALAPG mIgG2a HGKNLEWIGLINPYNGGTIYNRKFKGKATLTVDKSSSTAYLELLSLTSEDSAVYYCARG ALYRYEGAMDYWGQGTSVIVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPV TLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKK IEPRGPTIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPD VQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLGAP IERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELN YKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 152 4.11H11 LC MGWSCIILFLVATATGVHSQIVLSQFPAILSASPGEKVTMTCRASSSVIYVHWYQQKPG LALAPG mIgG2a SSPKPWIYATSNLASGVPARFSGSGSGTSHSLTISRLEAEDTATYYCQQWSSNPLTFGA GTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGV LNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 153 4.29C4 VH CDR1 NYWMN 154 4.29C4 VH CDR2 MIHPSDSESRLSQRFKD 155 4.29C4 VH CDR3 LDY 156 4.29C4 VL CDR1 KSSQSLLKSSNQKNYLA 157 4.29C4 VL CDR2 FASTRES 158 4.29C4 VL CDR3 QQHYSAPLT 159 4.29C4 VH QVQLQQPGAELVRPGASVKLSCKASGYSFANYWMNWVKQRPGQGLEWIGMIHPSDSESR LSQRFKDKATLTVDKSSSTAYMQLNSPTSEDSAVYYCARLDYWGQGTSV 160 4.29C4 VL DIVMTQSPSSLAMSVGQKVTMSCKSSQSLLKSSNQKNYLAWYQQKPGQSPKLLVFFAST RESGVPDRFIGSGSGTDFTLTISSVQAEDLADYFCQQHYSAPLTFGA 161 4.29C4 HC MGWSCIILFLVATATGVHSQVQLQQPGAELVRPGASVKLSCKASGYSFANYWMNWVKQR LALAPG mIgG2a PGQGLEWIGMIHPSDSESRLSQRFKDKATLTVDKSSSTAYMQLNSPTSEDSAVYYCARL DYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSL SSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIK PCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPDVQISWFVNN VEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLGAPIERTISKPK GSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLD SDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 162 4.29C4 LC MGWSCIILFLVATATGVHSDIVMTQSPSSLAMSVGQKVTMSCKSSQSLLKSSNQKNYLA LALAPG mIgG2a WYQQKPGQSPKLLVFFASTRESGVPDRFIGSGSGTDFTLTISSVQAEDLADYFCQQHYS APLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDG SERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR NEC 163 5.17D12 VH CDR1 SNYYMC 164 5.17D12 VH CDR2 CVYVGSGGSTYYASWAK 165 5.17D12 VH CDR3 DLSYAGDL 166 5.17D12 VL CDR1 QASESISSYLA 167 5.17D12 VL CDR2 GASNLAS 168 5.17D12 VL CDR3 QSAYYSNSGGHA 169 5.17D12 VH QSLEESGGDLVKPGASLTLTCTASGFSFSSNYYMCWVRQAPGKGLEWIACVYVGSGGST YYASWAKGRFTFSKTSSTTWTLQMTSLTAADTATYFCARDLSYAGDLWGPGTLVTVSS 170 5.17D12 VL DPVMTQTPASVSEPVGGTVTINCQASESISSYLAWYQQKPGQPPKLLIYGASNLASGVP SRFKGSGSGTEYTLTISDLECDDAATYYCQSAYYSNSGGHAFGGGTEVVVK 171 5.17D12 HC METGLRWLLLVAVLKGVQCQSLEESGGDLVKPGASLTLTCTASGFSFSSNYYMCWVRQA PGKGLEWIACVYVGSGGSTYYASWAKGRFTFSKTSSTTWTLQMTSLTAADTATYFCARD LSYAGDLWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVTVTW NSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAPSTC SKPTCPPPELLGGPSVFIFPPKPKDTLMISRTPEVTCVWDVSQDDPEVQFTWYINNEQ VRTARPPLREQQFNSTIRWSTLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKARGQ PLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVEWEKNGKAEDNYKTTPAVLDSD GSYFLYNKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK 172 5.17D12 LC MDMRAPTQLLGLLLLWLPGVICDPVMTQTPASVSEPVGGTVTINCQASESISSYLAWYQ QKPGQPPKLLIYGASNLASGVPSRFKGSGSGTEYTLTISDLECDDAATYYCQSAYYSNS GGHAFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGT TQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC 173 5.17H8 VH CDR1 SYAMG 174 5.17H8 VH CDR2 IISSSGSTHYASWA 175 5.17H8 VH CDR3 ARAGSTYYTGYYFNL 176 5.17H8 VL CDR1 QASESIYSNLA 177 5.17H8 VL CDR2 GASTLES 178 5.17H8 VL CDR3 QSGYYGISAINNA 179 5.17H8 VH QSLEESGGRLVTPGTPLTLTCTVSGIDLSSYAMGWVRQAPGKGLEWIGIISSSGSTHYA SWAKGRFTISKTSTTVDLKITSPTTEDTATYFCARARAGSTYYTGYYFNLWGQGTLVTV SS 180 5.17H8 VL AIEMTQTASPVSAAVGGTVTINCQASESIYSNLAWYQQKPGQRPKLLIYGASTLESGVP SRFKGSGSGTEYTLTISDLECDDAATYYCQSGYYGISAINNAFGGGTEVVVK 181 5.17H8 HC METGLRWLLLVAVLKGVQCQSLEESGGRLVTPGTPLTLTCTVSGIDLSSYAMGWVRQAP GKGLEWIGIISSSGSTHYASWAKGRFTISKTSTTVDLKITSPTTEDTATYFCARARAGS TYYTGYYFNLWGQGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVT VTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAP STCSKPTCPPPELLGGPSVFIFPPKPKDTLMISRTPEVTCVWDVSQDDPEVQFTWYIN NEQVRTARPPLREQQFNSTIRWSTLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKA RGQPLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVEWEKNGKAEDNYKTTPAVL DSDGSYFLYNKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK 182 5.17H8 LC MDMRAPTQLLGLLLLWLPGVTFAIEMTQTASPVSAAVGGTVTINCQASESIYSNLAWYQ QKPGQRPKLLIYGASTLESGVPSRFKGSGSGTEYTLTISDLECDDAATYYCQSGYYGIS AINNAFGGGTEVWKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDG TTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGD C 183 5.11H2 VH CDR1 YNYWIY 184 5.11H2 VH CDR2 CINTGNSGITNYANWAK 185 5.11H2 VH CDR3 GGINSGDYMNL 186 5.11H2 VL CDR1 QASENIYRLLA 187 5.11H2 VL CDR2 DASTLAS 188 5.11H2 VL CDR3 QQAYSNSNIDNY 189 5.11H2 VH QSLEESGGDLVKPGASLTLTCTASGFSFSYNYWIYWVRQAPGKGLEWIGCINTGNSGIT NYANWAKGRFTISKTSSTTVTLQMTSLTAADTATYFCARGGINSGDYMNLWGPGTLVTV SS 190 5.11H2 VL AYDMTQTPASVEVAVGGTVTIKCQASENIYRLLAWYQQKPGQAPKLLIYDASTLASGVP SRFSGSGSGTQFTLTVSGVQCDDAATYYCQQAYSNSNIDNYFGGGTEVVVK 191 5.11H2HC METGLRWLLLVAVLKGVQCQSLEESGGDLVKPGASLTLTCTASGFSFSYNYWIYWVRQA PGKGLEWIGCINTGNSGITNYANWAKGRFTISKTSSTTVTLQMTSLTAADTATYFCARG GINSGDYMNLWGPGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVT VTWNSGTLTNGVRTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAP STCSKPTCPPPELLGGPSVFIFPPKPKDTLMISRTPEVTCVWDVSQDDPEVQFTWYIN NEQVRTARPPLREQQFNSTIRWSTLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKA RGQPLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVEWEKNGKAEDNYKTTPAVL DSDGSYFLYNKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK 192 5.11H2LC MDMRAPTQLLGLLLLWLPGARCAYDMTQTPASVEVAVGGTVTIKCQASENIYRLLAWYQ QKPGQAPKLLIYDASTLASGVPSRFSGSGSGTQFTLTVSGVQCDDAATYYCQQAYSNSN IDNYFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGT TQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC 193 5.14D6 VH CDR1 SKTIT 194 5.14D6 VH CDR2 FINTDGRAYYASWA 195 5.14D6 VH CDR3 TNL 196 5.14D6 VL CDR1 QASQSVYKNNYLA 197 5.14D6 VL CDR2 SVSTLDS 198 5.14D6 VL CDR3 LGSYDCSSADCAA 199 5.14D6 VH QSVEESGGRLVTPGTPLTLTCTVSGFSLSSKTITWVRQAPGKGLEWIGFINTDGRAYYA SWAKGRFTISKTSTTVDLKITSPTTEDTATYFCGRTNLWGQGTLVTVSS 200 5.14D6 VL AQVLTQTSSPVSAAVGSTVTINCQASQSVYKNNYLAWFQQKPGQPPKRLIYSVSTLDSG VPSRFSGSGSGTQFTLTISDVQCDDAATYYCLGSYDCSSADCAAFGGGTEVVVK 201 5.14D6 HC METGLRWLLLVAVLKGVQCQSVEESGGRLVTPGTPLTLTCTVSGFSLSSKTITWVRQAP GKGLEWIGFINTDGRAYYASWAKGRFTISKTSTTVDLKITSPTTEDTATYFCGRTNLWG QGTLVTVSSGQPKAPSVFPLAPCCGDTPSSTVTLGCLVKGYLPEPVTVTWNSGTLTNGV RTFPSVRQSSGLYSLSSVVSVTSSSQPVTCNVAHPATNTKVDKTVAPSTCSKPTCPPPE LLGGPSVFIFPPKPKDTLMISRTPEVTCVVVDVSQDDPEVQFTWYINNEQVRTARPPLR EQQFNSTIRWSTLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKARGQPLEPKVYTM GPPREELSSRSVSLTCMINGFYPSDISVEWEKNGKAEDNYKTTPAVLDSDGSYFLYNKL SVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK 202 5.14D6 LC MDMRAPTQLLGLLLLWLPGATFAQVLTQTSSPVSAAVGSTVTINCQASQSVYKNNYLAW FQQKPGQPPKRLIYSVSTLDSGVPSRFSGSGSGTQFTLTISDVQCDDAATYYCLGSYDC SSADCAAFGGGTEVWKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEV DGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNR GDC 203 3.7F5 VH CDR1 DYNVF 204 3.7F5 VH CDR2 YIDPYNGATSYNQKFKD 205 3.7F5 VH CDR3 GTVRAFFDS 206 3.7F5 VL CDR1 KSSQSLLYRNDQINYLA 207 3.7F5 VL CDR2 WASTRES 208 3.7F5 VL CDR3 QQYYSYPPT 209 3.7F5 VH EIHLQQSGPEVVQPGASLKVSCKASDYSFTDYNVFWVKQSHGKSLEWIAYIDPYNGATS YNQKFKDKATLTVDKSSSTAFMYLNSLTSEDSAVYYCARGTVRAFFDSWGQGTTL 210 3.7F5 VL DIVMSQSPSSLVVSVGEKVSLSCKSSQSLLYRNDQINYLAWYQQKPGQSPKLLIFWAST RESGVPVRFTGSGSGTDFTLNINTVKAEDLAVYYCQQYYSYPPTFGT 211 3.7F5 HC MGWSCIILFLVATATGAYAEIHLQQSGPEWQPGASLKVSCKASDYSFTDYNVFWVKQS LALAPG mIgG2a HGKSLEWIAYIDPYNGATSYNQKFKDKATLTVDKSSSTAFMYLNSLTSEDSAVYYCARG TVRAFFDSWGQGTTLTVSSASTKGPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLT WNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP RGPTIKPCPPCKCPAPNAAGGPSVFIFPPKIKDVLMISLSPIVTCVWDVSEDDPDVQI SWFVNNVEVHTAQTQTHREDYNSTLRWSALPIQHQDWMSGKEFKCKVNNKDLGAPIER TISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKN TEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK 212 3.7F5 LC MGWSCIILFLVATATGVHSDIVMSQSPSSLWSVGEKVSLSCKSSQSLLYRNDQINYLA LALAPG mIgG2a WYQQKPGQSPKLLIFWASTRESGVPVRFTGSGSGTDFTLNINTVKAEDLAVYYCQQYYS YPPTFGTGTKLEIKRADAAPTVSIFPPSSEQLTSGGASWCFLNNFYPKDINVKWKIDG SERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR NEC 213 Human APOL1 EA GARVQQNVPS GTDTGDPQSK KIK isotype PLGDWAAGTM DRESSIFIED AIKYFKEKVS TQNLLLLLTD NEAWNGFVAA G0 form AELPRNEADE LRKALDNLAR QMIMKDKNWH DKGQQYRNWF LKEFPRLKSE (no signal LEDNIRRLRA LADGVQKVHK GTTIANVVSG SLSISSGILT LVGMGLAPFT sequence) EGGSLVLLEP GMELGITAAL TGITSSTIDY GKKWWTQAQA HDLVIKSLDK LKEVXEFLGE NISNFLSLAG NTYQLTRGIG KDIRALRRAR ANLQSVPHAS ASRPRVTEPI SAESGEQVER VNEPSILEMS RGVKLTDVAP VSFFLVLDW YLVYESKHLH EGAKSETAEE LKKVAQELEE KLNILNNNYK ILQADQEL 214 Human APOL1 EA GARVQQNVPS GTDTGDPQSK EIK isotype PLGDWAAGTM DRESSIFIED AIKYFKEKVS TQNLLLLLTD NEAWNGFVAA G0 form AELPRNEADE LRKALDNLAR QMIMKDKNWH DKGQQYRNWF LKEFPRLKSE (no signal LEDNIRRLRA LADGVQKVHK GTTIANVVSG SLSISSGILT LVGMGLAPFT sequence) EGGSLVLLEP GMELGITAAL TGITSSTIDY GKKWWTQAQA HDLVIKSLDK LKEVKEFLGE NISNFLSLAG NTYQLTRGIG KDIRALRRAR ANLQSVPHAS ASRPRVTEPI SAESGEQVER VNEPSILEMS RGVKLTDVAP VSFFLVLDW YLVYESKHLH EGAKSETAEE LKKVAQELEE KLNILNNNYK ILQADQEL 215 Human APOL1 G1 EA GARVQQNVPS GTDTGDPQSK variant of EMR PLGDWAAGTM DRESSIFIED AIKYFKEKVS TQNLLLLLTD NEAWNGFVAA isotype AELPRNEADE LRKALDNLAR QMIMKDKNWH DKGQQYRNWF LKEFPRLKSE (no signal LEDNIRRLRA LADGVQKVHK GTTIANVVSG SLSISSGILT LVGMGLAPFT sequence) EGGSLVLLEP GMELGITAAL TGITSSTIDY GKKWWTQAQA HDLVIKSLDK LKEVKEFLGE NISNFLSLAG NTYQLTRGIG KDIRALRRAR ANLQSVPHAS ASRPRVTEPI SAESGEQVER VNEPSILEMS RGVKLTDVAP VGFFLVLDW YLVYESKHLH EGAKSETAEE LKKVAQELEE KLNMLNNNYK ILQADQEL 216 Human APOL1 G2 EA GARVQQNVPS GTDTGDPQSK variant of EMR PLGDWAAGTM DRESSIFIED AIKYFKEKVS TQNLLLLLTD NEAWNGFVAA isotype AELPRNEADE LRKALDNLAR QMIMKDKNWH DKGQQYRNWF LKEFPRLKSE (no signal LEDNIRRLRA LADGVQKVHK GTTIANVVSG SLSISSGILT LVGMGLAPFT sequence) EGGSLVLLEP GMELGITAAL TGITSSTMDY GKKWWTQAQA HDLVIKSLDK LKEVKEFLGE NISNFLSLAG NTYQLTRGIG KDIRALRRAR ANLQSVPHAS ASRPRVTEPI SAESGEQVER VNEPSILEMS RGVKLTDVAP VSFFLVLDW YLVYESKHLH EGAKSETAEE LKKVAQELEE KLNILNN__K ILQADQEL