Conjugates of Guide RNA-Cas Protein Complex
20250381301 ยท 2025-12-18
Inventors
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N9/226
CHEMISTRY; METALLURGY
C12N2740/15043
CHEMISTRY; METALLURGY
A61K48/0058
HUMAN NECESSITIES
C12N2750/14143
CHEMISTRY; METALLURGY
C12N2830/002
CHEMISTRY; METALLURGY
A61K48/0066
HUMAN NECESSITIES
C12N15/11
CHEMISTRY; METALLURGY
International classification
A61K48/00
HUMAN NECESSITIES
C12N15/11
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
Abstract
Provided herein are compositions of conjugates of a guide RNA(s)-CRISPR Cas protein (RNP) complex. The conjugate comprises a guide RNA(s)-CRISPR Cas protein (RNP) complex and one or more molecules selected from PEG, non-PEG polymers, ligands for cellular receptors, lipids, oligonucleotides, polysaccharides and peptides and chemically linked to the Cas protein and/or guide RNA(s). The conjugates are delivered to targeted cells as RNP complexes, or formed in targeted cells from guide RNA conjugates and a mRNA or a viral vector encoding a Cas protein, or formed in targeted cells from a crRNA conjugates and a viral vector encoding both a Cas protein and a tracrRNA. Also provided are preparation methods and uses of these conjugates.
Claims
1. A conjugate of CRISPR-Cas protein-guide RNA(s) complex, comprising a) an lgRNA-Cas protein (RNP) complex and b) one or more molecules selected from the group consisting of PEG, non-PEG polymers, ligands of cellular receptors, lipids, oligonucleotides, antibodies, polysaccharides, glycans and peptides, wherein said one or more molecules are chemically linked to said RNP complex.
2-38. (canceled)
39. Said conjugated oligonucleotide of claim 1 comprising a sequence to introduce one or more stop codons selected from the sequence group consisting of 5-(tga)-3, 5-(taa)-3, 5-(tag)-3, 5-(tga-ntga-ntga)-3, 5-(tga-ntga-ntaa)-3, 5-(tga-ntga-ntag)-3, 5-(tga-ntaa-ntga)-3, 5-(tga-ntaa-ntaa)-3, 5-(tga-ntaa-ntag)-3, 5-(tga-ntga-ntga)-3, 5-(tga-ntga-ntaa)-3, 5-(tga-ntga-ntag)-3, 5-(taa-ntga-ntga)-3, 5-(taa-ntga-ntaa)-3, 5-(taa-ntga-ntag)-3, 5-(taa-ntaa-ntga)-3, 5-(taa-ntaa-ntaa)-3, 5-(taa-ntaa-ntag)-3, 5-(taa-ntga-ntga)-3, 5-(taa-ntga-ntaa)-3, 5-(taa-ntga-ntag)-3, 5-(tag-ntga-ntga)-3, 5-(tag-ntga-ntaa)-3, 5-(tag-ntga-ntag)-3, 5-(tag-ntaa-ntga)-3, 5-(tag-ntaa-ntaa)-3, 5-(tag-ntaa-ntag)-3, 5-(tag-ntga-ntga)-3, 5-(tag-ntga-ntaa)-3, 5-(tag-ntga-ntag)-3, wherein n is any nucleotide, and said more stop codons comprises repetitive said sequence separated by absent or more nucleotides in between or different said sequences separated by absent or more nucleotides in between.
40. Said conjugated oligonucleotide of claim 1 comprising one or more aptamers.
41. Said conjugate of CRISPR-Cas protein-lgRNA(s) complex of claim 1, wherein the chemical linkages are covalent, and each optionally biodegradable in targeted cells and tissues.
42. Said conjugate of CRISPR-Cas protein-lgRNA(s) complex of claim 41, wherein the chemical linkages are redox-responsive disulfide bond.
43. Said conjugate of CRISPR-Cas protein-lgRNA(s) complex of claim 41, wherein the biodegradable covalent linkage is selected from the group consisting of acetal [OC(RR)O], carboxylic acid ester [R(CO)O], thioester [R(CO)S], carbamate ester [N(RR)(CO)O], and carbonate ester [RO(CO)O], wherein each of R and R is an optionally substituted alkyl, or an optionally substituted aryl, or an optionally substituted heteroaryl.
44. A method of gene editing comprising the following steps: a) delivering to targeted cells conjugates of CRISPR-Cas protein-lgRNA complex of claim 1; b) cleaving DNA to be edited, leading to a double strand break or a nick; c) hybridizing the resulting single DNA strand of the cleavage product with the 3-homology arm of conjugated donor template and extending the 3-end of complementary broken strand using said template to edit the target gene by introducing insertions, deletions or point mutations included in the gene editing sequence of conjugated oligonucleotide; d) recycling the RNP complexes.
45. Said method of claim 44 for treatment of chronic viral infections comprising the following steps: a) delivering to infected cells conjugates of CRISPR-Cas protein-lgRNA complex of claim 1; b) cleaving viral episomal, viral integrated DNA or both, leading to a double strand break or a nick; c) hybridizing one of the resulting single DNA strand of the cleavage product with the 3-homology arm of conjugated donor template and extending the 3-end of complementary broken strand using said template to deactivate the viral gene by introducing insertions, deletions or point mutations included in the gene editing sequence; d) recycling the RNP complexes.
46. Said chronic viral infection in claim 45 is HBV, HIV or herpesvirus infection.
47. A method of delivering conjugates of a CRISPR RNP complex(es) of claim 1 to cells or animals comprising: a) delivering a tissue tropic viral vector encoding a Cas protein comprising recognition domains and endonuclease domains and b) delivering guide RNA(s) selected from the group consisting of lgRNA(s), lgRNA conjugate(s), dual guide RNAs comprising a ligated tracrRNA or its conjugate(s), dual guide RNAs comprising a crRNA conjugate(s) and a ligated tracrRNA, and guide RNAs comprising a crRNA conjugate(s), in an aqueous solution gymnotically or with transfection reagents or in a non-viral carrier; wherein a) and b) can be co-injections or separate injections.
48. Said method of claim 47 further comprises: c) delivering one or more donor nucleic acid sequence for correction, insertion or replacement of a target gene, and the sequence is optionally conjugated with cell targeting ligands, antibodies, or aptamers, either in an aqueous solution gymnotically or with transfection reagents or in a non-viral carrier.
49. Said method of claim 47, wherein said guide RNA conjugate(s) of b) comprises guide RNA(s) and one or more conjugated ssDNA templates for DNA repair and delivered either in an aqueous solution gymnotically or with transfection reagents or in a non-viral carrier.
50. Said method of claim 49, wherein said conjugated ssDNA template is replaced with a double strand DNA (dsDNA) covalently linked to guide RNA(s) via a linker to either of its double strands. The said linker is a nucleotide linker or an nNt-linker.
51. Said method of claim 47, wherein said Cas protein of a) is delivered as its mRNA either in an aqueous solution gymnotically or with transfection reagents or in a non-viral carrier.
52. Said method of claim 47, wherein: said tissue tropic viral vector of a) encodes both a tracrRNA and a Cas protein comprising recognition domains and endonuclease domains; and said guide RNA of b) is a crRNA conjugate.
53. Said method of claim 52 further comprises: c). delivering a donor nucleic acid sequence for correction, insertion or replacement of a target gene, and the sequence optionally conjugated with cell targeting ligands, antibodies, or aptamers, either in an aqueous solution gymnotically or with transfection reagents or in a non-viral carrier, wherein a), b) and c) can be co-injections or separate injections.
54. Said method of claim 52, wherein said crRNA conjugate(s) of b) comprises a crRNA and one or more ssDNA template for DNA repair conjugated at either 5-end or 3-end of crRNA and delivered either in an aqueous solution gymnotically or with transfection reagents or in a non-viral carrier.
55. Said method of claim 54, wherein said conjugated ssDNA template is replaced with a double strand DNA (dsDNA) covalently linked to crRNA(s) via a linker to either of its double strands. The said linker is a nucleotide linker or an nNt-linker.
56. Said method of claim 52, wherein the expression of said Cas protein and tracrRNA is optionally under the control of a single or a plurality of switchable transcription promotor and/or enhancer and/or depressor.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0073]
[0074]
[0075]
[0076] A. Selective conjugations at serine and lysine residues of a preformed RNP complex; B. Selective conjugations at lysine residues of a preformed RNP complex; C. Selective conjugations at cysteine residues of an engineered Cas protein obtained by site-directed mutagenesis, followed by RNP formation.
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
Definition
[0085] The definitions of terms used herein are consistent to those known to those of ordinary skill in the art, and in case of any differences the definitions are used as specified herein instead.
[0086] The term nucleoside as used herein refers to a molecule composed of a heterocyclic nitrogenous base, containing an N-glycosidic linkage with a sugar, particularly a pentose. An extended term of nucleoside as used herein also refers to acyclic nucleosides and carbocyclic nucleosides.
[0087] The term nucleotide as used herein refers to a molecule composed of a nucleoside monophosphate, di-, or triphosphate containing a phosphate ester at 5-, 3-position or both. The phosphate can also be a phosphonate, phosphoramidate, phosphorodiamidate, phosphonoacetate (PACE), thiophosphonoacetate (thioPACE), or phosphoromonothioate.
[0088] The term of oligonucleotide (ON) is herein used interchangeably with polynucleotide, nucleotide sequence, and nucleic acid, and refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. An oligonucleotide may comprise one or more modified nucleotides, which may be imparted before or after assembly of such an oligonucleotide. The sequence of nucleotides may be interrupted by non-nucleotide components.
[0089] The term of CRISPR-Cas system refers a prokaryotic immune system that confers resistance to foreign genetic elements such as those present within plasmids and phages that provides a form of acquired immunity. RNA harboring the spacer sequence helps Cas (CRISPR-associated) proteins recognize and cut foreign pathogenic DNA. Other RNA-guided Cas proteins cut foreign RNA. CRISPR are found in approximately 50% of sequenced bacterial genomes and nearly 90% of sequenced archaea. The system is being engineered for gene regulation and editing, insertion, disruption and/or correction in eukaryotic cells.
[0090] The term of CRISPR/Cas9 refers to the type II CRISPR-Cas system such as spCas9 from Streptococcus pyogenes. The type II CRISPR-Cas system comprises protein Cas9 and two noncoding RNAs (crRNA and tracrRNA). These two noncoding RNAs were further fused into one single guide RNA via a tetraloop (sgRNA) and a chemically ligated guide RNA via one or more nNt-Linkers (lgRNA). The Cas9/sgRNA or Cas9/lgRNA complex binds double-stranded DNA sequences that contain a sequence match to the first 17-20 nucleotides of the guide RNA(s) and immediately before a protospacer adjacent motif (PAM). Once bound, two independent nuclease domains (HNH and RuvC) in Cas9 each cleaves one of the DNA strands 3 bases (HNH) or more (RuvC) upstream of the PAM, leaving a DNA double stranded break (DSB).
[0091] The term of Cas protein refers to a class 2 CRISPR-Cas protein.
[0092] The term of off-target effects refers to non-targeted cleavage of the genomic DNA target sequence by Cas9 or any other Cas protein in spite of imperfect matches between the gRNA sequence and the genomic DNA target sequence. Single mismatches of the gRNA can be permissive for off-target cleavage by Cas9. Off-target effects were reported for all the following cases: (a) same length but with 1-5 base mismatches; (b) off-target site in target genomic DNA has one or more bases missing (deletions); (c) off-target site in target genomic DNA has one or more extra bases (insertions).
[0093] The term of guide RNA (gRNA) refers to a synthetic fusion of crRNA and tracrRNA via a tetraloop (GAAA) (defined as sgRNA) or other chemical linkers such as an nNt-Linker (defined as lgRNA), and is used interchangeably with chimeric RNA, chimeric guide RNA, single guide RNA and synthetic guide RNA. The gRNA contains secondary structures of the repeat:anti-repeat duplex, stem loops 1-3, and the linker between stem loops 1 and 2.
[0094] The term of dual RNAs or dual guide RNAs refers to hybridized complex of the short CRISPR RNAs (crRNA) and the trans-activating crRNA (tracrRNA). The crRNA hybridizes with the tracrRNA to form a crRNA:tracrRNA duplex, which is loaded onto a Cas protein to direct the cleavage of cognate DNA sequences bearing appropriate protospacer-adjacent motifs (PAM).
[0095] The term of lgRNA refers to guide RNA (gRNA) joined by chemical ligations to form non-nucleotide linkers (nNt-linkers) between crgRNA and tracrgRNA, or at other sites.
[0096] The terms of dual lgRNA, triple lgRNA and multiple lgRNA refer to hybridized complexes of the synthetic guide RNA fused by chemical ligations via non-nucleotide linkers. Dual tracrgRNA is formed by chemical ligation between tracrgRNA1 and tracrgRNA2 (RNA segments of 30 nt), and crgRNA (30 nt) is fused with a dual tracrgRNA to form a triple lgRNA duplex, which is loaded onto Cas9 to direct the cleavage of cognate DNA sequences bearing appropriate protospacer-adjacent motifs (PAM). Each RNA segment can be readily accessible by chemical manufacturing and compatible to extensive chemical modifications.
[0097] The term guide sequence refers to the about 20 bp sequence within the guide RNA that specifies the target site and is herein used interchangeably with the terms guide or spacer.
[0098] The term tracr mate sequence may also be used interchangeably with the term direct repeat(s).
[0099] The term of crgRNA refers to crRNA equipped with chemical functions for conjugation/ligation. The oligonucleotide may be chemically modified close to its 3-end, any one or several nucleotides, or for its full sequence. A crgRNA may also be prepared by in vitro transcription at the presence of a RNA polymerase such as bacteriophage T7 RNA polymerase, and the conjugating chemical function, e.g., amine and alkyne, is incorporated at its 5 (preferably as 5-GU or 5-GC) or 3-end from a nucleoside triphosphate analogue, e.g. CTP, UTP:
##STR00008## ##STR00009##
and etc.
[0100] The term of tracrgRNA refers to tracrRNA equipped with chemical functions for conjugation/ligation. The oligonucleotide may be chemically modified at any one or several nucleotides, or for its full sequence by chemical synthesis. A tracrgRNA may also be prepared by in vitro transcription at the presence of a RNA polymerase such as bacteriophage T7 RNA polymerase, and the conjugating chemical function, e.g., amine and alkyne, is incorporated at its 5 (preferably as 5-GU or 5-GC) or 3-end from a nucleoside triphosphate analogue.
[0101] The term of the protospacer adjacent motif (PAM) refers to a DNA sequence immediately following the DNA sequence targeted by Cas9 in the CRISPR bacterial adaptive immune system, including NGG, NNNNGATT, NNAGAA, NAAAC, and others from different bacterial species where N is any nucleotide. In CRISPR-Casl2a system, PAM refers to a DNA sequence such as TTTN immediately before the targeted DNA sequence.
[0102] The term of chemical ligation refers to joining together synthetic oligonucleotides via an nNt-linker by chemical methods such as click ligation (the azide-alkyne reaction to produce a triazole linkage), thiol-maleimide reaction, and formations of other chemical groups.
[0103] The term of complementary refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick or other non-traditional types. Cas9 contains two nuclease domains, HNH and RuvC, which cleave the DNA strands that are complementary and non-complementary to the 20 nucleotide (nt) guide sequence in crRNAs, respectively.
[0104] The term of a donor template refers to a transgene cassette or a gene-editing-sequence flanked with homologous regions to recombine with the host loci and replace the mutated DNA with the correct sequence by HDR/SSTR. A donor template can be an ssDNA or a dsDNA or a plasmid/vector, and may be chemically conjugated to guide RNA(s) or Cas protein via a covalent linker.
[0105] A donor template can be chemically synthesized and equipped with chemical functions for conjugations/ligations. A conjugating donor template may also be prepared by in vitro gene synthesis at the presence of a DNA polymerase, with chemical functions, e.g. an amine and an alkyne, enzymatically incorporated at its 5 or 3-end for chemical conjugation/ligation from a nucleoside triphosphate analogue.
[0106] The term of gene editing sequence, gene-editing-sequence or gene_editing_sequence refers to the sequence contained in a donor template sequence to introduce expected gene editing, between the two homology arms identical to the DNA fragments flanking the cleavage site.
[0107] The term of Hybridization refers to a reaction in which one or more polynucleotides form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues. The complex may comprise two strands forming a duplex structure, three or more strands forming a multi stranded complex, a single self-hybridizing strand, or any combination of these. A sequence capable of hybridizing with a given sequence is referred to as the complement of the given sequence.
[0108] The synonymous terms hydroxyl protecting group and alcohol-protecting group as used herein refer to substituents attached to the oxygen of an alcohol group commonly employed to block or protect the alcohol functionality while reacting other functional groups on the compound. Examples of such alcohol-protecting groups include but are not limited to the 2-tetrahydropyranyl group, 2-(bisacetoxyethoxy)methyl group, trityl group, trichloroacetyl group, carbonate-type blocking groups such as benzyloxycarbonyl, trialkylsilyl groups, examples of such being trimethylsilyl, tert-butyldimethylsilyl, tert-butyldiphenylsilyl, phenyldimethylsilyl, triiospropylsilyl and thexyldimethylsilyl, ester groups, examples of such being formyl, (C1-C10) alkanoyl optionally mono-, di- or tri-substituted with (C1-C6) alkyl, (C1-C6) alkoxy, halo, aryl, aryloxy or haloaryloxy, the aroyl group including optionally mono-, di- or tri-substituted on the ring carbons with halo, (C1-C6) alkyl, (C1-C6) alkoxy wherein aryl is phenyl, 2-furyl, carbonates, sulfonates, and ethers such as benzyl, p-methoxybenzyl, methoxymethyl, 2-ethoxyethyl group, etc. The choice of alcohol-protecting group employed is not critical so long as the derivatized alcohol group is stable to the conditions of subsequent reaction(s) on other positions of the compound of the formula and can be removed at the desired point without disrupting the remainder of the molecule. Further examples of groups referred to by the above terms are described by J. W. Barton, Protective Groups In Organic Chemistry, J. G. W. McOmie, Ed., Plenum Press, New York, N.Y., 1973, and G.M. Wuts, T.W. Greene, Protective Groups in Organic Synthesis, John Wiley & Sons Inc., Hoboken, New Jersey, 2007, which are hereby incorporated by reference. The related terms protected hydroxyl or protected alcohol define a hydroxyl group substituted with a hydroxyl protecting group as discussed above.
[0109] The term nitrogen protecting group, as used herein, refers to groups known in the art that are readily introduced on to and removed from a nitrogen atom. Examples of nitrogen protecting groups include but are not limited to acetyl (Ac), trifluoroacetyl, Boc, Cbz, benzoyl (Bz), N,N-dimethylformamidine (DMF), trityl, and benzyl (Bn). See also G. M. Wuts, T. W. Greene, Protective Groups in Organic Synthesis, John Wiley & Sons Inc., Hoboken, New Jersey, 2007, and related publications.
[0110] The term conjugation, as used herein, refers to a method for covalently crosslinking drug molecules, proteins or nucleic acids to other molecules using crosslinking reagents. The product of conjugation is referred as conjugate(s). Traditional pharmaceuticals can be linked to monoclonal antibodies to deliver targeted doses, prevent breakdown, decrease immunogenicity, and increase bioavailability in circulation. CRISPR RNP complex can be chemically modified by linking to other molecules either covalently or non-covalently.
[0111] The term conjugating site, as used herein, refers to a chemical moiety which is directly linked to other molecules by conjugation, and a conjugating site can be an amino acid residue, N-terminus or C-terminus of proteins, a nucleoside, a nucleotide, or a phosphate.
[0112] The term PEG, or macrogol, as used herein, refers to polyethylene glycol chains, linear, branched, substituted or unsubstituted. A derivatized linear single PEG chain comprises at least 2 PEG subunits.
[0113] The term PEGylation, as used herein, refers to the process of both covalent and non-covalent attachment or amalgamation of polyethylene glycol (PEG) polymer chains to molecules and macrostructures, such as a drug, a CRISPR RNP complex, a therapeutic protein or vesicle, which is then described as PEGylated. PEGylation is routinely achieved by incubation of a reactive derivative of PEG with the target molecule.
[0114] The term glycan, as used herein, refers to polysaccharides or the carbohydrate portion of a glycoconjugate, such as a glycoprotein, glycolipid, or a proteoglycan, even if the carbohydrate is only an oligosaccharide
[0115] The term polysaccharides, as used herein, refers compounds consisting of a large number of monosaccharides linked glycosidically.
[0116] The term epitope or antigenic determinant, as used herein, refers to the part of an antigen that is recognized by the immune system, specifically by antibodies, B cells, or T cells. An epitope can be either conformational or linear.
[0117] The term epitope masking, as used herein, refers to identifying potentially immunogenic peptide sequences and modifying or removing them to prevent detection by the immune system while still maintaining the therapeutic function of the original protein.
[0118] The term of Isotopically enriched refers to a compound containing at least one atom having an isotopic composition other than the natural isotopic composition of that atom. The term of Isotopic composition refers to the amount of each isotope present for a given atom, and natural isotopic composition refers to the naturally occurring isotopic composition or abundance for a given atom. As used herein, an isotopically enriched compound optionally contains deuterium, carbon-13, nitrogen-15, and/or oxygen-18 at amounts other than their natural isotopic compositions.
[0119] As used herein, the terms therapeutic agent and therapeutic agents refer to any agent(s) which can be used in the treatment or prevention of a disorder or one or more symptoms thereof. In certain embodiments, the term therapeutic agent includes a compound provided herein. In certain embodiments, a therapeutic agent is an agent known to be useful for, or which has been or is currently being used for the treatment or prevention of a disorder or one or more symptoms thereof.
[0120] The term of gene therapy refers to altering a disease-causing gene in a patient or introducing a healthy copy of a mutated gene to a patient to treat genetic diseases. CRISPR/Cas can potentially be used to introduce site specific gene editing to correct disease-causing mutations, or to deliver a correct gene into human genome to fix a defect gene or a desired gene. CRISPR/Cas can potentially be used to remove and/or deactivate episomal HBV cccDNA and integrated viral genomes such as HIV proviral DNA and integrated HBV DNA to cure these infectious diseases.
[0121] It is noted that as used, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a guide RNA(s)-Cas protein (RNP) complex includes a plurality of such complexes. Reference to the conjugate includes reference to one or more conjugates and equivalents thereof known to those skilled in the art, and so forth. It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as solely, only and the like in connection with the recitation of claim elements, or use of a negative limitation.
[0122] As used herein, the term about will be understood by persons of ordinary skill in the art and will vary to some extent depending upon the context in which it is used. If there are uses of the term which are not clear to persons of ordinary skill in the art given the context in which it is used, about will mean up to plus or minus 10% of the particular term.
Nucleotides
[0123] In some embodiments, the crRNA and tracrRNA are truncated at 3-end and 5-end, respectively:
##STR00010##
and the duplex ends are rejoined by a small molecule non-nucleotide linker (nNt-linker, ligation1) to form a ligated dual lgRNA:
##STR00011##
wherein NNNNNNNNNN NNNNNNNNNN is a guide sequence of 17-20 nt, and N is preferably a ribonucleotide with intact 2-OH, and wherein is a chemical nNt-linker.
[0124] In some embodiments, the duplex ends are rejoined by a tetraloop (e.g. GAAA) to form an sgRNA:
##STR00012##
[0125] In other embodiments, tracrRNA is a ligated dual oligonucleotide (via ligation2, the inner ligation between tracrgRNA1 and tracrgRNA2), or a multiple oligonucleotide. Non-limiting examples include:
##STR00013##
[0126] In some embodiments, the crRNA and tracrRNA are further truncated, and the ligation sites can be located at other positions, as illustrated by non-limiting examples of resulting lgRNAs in U.S. Pat. No. 10,059,940.
[0127] In some embodiments, crRNA and tracrRNA are truncated at 3-end and 5-end, respectively, and the duplex ends are rejoined by nucleotide linker such as an aptamer and thus to provide an extended single gRNA with small molecule and protein recognition module(s):
##STR00014##
[0128] In another embodiment, the crRNA and tracrRNA are truncated at 3-end and 5-end, respectively, and the duplex ends are rejoined by non-nucleotide linker-aptamer conjugate to provide an extended single lgRNA with small molecule and protein recognition module(s):
##STR00015##
[0129] In another embodiment, the stem loop of tracrRNA is split at the GAAA tetraloop, and the duplex ends are rejoined by non-nucleotide linker-aptamer conjugate to provide an extended tracrRNA with small molecule and protein recognition module(s):
##STR00016##
[0130] In yet another embodiment, lgRNA is conjugated with an aptamer by a non-nucleotide linker at either of the two GAAA tetraloops or both, or 5/3-end of sgRNA, to bind a small molecule or a biopolymer such as a protein or a nucleic acid:
##STR00017##
[0131] In some embodiments, the crRNA and tracrRNA are shortened by truncation at 3-end and 5-end, respectively, and the repeat/anti-repeat duplex comprises a bulge and >12 Watson-Crick base pairs:
##STR00018##
[0132] In some embodiments, the crRNA and tracrRNA are joined at 3-end of tracrRNA and 5-end of crRNA by a nucleotide linker or a non-nucleotide linker to form a sgRNA or lgRNA, respectively; and the tracrRNA is optionally a ligated tracrRNA comprising one or more than one non-nucleotide linker:
##STR00019##
[0133] In some embodiments, the dual guide RNAs, sgRNA and lgRNA are conjugates of small molecule ligands, antibodies or aptamers:
##STR00020## ##STR00021## ##STR00022##
[0134] In some embodiments, the crRNA, dual guide RNAs, sgRNA and lgRNA are conjugates of single-stranded template repair (SSTR) donor DNA templates of sequences containing a 5-homology arm and a downstream gene editing sequence, optionally followed by a 3-homology arm. Non-limiting such examples are given below:
##STR00023## ##STR00024##
[0135] In certain embodiments, the conjugating linker is an oligonucleotide.
[0136] In certain embodiments, the conjugating linker is an RNA tetraloop such as ANYA, CUYG, GNRA, UNAC and UNCG, in which N could be uracil, adenine, cytosine, or guanine, R is either guanine or adenine and Y is either uracil or cytosine.
[0137] In certain embodiments, the conjugating linker is an nNt-linker, as described in U.S. Pat. No. 10,059,940, selected from a group comprising a 1,4-disubstituted 1,2,3-triazole formed between an alkyne and an azide via [3+2]cycloaddition catalyzed by Cu(I) or without Cu(I) catalysis (such as strain-promoted azide-alkyne cycloaddition (SPAAC)), a thioether by chemical ligation between a thiol and a maleimide, and other functional groups.
[0138] In certain embodiments, homology arms flanking the gene editing sequence overlap with the non-target PAM containing strand of target DNA.
[0139] In certain embodiments, homology arms flanking the gene editing sequence overlap with the target strand of target DNA.
[0140] In some embodiments, the conjugating site is the 5-position of the nucleoside base U or C, or the 7-position of the nucleoside base 7-deazaguanine or 7-deazaadenine, or the 8-position of the nucleoside base purine.
[0141] In other embodiments, the conjugating site is the 2- or 5-position of the sugar moiety of the 5-end nucleotide of crRNA, tracrRNA, a single strand HDR/SSTR donor template (ssDNA), sgRNA or lgRNA.
[0142] In other embodiments, the conjugating site is the 2- or 3-position of the sugar moiety of the 3-end nucleotide of crRNA, tracrRNA, a single strand HDR/SSTR donor template (ssDNA), sgRNA or lgRNA.
[0143] In certain embodiments, as non-limiting examples, the lgRNA-ssDNA conjugates comprise the following structures:
##STR00025## ##STR00026## ##STR00027##
[0144] In some embodiments, the gene-editing-sequence comprises one or more sequences selected from a group comprising 5-(tga)-3, 5-(taa)-3, 5-(tag)-3, 5-(tga-ntga-ntga)-3, 5-(tga-ntga-ntaa)-3, 5-(tga-ntga-ntag)-3, 5-(tga-ntaa-ntga)-3, 5-(tga-ntaa-ntaa)-3, 5-(tga-ntaa-ntag)-3, 5-(tga-ntga-ntga)-3, 5-(tga-ntga-ntaa)-3, 5-(tga-ntga-ntag)-3, 5-(taa-ntga-ntga)-3, 5-(taa-ntga-ntaa)-3, 5-(taa-ntga-ntag)-3, 5-(taa-ntaa-ntga)-3, 5-(taa-ntaa-ntaa)-3, 5-(taa-ntaa-ntag)-3, 5-(taa-ntga-ntga)-3, 5-(taa-ntga-ntaa)-3, 5-(taa-ntga-ntag)-3, 5-(tag-ntga-ntga)-3, 5-(tag-ntga-ntaa)-3, 5-(tag-ntga-ntag)-3, 5-(tag-ntaa-ntga)-3, 5-(tag-ntaa-ntaa)-3, 5-(tag-ntaa-ntag)-3, 5-(tag-ntga-ntga)-3, 5-(tag-ntga-ntaa)-3 and 5-(tag-ntga-ntag)-3, wherein n is any nucleotide, and said more stop codons comprises repetitive said sequence separated by absent or more nucleotides in between or different said sequences separated by absent or more nucleotides in between.
[0145] In some embodiments, the gene-editing-sequence comprises one or more sequences such as stop codons to deactivate integrated and episomal viral DNAs, oncogenic or pathogenic gene loci in animals and human.
[0146] In some embodiments, the gene-editing-sequence comprises one or more sequences such as stop codons to deactivate target gene(s) and to eliminate deleterious off-target edits.
[0147] In some embodiments, the gene-editing-sequence comprises DNA sequence(s) to correct oncogenic or pathogenic gene mutations in animals and human.
[0148] In other embodiments, the conjugated single strand HDR/SSTR donor template (ssDNA) forms a duplex with its complementary stand, i.e. HDR donor template is a double strand DNA (dsDNA) covalently linked to guide RNA(s) via a linker to either of its double strands.
[0149] The said linker of X and Y is an L linker, a nucleotide linker or an nNt-linker and can be the same or different.
##STR00028##
[0150] In some embodiments, the said conjugated oligonucleotide is a donor template which comprises two sequences overlapping with the target strand or with the non-target strand of the DNA duplex to be edited, e.g. 5- and 3-homology arms, and a gene editing sequence, and the said two sequences flanking the said gene editing sequence are optionally chemically modified, and the said 3-homology arm comprises an optionally chemically modified RNA segment of 5 to 17 nucleotides complementary to 5-end of the spacer of guide RNA, and is joined at its 5-end by a oligonucleotide comprising said gene editing sequence and said 5-homology arm as a template for DNA synthesis (i.e.
[0151] In some embodiments, the said conjugated oligonucleotide is a donor template which comprises two sequences overlapping with the target strand or with the non-target strand of the DNA duplex to be edited, e.g. 5- and 3-homology arms, and a gene editing sequence, and the said two sequences flanking the said gene editing sequence are optionally chemically modified, and the said 3-homology arm comprises an optionally chemically modified DNA or chimeric oligonucleotide segment of 5 to 17 nucleotides complementary to 5-end of the spacer of guide RNA, and is joined at its 5-end by a oligonucleotide comprising said gene editing sequence and said 5-homology arm as a template for DNA synthesis (i.e.
[0152] In some embodiments, the said conjugated oligonucleotide is a donor template for DNA repair or serves as a bridging molecule to a second oligonucleotide via complementary hybridization.
NON-NUCLEOTIDE LINKERS (nNt-linker)
[0153] An nNt-Linker, formed by chemical ligation, comprises an M core structure of Formula M-1 to M-13 as non-limiting examples:
##STR00029## ##STR00030## [0154] wherein XO, S, NH, or CH.sub.2, m=0 to 3 and n=0 to 3, [0155] and two L linkers comprising Formula L-1 to L-23 as non-limiting examples:
##STR00031## ##STR00032## ##STR00033## [0156] wherein m=0 to 16 and n=0 to 16, [0157] said L linkers and said M core structure are joined as L-M-L, wherein the two L linkers are the same or different, and each L optionally comprises one or more structures of Formula L-1 to L-23 or partial structure(s), and attached to two terminal nucleotides of Formula Nuc-1 to Nuc-18 as non-limiting examples:
##STR00034## ##STR00035## ##STR00036## ##STR00037##
wherein the attached positions are
##STR00038##
to L-M-L and
##STR00039##
to upstream and downstream oligonucleotides, respectively, and wherein R is H, OH,
##STR00040##
CH.SUB.2.OH,
##STR00041##
F, NH.sub.2, OMe, CH.sub.2OMe, OCH.sub.2CH.sub.2OMe, an alkyl, a cycloalkyl, an aryl, or heteroaryl, R is H, OH
##STR00042##
CH.SUB.2.OH,
##STR00043##
F, NH.sub.2, OMe, CH.sub.2OMe, OCH.sub.2CH.sub.2OMe, an alkyl, a cycloalkyl, an aryl, or a heteroaryl, and Q is a natural or a non-natural nucleic acid base.
[0158] In some embodiments, the M core structure, L, and terminal nucleotides are optionally modified with substituents such as halogen (F, Cl, Br, I), lower alkyl of C.sub.1-C.sub.6, halogenated (F, Cl, Br, I) lower alkyl of C.sub.1-C.sub.6, lower alkenyl of C.sub.2-C.sub.6, halogenated (F, Cl, Br, I) lower alkenyl of C.sub.2-C.sub.6, CN, lower alkynyl of C.sub.2-C.sub.6, halogenated (F, Cl, Br, I) lower alkynyl of C.sub.2-C.sub.6, lower alkoxy of C.sub.1-C.sub.6, halogenated (F, Cl, Br, I) lower alkoxy of C.sub.1-C.sub.6, an optionally substituted aryl, an optionally substituted heteroaryl, an optionally substituted sulfonyl, or optionally substituted acyl, which includes but is not limited to C(O) alkyl, NR.sub.2, CN, CO.sub.2H, CO.sub.2R, CONH.sub.2, CONHR, CONR.sub.2, CHCHCO.sub.2H, or CHCHCO.sub.2R, wherein R is an optionally substituted alkyl, which includes, but is not limited to, H, an optionally substituted C.sub.1-C.sub.20 alkyl, an optionally substituted lower alkyl, an optionally substituted cycloalkyl, an optionally substituted alkynyl of C.sub.2-C.sub.6, an optionally substituted lower alkenyl of C.sub.2-C.sub.6, an optionally substituted aryl, an optionally substituted heteroaryl, an optionally substituted sulfonyl, or optionally substituted acyl, which includes but is not limited to C(O) alkyl, or alternatively, in the instance of NR.sub.2, each R comprise at least one C atom that are joined to form a heterocycle comprising at least two carbon atoms.
[0159] In some embodiments, an nNt-Linker joins the 3-terminal nucleotide of a crRNA and the 5-terminal nucleotide of a tracrRNA. In some embodiments, an nNt-Linker joins the 5-terminal nucleotide of a crRNA and the 3-terminal nucleotide of a tracrRNA. In some embodiments, an nNt-Linker joins two oligonucleotide segments of tracrRNA.
[0160] In some embodiments, one of the two L's in an nNt-linker (L-M-L) is covalently linked to guide RNA(s), and the other is covalently linked to a PEG polymers, a non-PEG polymer, a ligand for cellular receptors, a lipid, an oligonucleotide, an antibody, a polysaccharides or a peptide.
[0161] In some embodiments, one of the two L's in nNt-linkers (L-M-L) is covalently linked to an exposed amino acid residue of a Cas protein such as lysine, serine, and cysteines, and the other is covalently linked to a PEG polymers, a non-PEG polymer, a ligand for cellular receptors, a lipid, an oligonucleotide, an antibody, a polysaccharides or a peptide.
[0162] In some embodiments, the nNt-linkers between the two nucleotides/nucleosides are represented by the following formulas:
##STR00044## ##STR00045##
Crispr Effector Proteins
[0163] In some embodiments, CRISPR effector endonuclease is selected from Cas proteins of Type II, Class 2 including Streptococcus pyogenes-derived Cas9 (SpCas9, 4.1 kb), smaller Cas9 orthologues, including Staphylococcus aureus-derived Cas9 (SaCas9, 3.16 kb), Campylobacter jejuni-derived Cas9 (CjCas9, 2.95 kb), Streptococcus thermophilus Cas9 (St1Cas9, 3.3 kb), Neisseria meningitidis (NmCas9, 3.2 kb), and many other variants of engineered Cas9 proteins such as SpCas9-HF1, eSpCas9, and HypaCas9, proteins of Type V, Class 2 including Cas12 (Cas12a (Cpf1), Cas12b (C2c1), Cas 12c, Cas12e, Cas12g, Cas12h, Cas12i, and etc.) and Cas14, and proteins of Type VI, Class 2 such as Cas13a and Cas13b. The said CRISPR effector protein can be a nickase e.g. SpCas9-nickase (D10A or H840A), or a catalytically inactive protein e.g. Cas9 (dCas9) coupled/fused with a protein effector such as FokI, transcription activator(s), transcription repressor(s), catalytic domains of DNA methyltransferase, histone acetyltransferase and deacetylase, reverse transcriptase (prime editor), and nucleic acid deaminases (base editor).
[0164] In another embodiment, the said CRISPR effector endonuclease is an artificial one comprising one or more functional domains derived from human.
[0165] In yet another embodiment, the said CRISPR effector endonuclease is a class 2 CRISPR Cas protein functionalized by site-directed mutagenesis to introduce orthogonal conjugating sites such as cysteines and remove deleterious conjugating sites (e.g. C80 in SpCas9), and corresponding RNP conjugates are prepared by selective conjugations such as PEGylation of cysteines by maleimide chemistry.
[0166] In yet another embodiment, the RNP complex conjugates are synthesized by reactions with crosslinking reagents, or by enzymes such as TGase which catalyzes amine transfer reaction between a primary amine at terminal side of PEG and the carboxamide of glutamine.
Tissue Tropic Viral Vectors Encoding a Cas Protein or a Cas-Tracrrna Complex
[0167] In some embodiments, the said viral vector encoding a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex, is a retrovirus, lentivirus, adenovirus, AAV, or baculovirus.
[0168] In some embodiments, the said viral vector encoding a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex, is an engineered AAV or AAV chimera to enable high transduction efficiency at a targeted tissue by changing the tropism of AAV capsids and to have low immunogenicity by evading human preexisting anti-AAV capsid neutralizing antibodies.
[0169] In some embodiments, the said viral vector encoding a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex, is a native or an engineered AAV to enable brain tissue targeted delivery. Such AAV serotypes include as non-limiting examples AAV1, AAV2/DJ, AAV2/DJ8, AAV2g9, AAV2-retro and scAAV9.
[0170] In some embodiments, the said viral vector encoding a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex, is a native or an engineered AAV to enable liver tissue targeted delivery. Such AAV serotypes include as non-limiting examples AAV8 and AAV3.
[0171] In some embodiments, the said viral vector encoding a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex, is a native or an engineered AAV to enable muscle tissue targeted delivery. Such AAV serotypes include as non-limiting examples AAV6, AAV8 and AAV9.
[0172] In some embodiments, the said viral vector encoding a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex, is a native or an engineered AAV to enable heart tissue targeted delivery. Such AAV serotypes include as non-limiting examples AAV rh74 and AAV9.
[0173] In some embodiments, the said viral vector encoding a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex, is a native or an engineered AAV to enable retina tissue targeted delivery. Such AAV serotypes include as non-limiting examples AAV1, AAV2, AAV5, AAV8 and AAV9.
[0174] In some embodiments, the said viral vector encoding a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex, is a native or an engineered AAV to enable lung tissue targeted delivery. Such AAV serotypes include as non-limiting examples AAV9.
[0175] In some embodiments, the expression of a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex by the said viral vector, is driven by inducible tissue-specific promoters.
[0176] In some embodiments, the expression of a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex by the said viral vector, is driven by brain tissue-specific promoters such as pMecp2, hSyn1, TRE3G and EFS as non-limiting examples.
[0177] In some embodiments, the expression of a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex by the said viral vector, is driven by liver tissue-specific promoters such as TBG and HCRhAATp or by lung tissue-specific promoters such as EFS, as non-limiting examples.
[0178] In some embodiments, the expression of a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex by the said viral vector, is driven by heart tissue-specific promoters such as CMV, Myh6, CB and CK7-miniCMV as non-limiting examples.
[0179] In some embodiments, the expression of a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex by the said viral vector, is driven by retina tissue-specific promoters such as EFS, CMV, Spc512, pMecp2, and Picam2 as non-limiting examples.
[0180] In some embodiments, the expression of a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex by the said viral vector, is driven by muscle tissue-specific promoters such as CMV, EFS and CK8 as non-limiting examples.
[0181] In some embodiments, the said viral vector encoding a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex, is administrated locally or systematically to optimize tissue targeted deliveries in animals and human. The injection site is intravenous, subcutaneous, intramuscular, intradermal, intraperitoneal, intravitreal, intranasal, intratracheal, subretinal, intraocular, or intracardiac, or at other sites. Chemically modified lgRNA(s), sgRNA(s), crRNA(s), or their conjugates are administrated either in an aqueous solution gymnotically or with transfection reagents or in a non-viral carrier by co-injections or separate injections.
[0182] In some embodiments, the said viral vector encoding a Cas effector endonuclease such as Cas9, or a Cas9-tracrRNA complex, is administrated to isolated cells including T cells, and chemically modified lgRNA(s), or crRNA(s) are administrated either in an aqueous solution gymnotically by electroporation or microinjection, or with transfection reagents or in a non-viral carrier.
Non-Viral Delivery of Rnp Complexes
[0183] In some embodiments, guide RNA conjugates, conjugates of guide RNA(s)-Cas protein (RNP) complexes such as PEGylated RNP complexes, or mixed lgRNA conjugate(s) and mRNA encoding a Cas-NLS protein are delivered with lipids well used in delivery of therapeutic nucleic acids such as DOPE, DOTAP, DOPS, DLin-MC3-DMA, cKK-E12, DSPC, POPE, 503013, PEG-DMG, bio-reducible lipid 8-O14B, cholesterol, and etc.
##STR00046##
[0184] In other embodiments, conjugates of guide RNA(s)-Cas protein (RNP) complexes such as PEGylated RNP complexes are delivered within lipid nanoparticles, liposomes, or exosomes.
[0185] In yet another embodiment, conjugates of guide RNA(s) and mRNA encoding a Cas protein are delivered within lipid nanoparticles, liposomes, or exosomes.
[0186] In yet another embodiment, conjugates of guide RNA(s) are delivered with lipids or peptides, or within lipid nanoparticles, liposomes, or exosomes to cells stably or inducibly expressing a Cas protein, or with a viral vector encoding a Cas protein co-delivered.
[0187] In yet another embodiment, conjugates of crRNA(s) are delivered with lipids or peptides, or within lipid nanoparticles, liposomes, or exosomes to cells stably or inducibly expressing Cas9 protein and tracrRNA, or with a viral vector encoding a Cas9 protein and a tracrRNA co-delivered.
[0188] In some embodiments, the said crRNA(s), or lgRNAs, or sgRNAs, or their conjugates or conjugates of guide RNA(s)-Cas protein (RNP) complexes are administrated by electroporation or microinjection.
Conjugates of Rnp Complexes
[0189] An aspect of the invention is directed to conjugates of guide RNA(s)-Cas protein (RNP) complexes such as a PEGylated CRISPR Cas protein-guide RNA complex(es), which are prepared by conjugation of a preformed guide RNA-CRISPR-Cas RNP(s) (RNP-I as an example),
##STR00047##
or prepared by conjugation of a Cas protein engineered for site-selective conjugations followed by complexing with a guide RNA(s) to form a RNP complex, wherein guide RNA(s) is an lgRNA composed of dual-modules (crRNA and tracrRNA) and comprising a single nNt-linker, dual or multiple nNt-linkers (lgRNA) formed by chemical ligation(s) and the ligation sites are preferably located at tetraloop (A32-U37) and/or stem 2 (C70-G79) (of reported sgRNA engineered for S. pyogenes Cas9), while any 3, 5-phosphodiester of sgRNA can be replaced by an nNt-Linker as a ligation site, a crRNA, an sgRNA, or dual guide RNAs, and wherein Cas protein is Cas9 comprising a nuclease lobe (NUC) and a recognition lobe (REC), an engineered Cas9, or a Cas protein other than the example of S. pyogenes Cas9 represented here; and wherein guide RNA(s) is chemically modified and optionally conjugated with one or more molecules selected from a group comprising PEG, non-PEG polymers, ligands for cellular receptors, lipids, oligonucleotides, antibodies, polysaccharides and peptides.
[0190] Another aspect of the invention is directed to CRISPR-Cas9-tracrRNA viral vectors or plasmids, encoding binary RNP complexes (RNP-II as an example) which further complex with crRNAs or their conjugates in targeted cells, wherein Cas9 comprising a nuclease lobe (NUC) and a recognition lobe (REC) can be a Cas protein other than the example of S. pyogenes Cas9 represented here, and can be an engineered Cas protein.
[0191] Another aspect of the invention is directed to a PEGylated CRISPR Cas protein-guide RNA complex(es), wherein the guide RNA(s) is a crRNA, dual guide RNAs, an sgRNA or an lgRNA.
[0192] Another aspect of the invention is directed to a CRISPR Cas protein conjugated with one or more molecules selected from a group comprising PEG, non-PEG polymers, ligands for cellular receptors, lipids, oligonucleotides, antibodies, polysaccharides and peptides.
[0193] Another aspect of the invention is directed to a conjugate of CRISPR Cas protein-guide RNA complex(es), wherein the guide RNA(s) is a conjugate of a crRNA, dual guide RNAs, an sgRNA or an lgRNA with one or more single strand DNAs (ssDNA) as a donor template for gene editing.
[0194] Another aspect of the invention is directed to a conjugate of CRISPR Cas protein-guide RNA complex(es), wherein the guide RNA(s) is a conjugate of a crRNA, dual guide RNAs, an sgRNA or an lgRNA with one or more single strand DNAs as a donor template for gene editing, and the CRISPR Cas protein is conjugated with one or more molecules selected from a group comprising PEG, non-PEG polymers, ligands for cellular receptors, lipids, oligonucleotides, antibodies, polysaccharides and peptides.
[0195] Some non-limiting examples of PEGylating reagents are given below.
##STR00048## ##STR00049##
[0196] The PEG can be either linear or branched and conjugated at a lysine or cysteine residue:
##STR00050##
[0197] Another aspect of the invention is directed to a lipid conjugated Cas protein-guide RNA complex, which is prepared by lipid conjugation of a preformed CRISPR-Cas RNP complex or by lipid conjugation of a Cas protein engineered for site-selective conjugations followed by complexing with a guide RNA to form an RNP complex.
[0198] Some non-limiting examples of lipid conjugating reagents are given below:
##STR00051##
[0199] Another aspect of the invention is directed to a peptide conjugated Cas protein-guide RNA complex, which is prepared by peptide conjugation of a preformed CRISPR-Cas RNP complex or by peptide conjugation of a Cas protein engineered for site-selective conjugations followed by complexing with a guide RNA to form an RNP complex. Non-limiting examples include conjugates of short peptides of nuclear localization signal (NLS).
[0200] Another aspect of the invention is directed to a Cas protein-guide RNA complex conjugated with small molecule ligands of cell receptors, which are prepared by ligand conjugation of a preformed CRISPR-Cas RNP complex or by ligand conjugation of a Cas protein engineered for site-selective conjugations followed by complexing with a guide RNA to form a RNP complex. Non-limiting examples include asialoglycoprotein receptor ligands (ASGPrL) such as N-acetylgalactosamine (GalNAc) and lactobionic acid.
##STR00052##
[0201] Yet another aspect of the invention is directed to a carbohydrate conjugated Cas protein-guide RNA complex, which is prepared by carbohydrate conjugation of a preformed CRISPR-Cas RNP complex or by carbohydrate conjugation of a Cas protein engineered for site-selective conjugations followed by complexing with a guide RNA to form an RNP complex. Non-limiting examples include oligosaccharides and polysaccharides.
[0202] Yet another aspect of the invention is directed to conjugates of an engineered Cas9 protein mutated at C80 and incorporating one or more cysteines for site-selective conjugations by site-directed mutagenesis.
[0203] The present invention relates to compositions of conjugates of a guide RNA(s)-Cas protein (RNP) complex and their uses as medicinal agents in treatment of viral infectious diseases and as gene regulation, disruption and/or correction-based therapeutics. The conjugate(s) comprises a guide RNA-Cas protein (RNP) complex and one or more molecules selected from a group comprising PEG, non-PEG polymers, ligands for cellular receptors, lipids, oligonucleotides, antibodies, polysaccharides, glycans and peptides and chemically linked to Cas protein and/or guide RNA(s).
[0204] The said uses may optionally include delivering an HDR template, wherein the template provides expression of a normal or less aberrant form of the protein to alleviate or eliminate a condition or disease state. The said HDR template may optionally be conjugated to guide RNA(s) and/or Cas protein.
[0205] Some aspects of the invention are directed to a donor template containing a gene-editing-sequence comprising one or more gene regulatory sequences or stop codons, and in some embodiments, the donor template(s) is conjugated to guide RNA(s) as part(s) of an lgRNA.
[0206] Some aspects of the invention are directed to PEGylated CRISPR-Cas9-lgRNA-conjugate and transfection reagent(s) systems.
[0207] Some aspects of the invention are directed to the use of conjugates of a guide RNA(s)-Cas protein (RNP) complex such as a PEGylated CRISPR-Cas9-lgRNA-conjugate system for antiviral therapy targeting against proviral DNAs or integrated viral DNA or episomal circular DNAs.
[0208] In some embodiments, non-limiting examples of targeted viral genomic sequences of HBV include:
TABLE-US-00001 (SEQIDNO:41) ctctgctagatcccagagtg[aGG], (SEQIDNO:42) gctatcgctggatgtgtctg[cGG], (SEQIDNO:43) tggacttctctcaattttct[a[G[G]G]G]], (SEQIDNO:44) gggggatcacccgtgtgtct[tGG], (SEQIDNO:45) tatgtggatgatgtggtactgg[gGG], (SEQIDNO:46) cctcaccatacagcactc[gGG], (SEQIDNO:47) gtgttggggtgagttgatgaatc[tGG],
wherein nucleotides in [ ] are PAMs, or any sequence of 17-20 nt immediately next to a PAM sequence.
[0209] In some embodiments, the therapeutic Cas9-lgRNA RNP conjugates comprise multiple lgRNAs targeting at different sites in viral genome (multiplex editing).
[0210] In some embodiments, multiple crgRNAs, including but not limited to sequences of YMDD and its mutations at catalytic domain of HBV polymerase, corresponding to
TABLE-US-00002 (SEQIDNO:48) tatgtggatgatgtggtactgg[gGG], (SEQIDNO:49) tatatggatgatgtggtattgg[gGG], (SEQIDNO:50) tatgtggatgatgtggtattgg[gGG], (SEQIDNO:51) tatatagatgatgtggtactgg[gGG],
are ligated to tracrgRNA to result in a mixture of lgRNAs, and thus a mixture of Cas9-lgRNA RNP conjugates to target drug resistance in therapies based on direct-acting antiviral agents (DAA).
[0211] In some embodiments, non-limiting examples of targeted viral genomic sequences of HIV include:
TABLE-US-00003 (SEQIDNO:52) gattggcagaactacacacc[aGG], (SEQIDNO:53) atcagatatccactgacctt[tGG], (SEQIDNO:54) gcgtggcctgggcgggactg[gGG], (SEQIDNO:55) cagcagttcttgaagtactc[cGG],
wherein nucleotides in [ ] are PAMs, or any sequence of 17-20 nt immediately next to a PAM sequence.
[0212] In some embodiments, non-limiting examples of targeted viral genomic sequences of herpesviridae virus such as HSV and EBV include:
TABLE-US-00004 (SEQIDNO:56) gccctggaccaacccggccc[gGG], (SEQIDNO:57) ggccgctgccccgctccggg[tGG], (SEQIDNO:58) ggaagacaatgtgccgcca[tGG], (SEQIDNO:59) tctggaccagaaggctccgg[cGG], (SEQIDNO:60) gctgccgcggagggtgatga[cGG], (SEQIDNO:61) ggtggcccaccgggtccgct[gGG], (SEQIDNO:62) gtcctcgagggggccgtcgc[gGG],
wherein nucleotides in [ ] are PAMs, or any sequence of 17-20 nt immediately next to a PAM sequence.
[0213] In some embodiments, non-limiting examples of targeted genomic sequences include 17-20 nt of genes encoding endogenous T-cell receptors (TCR), HLA class I (HLA-I) or T-cell inhibitory receptors or signal molecules such as programmed cell death protein 1 (PD1) and cytotoxic T lymphocyte-associate protein 4 (CTLA4), immediately next to a PAM sequence.
[0214] Other aspects of the invention are directed to the use of said CRISPR-Cas-guide RNA conjugate systems for gene therapy and treatments of human infectious diseases.
[0215] In some embodiments, targeted sequences are human genomic sequences incorporating disease causing mutations, e.g.
TABLE-US-00005 (SEQIDNO:63) 5-aaagaaaatatmmmtggtgtt-3,
wherein m is a mutation, and the gene-editing-sequence comprises
TABLE-US-00006 (SEQIDNO:64) 5-aaagaaaatatctttggtgtt-3.
[0216] Non-limiting examples of such human single-gene disorders are given below (Table 1). Other examples include human polygenic disorders such as heart disease and diabetes.
TABLE-US-00007 TABLE 1 Examples single-gene disorders and their prevalence Prevalence Disorder (approximate) Autosomal dominant Familial hypercholesterolemia 1 in 500 Polycystic kidney disease 1 in 1250 Neurofibromatosis type I 1 in 2,500 Hereditary spherocytosis 1 in 5,000 Marfan syndrome 1 in 4,000 Huntington's disease 1 in 15,000 Autosomal recessive Sickle cell anaemia 1 in 625 Cystic fibrosis 1 in 2,000 Tay-Sachs disease 1 in 3,000 Phenylketonuria 1 in 12,000 Mucopolysaccharidoses 1 in 25,000 Lysosomal acid lipase deficiency 1 in 40,000 Glycogen storage diseases 1 in 50,000 X-linked Duchenne muscular dystrophy 1 in 7,000 Hemophilia 1 in 10,000
[0217] All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present disclosure is not entitled to antedate such publication by virtue of prior disclosure. Further, the dates of publication provided may be different from the actual publication dates that may need to be independently confirmed.
[0218] This disclosure is not limited to particular embodiments described, as such may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present disclosure will be limited only by the appended claims.
[0219] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present disclosure. Any recited method can be carried out in the order of events recited or in any other order that is logically possible.
EXAMPLES
[0220] The following examples further illustrate embodiments of the disclosed invention, which are not limited by these examples.
Example 1
Synthesis of SaCas9 crRNA-GalNAc conjugate
##STR00053##
[0221] STEP 1. The 3-amino-crRNA is prepared using 2-TBS protected RNA phosphoramidite monomers with t-butylphenoxyacetyl protection of the A, G and C nucleobases and unprotected uracil. 0.3 M Benzylthiotetrazole in acetonitrile (Link Technologies) is used as the coupling agent, t-butylphenoxyacetic anhydride as the capping agent and 0.1 M iodine as the oxidizing agent. Oligonucleotide synthesis is carried out on an Applied Biosystems 394 automated DNA/RNA synthesizer using the standard 1.0 mole RNA phosphoramidite cycle. Uridine on CPG is prepared as before (US20160215275A1) and packed into a twist column. All -cyanoethyl phosphoramidite monomers are dissolved in anhydrous acetonitrile to a concentration of 0.1 M immediately prior to use. Stepwise coupling efficiencies are determined by automated trityl cation conductivity monitoring and in all cases are >97.5%.
[0222] Fmoc is then cleaved by treatment with 20% piperidine in DMF. The resulting 3-end aminoethyl oligonucleotide is then treated with NHS ester of 6-azido caproic acid in DMF.
[0223] Cleavage of oligonucleotides from the solid support and deprotection are achieved by exposure to concentrated aqueous ammonia/ethanol (3/1 v/v) for 2 h at room temperature followed by heating in a sealed tube for 45 min at 55 C. and desilylation in 1.0 M TBAF in THF for 24 h to give 3-azide-crRNA.
[0224] Alternatively, the step of reaction with NHS ester is skipped, and the above resulting fully deprotected oligonucleotide is dissolved in 0.5 M Na.sub.2CO.sub.3/NaHCO.sub.3 buffer (pH 8.75) and incubated with succinimidyl-6-azidohexanate (20 eq.) in DMSO to give 3-azide-crRNA.
[0225] STEP 2. To a solution of tri-GalNAc-alkyne and 3-azide-crRNA (0.2 nmol of each) in 0.2 M NaCl (50 L) at room temperature are added tris-hydroxypropyl triazole ligand (28 nmol in 42 L 0.2 M NaCl), sodium ascorbate (40 nmol in 4 L 0.2 M NaCl) and CuSO.sub.4.Math.5H.sub.2O (4 nmol in 4.0 L 0.2 M NaCl), under argon. The reaction mixture is kept under argon at room temperature for the desired time, and formamide (50 L) is added. The reaction is analyzed by loading directly onto a 20% polyacrylamide electrophoresis gel, and purified by reversed-phase HPLC to give the crRNA-tri-GalNAc conjugate.
Example 2: Cas9::crRNA-GalNAc::tracrRNA Complex
Cas9 Protein:
[0226] Recombinant Cas9 protein is available from New England BioLabs, Inc. and other providers or is expressed and purified from E. coli by a routinely used protocol (Anders, C. and Jinek, M. Methods Enzymol. 2014, 546, 1-20). The purity and concentration of Cas9 protein are analyzed by SDS-PAGE.
Cas9::crRNA-GalNAc::tracrRNA Complex:
[0227] tracrRNA is synthesized on an Applied Biosystems 394 automated DNA/RNA synthesizer as reported. Cas9, crRNA-GalNAc and tracrRNA are preincubated in a 1:5:5 molar ratio in the cleavage buffer to reconstitute the Cas9::crRNA-GalNAc::tracrRNA (RNP) complex.
[0228] Alternatively, tracrRNA is prepared by in vitro transcription at the presence of a RNA polymerase such as bacteriophage T7 RNA polymerase.
Example 3: PEGylation of CRISPR-Cas RNP Complex
[0229] The RNP (guide RNA-Cas protein) PEGylation is performed at different concentrations of m-PEG-pNP or m-PEG-NHS. RNP at 2 mg/mL in saline is incubated with varying concentrations of m-PEG-pNP or m-PEG-NHS (0.5, 1, 2, 4 and 6 mg/mL) in 1.5-mL microfuge tubes. The reaction is allowed to proceed at 30 C. for 3 hours. The PEGylated RNP complex(es) is used for in vitro DNA cleavages according to reported procedures without further purification.
[0230] Alternatively, before its storage at 80 C. or uses, size exclusion chromatography (SEC) of PEGylated RNP complex(es) is performed on a Akta Purifier using a HiLoad 16/60 S200 superdex column with gel filtration buffer (20 mM HEPES pH 7.5, 150 mM KCl, 10% (v/v) glycerol) with a flow rate of 1 mL/min. PEGylated RNP complex(es) is loaded in volumes no greater than 1 mL.
Example 4: Expression and Purification of SpCas9 (Cys-SpCas9: M1C, C80A, S145C, S204C, S469C, S1159C)
[0231] SpCas9 expression plasmid containing amino acid substitutions are generated by standard PCR and molecular cloning.
[0232] The primers are synthesized on an Applied Biosystems 394 automated DNA/RNA synthesizer using the standard 1.0 mole DNA phosphoramidite cycle. Nucleoside on CPG support is packed into a twist column. All -cyanoethyl phosphoramidite monomers are dissolved in anhydrous acetonitrile to a concentration of 0.1 M immediately prior to use. Stepwise coupling efficiencies are determined by automated trityl cation conductivity monitoring and in all cases are >99%.
[0233] The Cys-SpCas9 is expressed in E. coli strain Rosetta 2 DE3 cells, and the protein is isolated and purified as described (Anders, et al. Methods Enzymol. 2014, 546, 1-20).
Example 5: PEGylation of Cys-SpCas9 Protein
[0234] PEGylation of Cys-SpCas9 protein is performed at different concentrations of m-PEG-Maleimide. Protein at 2 mg/mL in saline is incubated with varying concentrations of m-PEG-Maleimide (0.5, 1, 2, 4 and 6 mg/mL) in 1.5-mL microfuge tubes. The reaction is allowed to proceed at 30 C. for 3 hours.
[0235] Before its storage at 80 C. or uses, size exclusion chromatography (SEC) of PEGylated RNP complex(es) is performed on a Akta Purifier using a HiLoad 16/60 S200 superdex column with gel filtration buffer (20 mM HEPES pH 7.5, 150 mM KCl, 10% (v/v) glycerol) with a flow rate of 1 mL/min. PEGylated RNP complex(es) is loaded in volumes no greater than 1 mL.
Example 6: Cys-SpCas9::lgRNA Complex
[0236] The PEGylated Cys-SpCas9 protein and lgRNA are preincubated in a 1:2 molar ratio in the cleavage buffer to reconstitute the Cas::lgRNA complex. The PEGylated RNP complex(es) is used for in vitro DNA cleavages according to reported procedures without further purification.
Example 7: ON-1 (SEQ ID NO: 66)
##STR00054##
[0237] ON-1 is synthesized in a way similar to the synthesis of 3-azide-crRNA in EXAMPLE 1, except the oligonucleotide is truncated at its 3-end. The oligonucleotide is cleaved off the solid phase and fully deprotected, and purified as described in EXAMPLE 1.
Example 8: ON-2
##STR00055##
[0238] ON-2 is synthesized in a way similar to the synthesis of ON-1, except that a solid phase support linked to Fmoc-hexylamine is used, and 2-propargyl adenosine phosphoramidite is used to introduce an alkyne.
[0239] Fmoc is then cleaved by treatment with 20% piperidine in DMF. The resulting 3-end aminohexyl oligonucleotide is then treated with NHS ester of 6-maleimide caproic acid in DMF.
[0240] Cleavage of oligonucleotides from the solid support and full deprotection are achieved by exposure to concentrated aqueous ammonia/ethanol (3/1 v/v) for 2 h at room temperature followed by heating in a sealed tube for 45 min at 55 C. and desilylation in 1.0 M TBAF in THF for 24 h.
[0241] Alternatively, the step of reaction with NHS ester is skipped, and the above resulting fully deprotected oligonucleotide is dissolved in 0.5 M Na.sub.2CO.sub.3/NaHCO.sub.3 buffer (pH 8.75) and incubated with NHS ester of 6-maleimide caproic acid (20 eq.) in DMSO to give ON-2.
Example 9: ON-3 (SEQ ID NO: 68)
##STR00056##
[0242] A solution of alkyne ON-1 and azide ON-2 (0.2 nmol of each) in 0.2 M NaCl (50 L) is annealed for 30 min at room temperature. In the meantime, tris-hydroxypropyl triazole ligand (28 nmol in 42 L 0.2 M NaCl), sodium ascorbate (40 nmol in 4 L 0.2 M NaCl) and CuSO.sub.4.Math.5H.sub.2O (4 nmol in 4.0 L 0.2 M NaCl), are added under argon. The reaction mixture is kept under argon at room temperature for the desired time, and formamide (50 L) is added. The reaction is analyzed by loading directly onto a 20% polyacrylamide electrophoresis gel, and purified by reversed-phase HPLC.
Example 10: ON-4 (SEQ ID NO: 69)
##STR00057##
[0243] ON-4 is synthesized in a way similar to the synthesis of primers in Example 4.
[0244] Cleavage of oligonucleotides from the solid support and deprotection are achieved by exposure to concentrated aqueous ammonia/ethanol (3/1 v/v) for 2 h at room temperature followed by heating in a sealed tube for 45 min at 55 C.
Example 11: lgRNA-ssDNA (SEQ ID NO: 70) and sgRNA-ssDNA (SEQ ID NO: 72)
##STR00058##
[0245] The ON-3 oligonucleotide carrying a maleimido group is incubated with 5-SH-oligonucleotide (ON-4, 1:1 molar ratio) in 0.1 M triethylammonium acetate (TEAA) at pH 7.0 overnight at room temperature. The reaction mixture is analyzed and separated by HPLC to give the lgRNA-ssDNA.
##STR00059##
[0246] Alternatively, ON-3 oligonucleotide is substituted with an sgRNA carrying a maleimido group (ON-5 (SEQ ID NO: 71)) prepared from an sgRNA (incorporated an amine at its 3-end) by in vitro transcription at the presence of a RNA polymerase such as bacteriophage T7 RNA polymerase, followed by reacting the amine to introduce a maleimido group via NHS chemistry. The said amine at the 3-end is incorporated from a uridine triphosphate analogue.
##STR00060##
[0247] The ON-5 oligonucleotide carrying a maleimido group is incubated with 5-SH-oligonucleotide (ON-4, 1:1 molar ratio) in 0.1 M triethylammonium acetate (TEAA) at pH 7.0 overnight at room temperature. The reaction mixture is analyzed and separated by HPLC to give the sgRNA-ssDNA.
Example 12: ssDNA-lgRNA (SEQ ID NO: 73)
[0248] The ssDNA oligonucleotide carrying a maleimido group at its 3-end is incubated with the 5-SH-lgRNA (1:1 molar ratio) in 0.1 M triethylammonium acetate (TEAA) at pH 7.0 overnight at room temperature. The reaction mixture is analyzed and separated by HPLC to give ssDNA-lgRNA.
##STR00061##
Example 13: Cys-SpCas9::ssDNA-lgRNA Complex
[0249] The PEGylated Cys-SpCas9 protein and ssDNA-lgRNA are preincubated in a 1:2 molar ratio in the cleavage buffer to reconstitute the Cas9::ssDNA-lgRNA complex. The PEGylated RNP complex(es) is used for DNA cleavages according to reported procedures without further purification.
Example 14: Cys-SpCas9-Nickase (H840A)::ssDNA-lgRNA Complex
[0250] A Cys-SpCas9-nickase (H840A) conjugate and ssDNA-lgRNA are preincubated in a 1:2 molar ratio in the cleavage buffer to reconstitute the Cas9::ssDNA-lgRNA complex. The RNP complex(es) is used for DNA cleavages according to reported procedures without further purification.
Example 15: CELLULAR TRANSFECTIONS, and ASSAYS of
[0251] Cas9::ssDNA-lgRNA
a. Transfection with cationic lipids (Liu, D. et al. Nature Biotechnology 2015, 33, 73-80):
[0252] Purified synthetic ssDNA-lgRNA or a mixture of synthetic ssDNA-lgRNAs is incubated with purified Cas9 protein for 5 min, and then complexed with the cationic lipid reagent in 25 L OPTIMEM. The resulting mixture is applied to the cells for 4 h at 37 C.
b. Transfection with cell-penetrating peptides (Kim, H. et al. Genome Res. 2014, 24: 1012-1019):
[0253] Cell-penetrating peptide (CPP) is conjugated to a purified recombinant Cys-Cas9 protein by drop wise mixing of 1 mg Cas9 protein (2 mg/mL) with 50 g 4-maleimidobutyryl-GGGRRRRRRRRRLLLL (m9R; 2 mg/mL) in PBS (pH 7.4) followed by incubation on a rotator at room temperature for 2 h. To remove unconjugated m9R, the samples are dialyzed against DPBS (pH 7.4) at 4 C. for 24 h using 50 kDa molecular weight cutoff membranes. Cys-Cas9-m9R protein is collected from the dialysis membrane and the protein concentration is determined using the Bradford assay (Biorad).
[0254] Synthetic ssDNA-lgRNA or a mixture of synthetic ssDNA-lgRNAs is complexed with CPP: ssDNA-lgRNA (1 g) in 1 l of deionized water is gently added to the C3G9R4LC peptide (9R) in lgRNA:peptide weight ratios that range from 1:2.5 to 1:40 in 100 l of DPBS (pH 7.4). This mixture is incubated at room temperature for 30 min and diluted 10-fold using RNase-free deionized water.
[0255] 150 l Cys-Cas9-m9R (2 M) protein is mixed with 100 l ssDNA-lgRNA:9R (10:50 g) complex and the resulting mixture is applied to the cells for 4 h at 37 C. Cells can also be treated with Cys-Cas9-m9R and ssDNA-lgRNA:9R sequentially.
Example 16: Anti-HBV in Cells
[0256] The antiviral assay is performed according to reported procedures (Hu, W. et al. Proc Natl Acad Sci USA 2014, 110: 11461-11466; Lin, Su. et al. Molecular Therapy-Nucleic Acids, 2014, 3, e186). Delivery to cell lines is either cationic lipid or CPP based delivery of Cys-Cas9-ssDNA-lgRNA complexes instead of plasmid transfection/transduction using gRNA/Cas9 expression vectors.
[0257] Alternatively, cells are treated with ssDNA-lgRNA and mRNA encoding Cas9 protein (ssDNA-lgRNA/mRNA-10:1) either as a mixture or sequentially in LNPs formulated with an amine-to-RNA-phosphate ratio of about 3-6 (N:P), or cells are treated with ssDNA-lgRNA in LNPs formulated with an amine-to-RNA-phosphate ratio of about 3-6 (N:P) and AAV vector encoding Cas9 protein.
Example 17: Anti-HBV in Chimeric Mice
[0258] 27The antiviral assay in HBV infected chimeric mice is performed according to a reported procedure except conjugates of Cys-Cas9-ssDNA-lgRNA RNP complexes are administrated instead of small interfering RNAs (Thi, E. P. and et al. ACS Infec. Dis. 2019, 5, 725-737). All animals are bred under specific pathogen-free conditions in accordance with the ethical guidelines set forth by the National Institutes of Health for care of laboratory animals. The cDNA-uPA/SCID (cDNA-uPA (+/wt)/SCID (+/+)) hemizygote mice are generated as described. Cryopreserved human hepatocytes (2-year-old female, Hispanic, BD195, BD Biosciences) are transplanted into 2-4-week-old hemizygous cDNA-uPA/SCID mice via the spleen under anesthesia. The human hepatocytes are allowed to expand for 10-12 weeks and the replacement index are tested by measuring human albumin (h-Alb) in blood collected from tail vein using clinical chemistry analyzer (BioMajesty Series JCA-BM6050, JEOL Ltd.) with latex agglutination immunonephelometry (LZ Test Eiken U-ALB, Eiken Chemical Co., Ltd.). Male chimeric mice with more than 7.0 mg/mL h-Alb concentration in blood are judged as PXBmice whose replacement index is more than 70%.
[0259] PXB mice (>70% replacement index, 13-15 weeks old) are infected with HBV by intravenous injection through the tail vein with 110.sup.5 copies of HBV containing serum from previously infected animals. Eight weeks post infection, animals with HBV DNA titers greater than 1.010.sup.6 copies/mL and h-Alb greater than 7.0 mg/mL are selected (n=5 per group). Cys-Cas9-ssDNA-lgRNA complexes are dosed via the lateral tail vein in a volume of 0.2 mL per animal. Animals are euthanized at various time points by exsanguination under isoflurane anesthesia. Liver tissue is collected from the median or left lateral lobe from each animal for DNA extraction and for NGS. Editing efficiency and off-targets are determined as described (Finn, J. D. et al. Cell Reports 2018, 22, 2227-2235; Tsai, S. Q. et al. Nat. Methods 2017, 14, 607-614).
[0260] Blood is collected into serum separator tubes. Serum HBV DNA is assayed by qPCR and serum HBsAg measured by chemiluminescence enzyme immunoassay (ARCHITECT, Abbott). Serum HBeAg is also assessed using a chemiluminescence enzyme immunoassay (ARCHITECT, Abbott). Liver total and 3.5 kb HBV (pg)RNA at day 42 (study termination) are analyzed by Quantigene 2.0 b DNA assay (Affymetrix), and data is normalized to human glyceraldehyde-3-phosphate dehydrogenase (GAPDH) mRNA. Immunohistochemical analysis for HBcAg is conducted on liver sections at day 42.
[0261] Alternatively, ssDNA-lgRNA and mRNA encoding Cas9 protein (ssDNA-lgRNA/mRNA10:1) are administrated either as a mixture or sequentially in LNPs formulated with an amine-to-RNA-phosphate ratio of about 3-6 (N:P), or AAV vector encoding Cas9 protein and ssDNA-lgRNA in LNPs formulated with an amine-to-RNA-phosphate ratio of about 3-6 (N:P) are administrated sequentially.
Example 18: Anti-HIV in Humanized Mice
[0262] The antiviral assay in HIV infected humanized mice is performed according to a reported procedure except Cys-Cas9-ssDNA-lgRNA RNP complexes are administrated instead of the AAV9-CRISPR-Cas9 vector (Dash, P. K. and et al. Nat. Comm. 2019, 10, 1-20).
[0263] CD34+HSC are enriched from human cord blood or fetal liver cells using immune-magnetic beads. CD34+cell purity was >90% by flow cytometry. Cells are transplanted into newborn mice irradiated at 1 Gy using a RS-2000-Ray Irradiator by intrahepatic (i.h.) injection of 50,000 cells/mouse in 20 l phosphate-buffered saline (PBS) with a 30-gauge needle. At 18 weeks of age, NSG-hu mice are infected intraperitoneally (i.p.) with HIV-1.sub.NL4-3 at 10.sup.4 tissue culture infective dose.sub.50 (TCID.sub.50)/ml.
[0264] Cys-Cas9-ssDNA-lgRNA complexes are dosed via the lateral tail vein in a volume of 0.2 mL per animal. HIV-1 nucleic acids are detected by ddPCR and editing efficiency and off-targets are determined as described.
[0265] Alternatively, ssDNA-lgRNA and mRNA encoding Cas9 protein (ssDNA-lgRNA/mRNA10:1) are administrated either as a mixture or sequentially in LNPs formulated with an amine-to-RNA-phosphate ratio of about 3-6 (N:P), or AAV vector encoding Cas9 protein and ssDNA-lgRNA in LNPs formulated with an amine-to-RNA-phosphate ratio of about 3-6 (N:P) are administrated sequentially.
Example 19: AAV-EFS_CMV::NLS-SaCas9-NLS-polyA;U6-tracrRNA Plasmid
[0266] 5-caccact tatac ctaaa attac agaat ctact aaaac aaggc aaaat gccgt gttta tctcg tcaac ttgtt ggcga gattt tt-3 (top, SEQ ID NO: 74)
[0267] 5-ggccaa aaatc tcgcc aacaa gttga cgaga taaac acggc atttt gcctt gtttt agtag attct gtaat tttag gtata agt-3 (bottom, SEQ ID NO: 75)
[0268] The top and bottom strands of oligonucleotides for cDNA encoding tracrRNA of SaCas9 system are synthesized using DNA phosphoramidite monomers with routine protection of the A, G and C nucleobases and unprotected thymine. 0.45 M tetrazole in acetonitrile is used as the coupling agent, acetic anhydride as the capping agent and 0.1 M iodine as the oxidizing agent. Oligonucleotide synthesis is carried out on an Applied Biosystems 394 automated DNA/RNA synthesizer using the standard 1.0 mole DNA phosphoramidite cycle. Nucleoside on CPG support is packed into a twist column. All -cyanoethyl phosphoramidite monomers are dissolved in anhydrous acetonitrile to a concentration of 0.1 M immediately prior to use. Stepwise coupling efficiencies are determined by automated trityl cation conductivity monitoring and in all cases are >99%.
[0269] Viral plasmids are produced utilizing standard recombinant DNA cloning techniques.
[0270] The above cDNA strands (1:1) are phosphorylated and annealed, and cloned into a linearized pX601-AAV-EFS_CMV::NLS-SaCas9-NLS-polyA3HA-bGHpA;U6::BsaI-sgRNA expression plasmid vector (Addgene gene plasmid #61591) as following. The AAV vector is digested with BsaI and NotI to remove the insert of sgRNA scaffold, treated with antarctic phosphatase, and purified with a Quick nucleotide removal kit (QIAGEN). An equal amount of complementary oligonucleotide is mixed in T4 polynucleotide kinase (PNK) buffer for annealing. These annealed seed pairs are phosphorylated with T4 PNK and ligated into the BsaI- and NotI digested AAV using T7 DNA ligase.
Example 20: Virus Production
[0271] The AAV::SaCas9 virus is packaged using a triple plasmid transfection method as described (Chew, et al. Nature Methods, 2016). 293FT cells (Life Technologies) are plated in growth media consisting of DMEM+glutaMAX+pyruvate+10% FBS (Life Technologies), supplemented with 1MEM non-essential amino acids (Gibco) in 150 mm plates. Confluency at transfection is between 70-90%, 20 g of pHelper plasmid, 10 g of pRepCap plasmid (encoding capsid proteins), and 10 g of AAV plasmid carrying the construct of interest are mixed in 500 L of DMEM, and 200 g of PEI MAX (Polysciences) (40 kDa, 1 mg/mL in H2O, pH 7.1) are added for PEI:DNA mass ratio of 5:1. The mixture is incubated for 15 minutes, and transferred drop-wise to the cell media. The day after transfection, media is changed to DMEM+glutamax+pyruvate+2% FBS. Cells are harvested 48-72 hours after transfection by scrapping or dissociation with 1PBS (pH7.2)+5 mM EDTA, and pelleted at 1500 g for 12 min. Cell pellets are resuspended in 1-5 mL of lysis buffer (Tris HCl pH 7.5+2 mM MgCl2+150 mM NaCl), and freeze-thawed 3 between dry-ice-ethanol bath and 37 C. water bath. Cell debris is clarified via 4000 g for 5 minutes, and the supernatant is collected.
[0272] The collected AAV supernatant is treated with 50 U/mL Benzonase and 1 U/mL Riboshredder for 30 minute at 37 C. After incubation, the lysate is concentrated to <3 mL by ultrafiltration with Amicon Ultra-15 (50 kDa MWCO) (Millipore), and loaded on top of a discontinuous density gradient consisting of 2 mL each of 15%, 25%, 40%, 60% Optiprep (Sigma-Aldrich) in an 11.2 mL Optiseal polypropylene tube (Beckman-Coulter). The tubes are ultracentrifuged at 58000 rpm, at 18 C., for 1.5 hours, on an NVT65 rotor. The 40% fraction is extracted, and dialyzed with 1PBS (pH 7.2) supplemented with 35 mM NaCl, using Amicon Ultra-15 (50 kDa or 100 kDa MWCO) (Millipore). The purified AAVs are stored at 80 C. as 25 L aliquots.
[0273] AAV titers (vector genomes) are quantified via hydrolysis probe qPCR against standard curves generated from linearized parental AAV plasmids.
Example 21: Generation of Cas9-tracrRNA Stable Cells and Transfection with crRNA(s)
[0274] Cells are plated at 210.sup.4 per well in a 96-well plate in 100 L of growth media. Purified AAVs are applied at confluency of 70-90%. Culture media is replaced with fresh growth media the next day, and the cells are incubated at 37 C. and 5% CO.sub.2 for 24 hours. Culture media is replaced with fresh media, and the cells are transfected with crRNAs either gymnotically or with transfection reagents.
Example 22: Mice Injection
[0275] AAV vector and crRNAs are delivered to 5-6 week old male mice intravenously via lateral tail vein injection. All dosages of AAV are adjusted to 100 L or 200 L with sterile phosphate buffered saline (PBS), pH 7.4 (Gibco) before the injection.
Example 23: Generation of Inducible Cas9 Stable Cells and Transfection with lgRNA(s)
[0276] Cells are transduced with Edit-R Inducible Lentiviral hEF1-Blast-Cas9 Nuclease Particles as detailed in the manufacturer's protocol. Cells are plated at 510.sup.4 cells per well in a 24-well plate using Tet-free growth medium, incubated at 37 C. in a humidified CO.sub.2-incubator overnight, and transduced with Edit-R Inducible Lentiviral hEF1-Blast-Cas9 Nuclease. The incubation is continued for 4-6 hours, and the medium is replaced with Tet-free growth medium and the incubation is continued for 24-48 hours. Inducible Cas9 stable cells are selected in the medium with Tet-free selection medium containing the appropriate amount of blasticidin and expanded.
[0277] The selected inducible Cas9 stable cells are then induced in freshly prepared doxycycline solution for at least 24 hours. The cells are transfected using Lipofectamine RNAiMax and the lgRNA(s). The medium is replaced with fresh medium after 12 hours. Cells are then grown for 72 hours with the media replaced when necessary.
EQUIVALENTS
[0278] The present disclosure is not to be limited in terms of the particular embodiments described in this application, which are intended as single illustrations of individual aspects of the present disclosure. Many modifications and variations of this present disclosure can be made without departing from its spirit and scope, as will be apparent to those skilled in the art. Functionally equivalent methods and apparatuses within the scope of the present disclosure, in addition to those enumerated herein, will be apparent to those skilled in the art from the foregoing descriptions. Such modifications and variations are intended to fall within the scope of the present disclosure. It is to be understood that this present disclosure is not limited to particular methods, reagents, compounds compositions, or biological systems, which can, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting.
[0279] In addition, where features or aspects of the disclosure are described in terms of Markush groups, those skilled in the art will recognize that the disclosure is also thereby described in terms of any individual member or subgroup of members of the Markush group.
[0280] As will be understood by one skilled in the art, for any and all purposes, particularly in terms of providing a written description, all ranges disclosed herein also encompass any and all possible subranges and combinations of subranges thereof. Any listed range can be easily recognized as sufficiently describing and enabling the same range being broken down into at least equal halves, thirds, quarters, fifths, tenths, etc. As a non-limiting example, each range discussed herein can be readily broken down into a lower third, middle third and upper third, etc. As will also be understood by one skilled in the art all language such as up to, at least, greater than, less than, and the like, include the number recited and refer to ranges which can be subsequently broken down into subranges as discussed above. Finally, as will be understood by one skilled in the art, a range includes each individual member. Thus, for example, a group having 1-3 or 1 to 3 items refers to groups having 1, 2, or 3 items. Similarly, a group having 1-5 or 1 to 5 items refers to groups having 1, 2, 3, 4, or 5 items, and so forth.
[0281] All patents, patent applications, provisional applications, and publications referred to or cited herein are incorporated by reference in their entirety, including all figures and tables, to the extent they are not inconsistent with the explicit teachings of this specification.
TABLE-US-00008 DNAsequenceofCys-SpCas9protein: (SEQIDNO:76) tgcgacaagaagtacagcatcggcctggacatcggcaccaactctgtgggctgggccgtgatcaccgacgagtacaaggtgc ccagcaagaaattcaaggtgctgggcaacaccgaccggcacagcatcaagaagaacctgatcggagccctgctgttcgaca gcggcgaaacagccgaggccacccggctgaagagaaccgccagaagaagatacaccagacggaagaaccggatcgcct atctgcaagagatcttcagcaacgagatggccaaggtggacgacagcttcttccacagactggaagagtccttcctggtggaa gaggataagaagcacgagcggcaccccatcttcggcaacatcgtggacgaggtggcctaccacgagaagtaccccaccatc taccacctgagaaagaaactggtggactgcaccgacaaggccgacctgcggctgatctatctggccctggcccacatgatca agttccggggccacttcctgatcgagggcgacctgaaccccgacaacagcgacgtggacaagctgttcatccagctggtgca gacctacaaccagctgttcgaggaaaaccccatcaacgcctgccggcgtggacgccaaggccatcctgtctgccagactgagc aagagcagacggctggaaaatctgatcgcccagctgcccggcgagaagaagaatggcctgttcggaaacctgattgccctg agcctgggcctgacccccaacttcaagagcaacttcgacctggccgaggatgccaaactgcagctgagcaaggacacctac gacgacgacctggacaacctgctggcccagatcggcgaccagtacgccgacctgtttctggccgccaagaacctgtccgac gccatcctgctgagcgacatcctgagagtgaacaccgagatcaccaaggcccccctgagcgcctctatgatcaagagatacg acgagcaccaccaggacctgaccctgctgaaagctctcgtgcggcagcagctgcctgagaagtacaaagagattttcttcgac cagagcaagaacggctacgccggctacattgacggcggagccagccaggaagagttctacaagttcatcaagcccatcctg gaaaagatggacggcaccgaggaactgctcgtgaagctgaacagagaggacctgctgcggaagcagcggaccttcgacaa cggcagcatcccccaccagatccacctgggagagctgcacgccattctgcggcggcaggaagatttttacccattcctgaag gacaaccgggaaaagatcgagaagatcctgaccttccgcatcccctactacgtgggccctctggccaggggaaacagcaga ttcgcctggatgaccagaaagtgcgaggaaaccatcaccccctggaacttcgaggaagtggtggacaagggcgcttccgcc cagagcttcatcgagcggatgaccaacttcgataagaacctgcccaacgagaaggtgctgcccaagcacagcctgctgtacg agtacttcaccgtgtataacgagctgaccaaagtgaaatacgtgaccgagggaatgagaaagcccgccttcctgagcggcga gcagaaaaaggccatcgtggacctgctgttcaagaccaaccggaaagtgaccgtgaagcagctgaaagaggactacttcaa gaaaatcgagtgcttcgactccgtggaaatctccggcgtggaagatcggttcaacgcctccctgggcacataccacgatctgc tgaaaattatcaaggacaaggacttcctggacaatgaggaaaacgaggacattctggaagatatcgtgctgaccctgacactgt ttgaggacagagagatgatcgaggaacggctgaaaacctatgcccacctgttcgacgacaaagtgatgaagcagctgaagc ggcggagatacaccggctggggcaggctgagccggaagctgatcaacggcatccgggacaagcagtccggcaagacaat cctggatttcctgaagtccgacggcttcgccaacagaaacttcatgcagctgatccacgacgacagcctgacctttaaagagg acatccagaaagcccaggtgtccggccagggcgatagcctgcacgagcacattgccaatctggccggcagccccgccatta agaagggcatcctgcagacagtgaaggtggtggacgagctcgtgaaagtgatgggccggcacaagcccgagaacatcgtg atcgaaatggccagagagaaccagaccacccagaagggacagaagaacagccgcgagagaatgaagcggatcgaagag ggcatcaaagagctgggcagccagatcctgaaagaacaccccgtggaaaacacccagctgcagaacgagaagctgtacct gtactacctgcagaatggggggatatgtacgtggaccaggaactggacatcaaccggctgtccgactacgatgtggaccat atcgtgcctcagagctttctgaaggacgactccatcgacaacaaggtgctgaccagaagcgacaagaaccggggcaagagc gacaacgtgccctccgaagaggtcgtgaagaagatgaagaactactggcggcagctgctgaacgccaagctgattacccag agaaagttcgacaatctgaccaaggccgagagaggcggcctgagcgaactggataaggccggcttcatcaagagacagctg gtggaaacccggcagatcacaaagcacgtggcacagatcctggactcccggatgaacactaagtacgacgagaatgacaag ctgatccgggaagtgaaagtgatcaccctgaagtccaagctggtgtccgatttccggaaggatttccagttttacaaagtgcgc gagatcaacaactaccaccacgcccacgacgcctacctgaacgccgtcgtgggaaccgccctgatcaaaaagtaccctaag ctggaaagcgagttcgtgtacggcgactacaaggtgtacgacgtgcggaagatgatcgccaagagcgagcaggaaatcggc aaggctaccgccaagtacttcttctacagcaacatcatgaactttttcaagaccgagattaccctggccaacggcgagatccgg aagcggcctctgatcgagacaaacggcgaaaccggggagatcgtgtgggataagggccgggattttgccaccgtgcggaa agtgctgagcatgccccaagtgaatatcgtgaaaaagaccgaggtgcagacaggcggcttcagcaaagagtctatcctgccc aagaggaacagcgataagctgatcgccagaaagaaggactgggaccctaagaagtacggcggcttcgacagccccaccgt ggcctattctgtgctggtggtggccaaagtggaaaagggcaagtccaagaaactgaagtgcgtgaaagagctgctggggatc accatcatggaaagaagcagcttcgagaagaatcccatcgactttctggaagccaagggctacaaagaagtgaaaaaggacc tgatcatcaagctgcctaagtactccctgttcgagctggaaaacggccggaagagaatgctggcctctgccggcgaactgcag aagggaaacgaactggccctgccctccaaatatgtgaacttcctgtacctggccagccactatgagaagctgaagggctcccc cgaggataatgagcagaaacagctgtttgtggaacagcacaagcactacctggacgagatcatcgagcagatcagcgagttc tccaagagagtgatcctggccgacgctaatctggacaaagtgtgtccgcctacaacaagcaccgggataagcccatcagag agcaggccgagaatatcatccacctgtttaccctgaccaatctgggagcccctgccgccttcaagtactttgacaccaccatcg accggaagaggtacaccagcaccaaagaggtgctggacgccaccctgatccaccagagcatcaccggcctgtacgagaca cggatcgacctgtctcagctgggaggcgac SequenceofCys-SpCas9-NLSprotein: (SEQIDNO:77) CDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRL KRTARRRYTRRKNRIAYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAY HEKYPTIYHLRKKLVCSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTY NQLFEENPINACGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFD LAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSAS MIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKM DGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIP YYVGPLARGNSRFAWMTRKCEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKH SLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIE CFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKT YAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDD SLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEM ARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVD QELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLL NAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLI REVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGD YKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDK GRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTV AYSVLVVAKVEKGKSKKLKCVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSL FELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHY LDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTI DRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDAYPYDVPDYASLGSGSPKKKRKVD