Therapeutic mRNA vaccine for malignancies

12502422 ยท 2025-12-23

Assignee

Inventors

Cpc classification

International classification

Abstract

Described herein is a method for cancer immunotherapy by administering to a subject an mRNA vaccine designed to express the carbonyl terminal segment of human chorionic gonadotropin (hCG). Also described an improved adjuvant by co-administration of an antisense IL-10 molecule to shift the vaccine immune response to enhanced T-cell responses to hCG. Other embodiments relate to devices and methods for improved delivery of the mRNA vaccine and adjuvant. The intended use involves repeated administration of the vaccine components to subjects over an interval of several months in a repeated boosting strategy.

Claims

1. An mRNA vaccine composition comprising: an mRNA polynucleotide encoding SEQ ID NO: 4; a DNA polynucleotide comprising an antisense IL-10 splice acceptor exon 4 oligomer of SEQ ID NO: 11; and one or more pharmaceutically acceptable excipients in a solution suitable for injection.

2. The composition of claim 1, wherein the composition further comprises a polypeptide encoded by SEQ ID NO: 1.

3. The composition of claim 1, wherein the composition further comprises one or more monoclonal antibodies immunoreactive to a hCG-CTP21 peptide of SEQ ID NO:12 or a hCG-CTP16 peptide of SEQ ID NO: 13.

4. A method for treating a cancer in a subject in need thereof comprising: administering to the subject the mRNA vaccine composition of claim 1.

5. The method of claim 4, wherein the administration is repeated on a once per four-week schedule for a period of at least 12 to 16 weeks.

6. The method of claim 4, wherein the administration comprises administering a dose of 0.03 to 0.1 mg of the vaccine composition to the subject.

7. The method of claim 4, wherein the vaccine composition further comprises an mRNA encoding hCG-CTP37.

8. The method of claim 4, wherein the vaccine composition further comprises nanoparticle drug carriers, liposomes, viral vectors, or microbubbles.

9. The method of claim 4, wherein the vaccine composition is administered to a solid tumor using a micro catheter.

10. The method of claim 4, wherein the vaccine composition is incorporated into substance-eluting beads.

11. The method of claim 10, wherein the substance-eluting beads comprise biocompatible, resorbable, or non-resorbable hydrogel beads comprising one or more of: polyethylene glycol polymers; nanoparticle-containing hydrogels; cyclodextrin hydrogels; hydrophilic polymers, polyethylene glycol, poly lactic acid, poly -caprolactone, polypropylene oxide, poly D,L-lactide-co-glycolide, or poly -caprolactone-co-D,L-lactide; ultra-thermosensitive hydrogels; hydrogels, emulsions, vesicular micelles, liposomes, or nanocapsules; solid lipid microparticles or nanoparticles, nanostructured lipid carriers, or lipid drug conjugates; biocompatible hydrogels comprising poly(isopropylamide-co-n-butyl methacrylate and PEG; polyethylenimine based hydrogels; supramolecular hydrogels; DNA-hydrogels; multi-functional and stimuli-responsive hydrogels; n-acrylic polymers impregnated with porcine gelatin; or gelatin.

12. The method of claim 10, wherein the substance-eluting beads comprise soybean lecithin entrapping hydrophilic bone morphogenic protein-2 into nanoporous poly(lactide-co-glycolide)-based microspheres.

13. The method of claim 4, wherein the vaccine composition is delivered using an image guided percutaneous biopsy needle.

14. The method of claim 4, wherein the vaccine composition is delivered using a pressure-enabled micro catheter.

15. The method of claim 14, wherein the vaccine composition is delivered using a pressure-enabled micro catheter using a continuous flow.

16. The method of claim 14, wherein the vaccine composition is delivered using a pressure-enabled micro catheter using an automated pulsatile flow.

17. The method of claim 4, wherein the vaccine composition is delivered using biologic scaffolds.

18. The method of claim 4, wherein the vaccine composition is delivered using polymer scaffolds.

19. The method of claim 4, wherein the vaccine composition is delivered using biological and polymer reservoirs for sustained delivery.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows the component parts of the hCG mRNA vaccine include a 5-cap, the 5-UTR including the HCV IRES sequence (SEQ ID NO: 7), the mRNA (SEQ ID NO: 5) encoding the hCG peptide antigen (SEQ ID NO: 6), the 3-UTR (SEQ ID NO: 8) and a polyadenylation signal sequence. Vaccine adjuvants are indicated as CpG motifs indicated within SEQ IDs NO: 5 and 9 as well as the antisense oligonucleotide IL-10SAE4 (SEQ ID NO: 11).

DETAILED DESCRIPTION

Definitions

(2) Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. For example, any nomenclatures used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics, and protein and nucleic acid chemistry and hybridization described herein are well known and commonly used in the art. In case of conflict, the present disclosure, including definitions, will control. Exemplary methods and materials are described below, although methods and materials similar or equivalent to those described herein can be used in practice or testing of the embodiments and aspects described herein.

(3) As used herein, the terms amino acid, nucleotide, polynucleotide, vector, polypeptide, and protein have their common meanings as would be understood by a biochemist of ordinary skill in the art. Standard single letter nucleotides (A, C, G, T, U) and standard single letter amino acids (A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y) are used herein.

(4) As used herein, the terms such as include, including, contain, containing, having, and the like mean comprising. The present disclosure also contemplates other embodiments comprising, consisting of, and consisting essentially of, the embodiments or elements presented herein, whether explicitly set forth or not.

(5) As used herein, the term a, an, the and similar terms used in the context of the disclosure (especially in the context of the claims) are to be construed to cover both the singular and plural unless otherwise indicated herein or clearly contradicted by the context. In addition, a, an, or the means one or more unless otherwise specified.

(6) As used herein, the term or can be conjunctive or disjunctive.

(7) As used herein, the term substantially means to a great or significant extent, but not completely.

(8) As used herein, the term about or approximately as applied to one or more values of interest, refers to a value that is similar to a stated reference value, or within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, such as the limitations of the measurement system. In one aspect, the term about refers to any values, including both integers and fractional components that are within a variation of up to 10% of the value modified by the term about. Alternatively, about can mean within 3 or more standard deviations, per the practice in the art. Alternatively, such as with respect to biological systems or processes, the term about can mean within an order of magnitude, in some embodiments within 5-fold, and in some embodiments within 2-fold, of a value. As used herein, the symbol means about or approximately.

(9) All ranges disclosed herein include both end points as discrete values as well as all integers and fractions specified within the range. For example, a range of 0.1-2.0 includes 0.1, 0.2, 0.3, 0.4 . . . 2.0. If the end points are modified by the term about, the range specified is expanded by a variation of up to 10% of any value within the range or within 3 or more standard deviations, including the end points.

(10) As used herein, the terms active ingredient or active pharmaceutical ingredient refer to a pharmaceutical agent, active ingredient, compound, or substance, compositions, or mixtures thereof, that provide a pharmacological, often beneficial, effect.

(11) As used herein, the terms control, or reference are used herein interchangeably. A reference or control level may be a predetermined value or range, which is employed as a baseline or benchmark against which to assess a measured result. Control also refers to control experiments or control cells.

(12) As used herein, the term dose denotes any form of an active ingredient formulation or composition, including cells, that contains an amount sufficient to initiate or produce a therapeutic effect with at least one or more administrations. Formulation and composition are used interchangeably herein.

(13) As used herein, the term prophylaxis refers to preventing or reducing the progression of a disorder, either to a statistically significant degree or to a degree detectable by a person of ordinary skill in the art.

(14) As used herein, the terms effective amount or therapeutically effective amount, refers to a substantially non-toxic, but sufficient amount of an agent, composition, or cell(s) being administered to a subject that will prevent, treat, or ameliorate to some extent one or more of the symptoms of the disease or condition being experienced or that the subject is susceptible to contracting. The result can be the reduction or alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system. An effective amount may be based on factors individual to each subject, including, but not limited to, the subject's age, size, type or extent of disease, stage of the disease, route of administration, the type or extent of supplemental therapy used, ongoing disease process, and type of treatment desired.

(15) As used herein, the term subject refers to an animal. Typically, the subject is a mammal. A subject also refers to primates (e.g., humans, male or female; infant, adolescent, or adult), non-human primates, rats, mice, rabbits, pigs, cows, sheep, goats, horses, dogs, cats, fish, birds, and the like. In one embodiment, the subject is a primate. In one embodiment, the subject is a human.

(16) As used herein, a subject is in need of treatment if such subject would benefit biologically, medically, or in quality of life from such treatment. A subject in need of treatment does not necessarily present symptoms, particular in the case of preventative or prophylaxis treatments.

(17) As used herein, the terms inhibit, inhibition, or inhibiting refer to the reduction or suppression of a given biological process, condition, symptom, disorder, or disease, or a significant decrease in the baseline activity of a biological activity or process.

(18) As used herein, treatment or treating refers to prophylaxis of, preventing, suppressing, repressing, reversing, alleviating, ameliorating, or inhibiting the progress of biological process including a disorder or disease, or completely eliminating a disease. A treatment may be either performed in an acute or chronic way. The term treatment also refers to reducing the severity of a disease or symptoms associated with such disease prior to affliction with the disease. Repressing or ameliorating a disease, disorder, or the symptoms thereof involves administering a cell, composition, or compound described herein to a subject after clinical appearance of such disease, disorder, or its symptoms. Prophylaxis of or preventing a disease, disorder, or the symptoms thereof involves administering a cell, composition, or compound described herein to a subject prior to onset of the disease, disorder, or the symptoms thereof. Suppressing a disease or disorder involves administering a cell, composition, or compound described herein to a subject after induction of the disease or disorder thereof but before its clinical appearance or symptoms thereof have manifest.

(19) The terms below and used herein, have the following meanings, unless otherwise indicated:

(20) Antigen is a molecule that will trigger an immune response, abbreviated by Ag. An Ag may originate from within the body (a self-protein) or from an external site (non-self). The immune system may not react to self-proteins due to negative selection of T-cells in the thymus during development.

(21) Negative selection is a process in which lymphocytes, capable of strong binding with self-protein defined by the major histocompatibility complex (MHC) are removed by receiving an apoptosis signal leading to cell death. Some lymphocytes are phagocytosed by dendritic cells which allows presentation of self-antigens to MHC class II, a requirement for CD4+ T-cell negative selection. Some of these T-cells responding to self-proteins become Treg (T-regulatory) cells. The process is a component of central tolerance prevents formation of cells capable of inducing autoimmune diseases.

(22) An antibody is a Y shaped protein, immunoglobulin (Ig), with an antigen binding site and an Fc region. Antibodies from humans include several classes or isotypes; IgA, IgD, IgE, IgG, or IgM. The IgG is composed of four polypeptide chains; two heavy chains and two light chains connected by disulfide bonds. The light chains contain one variable domain (VL) and one constant domain (CL) and the heavy chains contain one variable domaine (VH) and three to four constant domains (CH1, CH2, CH3). Structurally, an antibody has two antigen binding fragments (Fab) composed of VL, VH, CL, and CH1 and a Fc fragment forming the trunk of the Y.

(23) A T-Cell is a type of white blood cells, a lymphocyte, that plays a central role in the Adaptive immune response. T-cells a differentiated from other lymphocytes by the presence of a T-cell receptor (TCR) on the cell surface. Multiple classes of T-cells are defined; CD8 killer T-cells, CD4 helper T-cells, and regulatory T-cells. Each class of T-cell performs a different function often involving release of cytokines. All T-cells originate from c-kit+Sca1+ hematopoietic stem cells (HSC) that reside in the bone marrow.

(24) An Epitope is a structural feature of an antigen that is an antigenic determinant that matches an antibody recognition site.

(25) Vaccination is the physical administration of a vaccine

(26) Immunization is the provision of immunity by any means, active or passive

(27) Active immunization is the administration of agents for induction of immunity that is long-lasting or at times, life-long

(28) Passive immunization is the administration of exogenously produced immune substances (e.g., convalescent serum, adoptive transfer of T-cells, or monoclonal antibodies) that dissipates with the turnover of the administered substances

(29) A vaccine is the conveyance of antigens to elicit immune responses that are generally protective. Multiple approaches to vaccine design are known including; attenuated virus, inactive virus, protein subunit, DNA vaccines, vectored vaccines, and mRNA vaccines.

(30) Vaccine adjuvant is a substance that increases and/or modulates the immune response to a vaccine antigen. Adjuvants can be inorganic compounds (potassium alum, aluminum hydroxide, aluminum phosphate, calcium phosphate hydroxide), oils (paraffin oil, peanut oil, squalene), bacterial products (mycobacterium Boris, toxoids, lipopolysaccharides), plant products (saponins), cytokines (IL-1, IL-2, IL-12), and stimulators of innate immune responses by binding Toll receptors (TLR ligand including CpG motifs).

(31) RNA is a ribonucleic acid and a polymeric molecule essential for coding, decoding, regulation and expression of genes. Cellular organisms use messenger RNA (mRNA) to convert genetic information as guanine (G), uracil (U), adenine (A), and cytosine (C) as triplets into selection of amino acids in synthesis of specific proteins

(32) RNA vaccine is a type of vaccine that uses a copy of a messenger RNA (mRNA) to express an antigen to produce an immune response as well as stimulate innate immune responses.

(33) Open reading frame is the sequence of nucleic acid mRNA that is translated into protein. It is referred to as open to contrast reading frames containing termination codons.

(34) Untranslated region is abbreviated as UTR refers to sections of mRNA flanking the ORF. On the 5-side it is the 5-UTR or leader and on the 3-side it is the 3-UTR or trailer. The 5-UTR contains sequence that is recognized by the ribosome and facilitates the initiation of translation. The 3-UTR is located immediately after the translation termination codon and facilitates post-transcriptional modification.

(35) Kozak consensus sequence is this sequence that contains the initiation start of translation and contains the sequence 5-ACCAUGG-3 where the AUG is the first methionine codon in an mRNA transcript.

(36) The sections herein will describe methods of administering the vaccine, methods of producing the vaccines, compositions comprising the vaccines, and nucleic acids encoding the vaccines. In some embodiments the vaccine may be compromised of an adjuvant as describe herein.

(37) Design, Synthesis, and Production

(38) The solid phase synthesis of a cDNA can be acquired from a number of commercial vendors. The synthesized cDNA is inserted or lighted into a commercially available bacterial plasmid (pDNA) that contains an origin of replication, antibiotic selectable resistance genes, and bacteriophage T7 polymerase (or any bacteriophage RNA transcription polymerase such as T3 for SP6). The pDNA is used to transform a competent bacteria grown in an appropriate antibiotic to select for a pDNA transformed bacteria that will allow growth and amplification of the pDNA. The manufactured pDNA can be retrieved from the bacteria by lysis of the bacteria and separation of pDNA from the bacterial chromosomal DNA by centrifugation and ethanol precipitation.

(39) The closed circular pDNA is linearized using a commercially available restriction endonuclease that allows separation of the linear form from other DNA by size exclusion chromatography. In vitro transcription of mRNA from the T7 polymerase includes nucleotide triphosphates (NTP) and a 5-cap can be added. The 5-cap is an option since the vaccine has an internal ribosomal entry site (IRES) in the 5-untranslated region (5-UTR). Extraction and precipitation steps remove unincorporated NTP and NTP metabolites, but some incomplete or shorter RNA will remain. Size exclusion chromatography separates mRNA based on size will remove shorter incomplete mRNA as well as contaminating double stranded RNA (dsRNA). Removal of dsRNA that may form is key in that it can stimulate unwanted innate immune responses. These processing steps are currently available at commercial GMP facilities that will ensure FDA compliant substance for human clinical use.

(40) Modifications

(41) RNA sensing by the 2-5-oligoadenylate synthetase (OAS) pathway resulting in RNase L-mediated RNA cleavage including the cellular ribosomal RNA (rRNA). The RNase L cleavage limits the mRNA vaccine half-life and reduces translation of mRNA (Anderson et al., 2011). RNA synthesized to include 2-O-methylated ribose, 5-methyl-uridines, or pseudouridine nucleosides do not activate the OAS sensing pathway and induction of the RNase L nuclease resulting in more durable translation of the mRNA vaccine.

(42) Synthetic mRNA with a 5-end modification, a 5-CAP, confers greater mRNA vaccine stability and enhanced translatability. The natural cap structure is an N7-methylated guanosine (m7G) connected by a 5-to 5-O-triphosp0hate bridge. In some cases, a 2-O-methylation of the +1 nucleotide ribose results in a cap structure m7GpppN2OmeN. The synthesis of the natural cap can be complex and an alternate synthetic CleanCap AG trimer (Tri Link Biotechologies, cat no. N-7113) can be added in vitro using a T7 RNA polymerase (Henderson et al., 2021).

(43) Pharmaceutical Vaccine Compositions

(44) The composition of the hCG mRNA vaccine is illustrated in FIG. 1. The hCG mRNA vaccine is composed of an mRNA nucleobase sequence (SEQ ID NO: 5) encoding the C-terminal 37 amino acids of hCG beta and a translation initiation site defined by a Kozak consensus AUG (amino acid product is SEQ ID NO: 6) identified in the artificial sequence. Immediately upstream of the hCG mRNA is a 5-UTR that may include the nucleobase sequence for the hepatitis C virus internal ribosomal entry site (SEQ ID NO: 7) designed to improve vaccine stability and enhance translation. The 5-terminus of the vaccine may include a CAP structure as either an N7-methylated guanine (m7GpppN), a dimmer cap structure including a 2-O-methylated ribose at N+1 (m7GpppN2OmeN), or a synthetic CleanCap trimer. Immediately downstream from the hCG mRNA is a translation termination codon, UAA, followed by a 3-UTR that may include the nucleobase sequence of the human beta-globin 3-UTR (SEQ ID NO: 8) known to improve mRNA stability and improve translation of the hCG mRNA. At the 3-terminus of the vaccine is a polyadenylation signaling sequence, AAUAAA (included in SEQ ID NO: 8).

(45) The compositions of the vaccine adjuvant include four CpG sequences within the hCG mRNA (SEQ ID NO: 5) known to stimulate innate immune surveillance pathways through toll-like receptors. In addition, an antisense oligonucleotide designed to bind near the splice acceptor region of exon 4 of interleukin 10 capable of inhibiting the expression of IL-10.

(46) IL-10 is an anti-inflammatory glycoprotein that participates in the regulation of immunity. IL-10 inhibits the activity of Th1 cells (a sub population of CD4+ T-cells), natural killer T-cells (NK), and macrophages that contribute to clearance of tumor tissue and infected cells. Expression and secretion of IL-10 inhibits the synthesis of interferon gamma (IFN-), IL-2, IL-3, tumor necrosis factor (TNF), and GM-CSF produced by activated macrophages and helper T-cells resulting in the inhibition of immune responses participating in clearance of tumor cells. Several immune cell type express IL-10 including macrophages, dendritic cells, B-cells, and subsets of CD4+ and CD8+ T-cells.

(47) An antisense oligonucleotide designed to bind to the splice acceptor region of exon four of IL-10 pre-mRNA (sequence 5-GGA GAA ATC GAT GCT GAA GAA-3; IL-10E4SA; SEQ ID NO: 11) led to skipping of exon 4 in the mature mRNA and reduced translation to the IL-10 protein. The IL10E4SA was determined to be optimal in targeting a variety of IL-10 transcript sites (Panchal et al., 2014). The inhibition of IL-10 protein in freshly isolated bone-marrow derived cells cultured to promote differentiation into dendritic cells was sequence specific, dose, and time dependent. When administered to mice that were challenged with a lethal mouse adapted Ebola virus, a survival benefit was observed in 7 replicate experiments of 10 mice in each treatment group for a cumulative of 41 survivors in the 70 infected mice compared to less than 10 survivors in 70 infected mice in vehicle control groups. Antibody depletion studies in IL-10.sup./ mice suggest a role for NK cells and IFN-gamma for the improved immune response in clearing infected cells. The capacity to shift Th1/Th2 balance with IL-10E4SA antisense oligomers represents a unique adjuvant strategy for an anti-cancer vaccine.

(48) Pharmaceutical Formulations

(49) Intravenous Injections

(50) Phosphate buffered saline (PBS) containing inactive ingredients-potassium phosphate mono basic, anhydrous, USP; potassium chloride, USP; sodium phosphate diabetic, anhydrous, USP; sodium chloride, USP; and water for injection, USP. Active ingredients include mRNA with and without antisense IL-10E4SA. The phosphate buffered saline with and without enhanced delivery agents including lipid nanoparticles (LNP) including but not limited to lipids (including ((4-hydroxybutyl)azanediyl)bis (hexane-6,1-diyl)bis (2-hexyldecanoate), 2[(polyethylene glycol)-2000]-N,N-ditetradecylacetamide, 1,2-distearoyl-sn-glycero-3-phosphocholine, and cholesterol), perflourocarbon micro bubbles (C4F10 or C5F12), or cationic peptides including but not limited to ArgArgArgArgArgArgGly (R.sub.6G).

(51) Intramuscular Injections

(52) A PBS solution as described for intravenous injection including mRNA with and without antisense IL-10E4SA administered in a solution of less than one milliliter into a muscle, e.g., the shoulder. The PBS solution with or without enhanced delivery agents including lipid nanoparticles (LNP) or cationic peptides including but not limited to R.sub.6G.

(53) Inhalation

(54) A PBS solution as described for intravenous injection including mRNA with and without antisense IL-10E4SA administered by an aerosol spray delivery device intra-nasally.

(55) A dry powder composed of aerodynamic particle size distributiona fine particle fraction (FPF) greater than 50 percent, a mean mass aerodynamic diameter (MMAD) of 2.0-2.5 micrometers, emitted dose (ED) of greater than 35 percent neat mRNA with and without IL-10E4SA and salt. The dry powder will be delivered by a flow-controlled inhalation metered device.

(56) Oral

(57) An oral rehydration solution (ORT) composed of 2.6 g NaCl, 2.9 g trisodium citrate, 1.5 g potassium chloride, 13.5 g anhydrous glucose, and mRNA with and without antisense IL-10E4SA in one liter of water.

(58) An oral solid dosage (pills or capsules) containing mRNA with or without antisense IL-10E4SA and excipients including binders, glidants, disintegrants, and lubricants to facilitate fill formation and dissolution in the gut.

(59) Formulations, Administration, Delivery, and Dosing

(60) Formulations

(61) The linear mRNA can be formulated by multiple strategies indicated in this document. Patients seeking vaccination will have confirmed disease and will be screened for prior adverse reactions to vaccines to exclude patients that may experience serious adverse reactions. No concurrent chemotherapy is permitted due to likelihood of immune suppressive actions of chemotherapy that may limit the efficacy of an hCG mRNA vaccine. Both male and female patients of all ethnic and ideological groups are included. Female patients of childbearing age are advised that the hCG mRNA vaccination will prevent pregnancy.

(62) Administration

(63) The hCG mRNA vaccine is administered by routes of administration described in this document such as intra-tumoral or intramuscular at doses of 0.03 to 0.10 mg of the hCG mRNA vaccine. The initial vaccination is designated day 0 and additional vaccinations will be administered at week 4, week 10, and week 16 to boost vaccine response. Patients are monitored for disease progression by standard procedures under the care of a qualified oncologist.

(64) TABLE-US-00002 TABLE 2 Exemplary administration protocol. Day Day 0 Week 4 Week 10 Week 16 Dose Initial Booster+ Booster+ Booster+
Delivery Methods

(65) Direct pulmonary delivery (e.g., aerosol, inhalers, etc.) is a more selective mode of drug delivery that typically requires a lower quantity of drug. But it can have limited efficacy due to improper dosing, stability issues, and difficulty in producing an optimum particle size. Pulmonary drug delivery can provide the following advantages: quick onset of action coupled with ease and convenience of administration; the pulmonary dose is significantly lower than the oral dose; and degradation of the drug in the liver can be avoided. On the other hand, the following drawbacks are often associated with pulmonary drug delivery: improper dosing; stability problems; and difficulty in producing the optimum particle size. In addition, not all drugs can be delivered via a pulmonary route due to formulation difficulties.

(66) Local therapeutic administration to solid tumors can be buttressed by using different types of drug delivery vehicles (nanoparticle drug carriers, liposomes, viral vectors, or microbubbles). The latter adhere to sites of damaged vascular endothelium and thus may be a method of systemically targeting delivery of therapeutics to organ damaged. For example, perfluorobutane gas microbubbles with a coating of dextrose and albumin efficiently bind to different pharmaceuticals. These 0.3-10.0 m particles bind to sites of vascular injury. Further, the perfluorobutane gas is an effective cell membrane fluidizer. The potential advantages of microbubble carrier delivery include none to minimal (additional) vessel injury through delivery, no resident polymer to degrade and lead to eventual inflammation, rapid bolus delivery, and repeated delivery. Microbubble carriers were successfully used in different animal models and clinical trials to deliver antisense oligonucleotide and/or Sirolimus to the injured vascular bed.

(67) Extracellular Vesicles (EV)

(68) Kumar and colleagues describe the use of extracellular vesicles (EVs), which are a family of natural carriers in the human body. EVs play a critical role in cell-to-cell communications and can be used as unique drug carriers of therapeutic vaccine to tumors. Though the authors of the reported investigations concluded that certain limitations need to be overcome as well as understanding the mechanism to control targeted delivery. Specifically, the isolation and drug encapsulation techniques employed to engineer EVs could result in the loss of functional properties of the EVs, such as the destruction of surface proteins. These unintended changes could lead to nonspecific interactions with other cells, leading to off-target effects, toxicity, and suboptimal efficacy.

(69) Adenosine Nanoparticles

(70) Recently, the efficacy in mitigating inflammation was demonstrated through the targeted delivery of adenosine and of multi-drug formulations. Bioconjugation of adenosine to squalene produces a prodrug-based nanocarrier, which, after nano for-mulation with Vit E, yields stable multidrug nanoparticles. This nanoparticle improves the bioavailability of both drugs with significant pharmaceutical activity in models of acute inflammatory injury.

(71) Novel Bio-Objects

(72) A group of researchers has succeeded in engineering a new kind of microscopic bio-object that may one day be used for personalized diagnostics and targeted delivery of drugs. The object consists of a genetically modified E. coli bacterium and nano-erythrocytes (small vesicles made of red blood cells), and it demonstrates a substantial improvement in motility over previous designs.

(73) Nanobodies

(74) In some embodiments therapeutic vaccine can be delivered using nanobodies. Indeed several researchers have shown that nanobodieswhich are tiny immune proteins can enhance site specific delivery and residence of vaccines.

(75) Nanomicells

(76) In brain tumors vaccine maybe delivered brain-derived neurotrophic factor mRNA using polyplex nanomicelle.

(77) Ischemic neuronal death causes serious lifelong neurological deficits; however, there is no proven effective treatment that can prevent neuronal death after the ischemia. We investigated the feasibility of mRNA therapeutics for preventing the neuronal death in a rat model of transient global ischemia (TGI). By intraventricular administration of mRNA encoding brain-derived neurotrophic factor (BDNF) using a polymer-based carrier, polyplex nanomicelle, the mRNA significantly increased the survival rate of hippocampal neurons after TGI, with a rapid rise of BDNF in the hippocampus.

(78) The nanomicelle has a core-shell structure surrounded by a PEG outer shell and an mRNA-containing core for stable retention of the mRNA in the nanomicelle. The local administration of mRNA loaded nanomicelles has already shown therapeutic potential in various organs, such as the liver, joint cartilage, intervertebral disk and the neural tissues, including the brain nanomicelles can also block the immune responses to extracellular mRNA by shielding them from recognition by the toll-like receptors in target cells.

(79) In some embodiments the problems associated with systemic delivery may be overcome by using intra-arterial or intravenous selective delivery of therapeutic agents using a percutaneous trans-catheter route to deliver a therapeutic agent for treating solid organ tumors.

(80) In some embodiments, a micro-catheter is introduced into a tumor feeding artery and/or its branches and a therapeutic agent for treating is infused through the micro-catheter. In some embodiments, the therapeutic agent is infused via an intravenous and/or intraarterial route using a micro-catheter.

(81) In some embodiments, the therapeutic agent delivery via the micro-catheter is pressure-enabled using a continuous flow. In some embodiments, the therapeutic agent delivery via the micro-catheter is pressure-enabled using an automated pulsatile flow. Optionally, pumping the therapeutic agent out via the micro-catheter may be synchronized with the subject's breathing.

(82) Different configurations of micro-catheters may be used with or without antireflux occluders including balloons; metallic constructions or fluid based vascular plugs. Any of the pharmaceuticals mentioned above may be delivered in a liquid state via the subject's blood, optionally with mixture of contrast agent and/or saline.

(83) Alternatively, different carriers such as micro-particles, nanoparticles, injectable polymers or natural carriers and others may be used to enhance penetration and residence of therapeutics at the target area.

(84) In some embodiments, a therapeutic vaccine is incorporated into substance-eluting beads (e.g., based on hydrogel and/or nanoparticles), and those beads are delivered via a micro-catheter using the blood vessels described above. The substance-eluting beads may be made, for example, by applying soybean lecithin to entrap hydrophilic bone morphogenic protein-2 into nanoporous poly(lactide-co-glycolide)-based microspheres. Other examples of materials that are suitable for forming the substance-eluting beads include but are not limited to biocompatible, resorbable, or non-resorbable hydrogel beads. The beads may optionally be produced from polyvinyl alcohol and may contain a covalently bound radiopaque moiety. Saccharose beads, etc. may be used.

(85) Other examples include silicon-based hydrogels; PEG-based polymers; nanoparticle-containing hydrogels; hydrogels containing cyclodextrins (CDs); hydrophilic polymers or poly ethylene glycol (PEG) provides water solubility to hydrogels, other polymers like as poly lactic acid (PLA), poly -caprolactone (PCL), polypropylene oxide (PPO), poly D,L-lactide-co-glycolide (PLGA) and poly -caprolactone-co-D,L-lactide (PCLA); ultra-thermosensitive hydrogel; hydrogels with different systems, namely, emulsions, vesicular (including micelles, liposomes and nanocapsules) and particulate systems (including mainly solid lipid micro and nanoparticles, nanostructured lipid carriers and lipid drug conjugates); biocompatible hydrogel, composed of the copolymer poly(nisopropylamide-co-n-butyl methacrylate) [P(NIPAAm-co-BMA)] and PEG; A polyethylenimine (PEI)-based hydrogel; supramolecular hydrogels; DNA-hydrogels; bioinspired hydrogels; and multi-functional and stimuli-responsive hydrogels; n-acrylic polymer impregnated with porcine gelatin; and gelatin.

(86) In some embodiments, a therapeutic vaccine is incorporated into biological (Fibrin glue, fibrin matrix and collagen matrix) or different polymers drug delivery depots to increase residence of vaccine in target tumor area.

(87) To avoid the disadvantages of oral or direct injection administration of drugs, a number of modes of administration of continuous dose, long-term delivery devices include reservoir devices, osmotic devices, and pulsatile devices for delivering beneficial agents have been utilized. Injecting drug delivery systems as small particles, microparticles or microcapsules avoids the incision needed to implant drug delivery systems. Microparticles, microspheres, and microcapsules, referred to herein collectively as microparticles, are solid or semi-solid particles having a diameter of less than one millimeter, more preferably less than 100 microns, which can be formed of a variety of materials, including synthetic polymers, and proteins. Another intensively studied polymeric injectable depot system is an in-situ-forming implant system. In situ-forming implant systems are made of biodegradable products, which can be injected via a syringe into the body, and once injected, congeal to form a solid biodegradable implant.

(88) In some embodiment's the vaccine can be delivered by image guided percutaneous interventional oncology procedure.

(89) Examples for Transcatheter Delivery

(90) One approach in lung cancer is to administer drugs locally using a pulmonary artery catheter (e.g., a Swan-Ganz catheter) via a pulmonary artery. For example, the catheter may be advanced into the superior vena cava, through the heart, and into the pulmonary artery, after which the therapeutic agent is delivered via the catheter. Two large, multicenter, randomized controlled studies have looked at the use of pulmonary artery catheters (PAC) in patients with shock and Acute Respiratory Distress Syndrome (ARDS) (Richard et al., 2003; National Heart Lung Blood Inst., 2006). PAC in the context of these trials were used to measure ventricular filling pressures, cardiac output, and other hemodynamic data, which the clinicians then used to guide treatment decisions. While there was no significant benefit shown in the use of PAC to guide decision making, there was no difference in mortality between the groups who did and did not receive a PAC. This may indicate that the use of PAC in patients with ARDS or acute lung injury does not pose an increased risk for mortality. Both studies indicated PAC-associated arrythmias as the most common complication. In the Richard PAC study, additional complications included arterial puncture and hemothorax. No deaths were attributable to ventricular fibrillation or arrhythmia. Several patients developed positive bacterial cultures following PAC insertion. In the NHLBI study, the rate of complications was no different between groups, and no deaths were related to the insertion of a catheter.

(91) Dosing

(92) The dosing of the hCG mRNA vaccine may range from 0.03 to 0.10 mg.

(93) Each of the sequences described herein encompasses a chemically modified sequence or an unmodified sequence which includes no nucleotide modifications.

(94) TABLE-US-00003 TABLE 3 Sequences Description SEQ ID NO FIG Human Chorionic Gonadotropin Exons 1-3 1 1 Human Chorionic Gonadotropin Protein 2 1 Human Chorionic Gonadotropin CTP-37 3 1 Human Chorionic Gonadotropin CTP-37 4 1 Human Chorionic Gonadotropin CTP-39 5 1 Human Chorionic Gonadotropin CTP-39 6 1 5-UTR based on HCV IRES 7 1 3-UTR based on beta-globin 8 1 Human Chorionic Gonadotropin CTP-39 9 1 (5-UTR, ORF, 3-UTR) Human Chorionic Gonadotropin CTP-39 10 1 dimer 5-UTR, 2 ORF, 3-UTR) Interleukin-10 exon 4 splice acceptor 11 1 antisense (IL-10E4SA) CTP21 12 CTP16 13

(95) TABLE-US-00004 TABLE4 Sequences SEQID Description Sequence(5.fwdarw.3) NO: HumanChorionic ATGGAGATGTTCCAGGGGCTGCTGCTGTTGCTGCTGCTGAGCATGGGCG 1 GonadotropinExons GGACATGGGCATCCAAGGAGCCGCTTCGGCCACGGTGCCGCCCCATCAA 1-3Sequence TGCCACCCTGGCTGTGGAGAAGGAGGGCTGCCCCGTGTGCATCACCGTC Length:498 AACACCACCATCTGTGCCGGCTACTGCCCCACCATGACCCGCGTGCTGC AGGGGGTCCTGCCGGCCCTGCCTCAGGTGGTGTGCAACTACCGCGATGT GCGCTTCGAGTCCATCCGGCTCCCTGGCTGCCCGCGCGGCGTGAACCCC GTGGTCTCCTACGCCGTGGCTCTCAGCTGTCAATGTGCACTCTGCCGCC GCAGCACCACTGACTGCGGGGGTCCCAAGGACCACCCCTTGACCTGTGA TGACCCCCGCTTCCAGGACTCCTCTTCCTCAAAGGCCCCTCCCCCCAGC CTTCCAAGCCCATCCCGACTCCCGGGGCCCTCGGACACCCCGATCCTCC CACAATAAAGGCTTCTCAATCCGCA HumanChorionic MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITV 2 Gonadotropin NTTICAGYCPTMTRVLQGVLPALPQvvCNYRDVRFESIRLPGCPRGVNP Protein VVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPS Sequence LPSPSRLPGPSDTPILPQ Length:165 HumanChorionic ACCTGTGATGACCCCCGCTTCCAGGACTCCTCTTCCTCAAAGGCCCCTC 3 GonadotropinCTP- CCCCCAGCCTTCCAAGCCCATCCCGACTCCCGGGGCCCTCGGACACCCC 37 GATCCTCCCACAATAA SequenceLength: 114 HumanChorionic TCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ 4 GonadotropinCTP- 37 HumanChorionic ACCAUGGGCACCUGCGACGACCCCAGAUUCCAGGACAGCAGCAGCAGCA 5 GonadotropinCTP- AAGCCCCCCCCCCCAGCCUGCCCAGCCCCAGCAGACUGCCCGGCCCCAG 39 CGACACCCCCAUCCUGCCCCAGUAA HumanChorionic MGTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ 6 GonadotropinCTP- 39 SequenceLength: 39 5-UTRbasedon GCCAGCCCCCUGAUGGGGGCGACACUCCACCAUGAAUCACUCCCCCGGC 7 HCVIRES GGGUCUACGUCUUCACGCAGAAAGCGCCUAGCCAUGGCGCUAGUAUGAG SequenceLength: UGUCGUGCAGCCGCCGGGACCCCCCCUCCCGGGAGAGCCAUAGCGGUCU 327 GCGGAACCGGUGCACCGGAAUGCCAGGACGACCGGGUCCUUUCUUGGAU CAACCCGCUCAAUGCCUGGAGAUUUGGGCGUGCCCCCGCAGACCGCAAG CCGUAGUGUUGGGUCGCGAAGGCCUUGUGGUACUGCCUGAUAGGGUGCU UGCGAGUGCCCCUUUAGGUCUCGUAGACCGUGC 3-UTRbasedon GCUCGCUUUCUUGCUGUCCAAUUUCUAUUAAAGGUCCUUUGUUCCCUAA 8 beta-globin GUCCAACUACUAAACUGAGGGAUAUUACAAAGGGCCUUGAGCAUCUGGA SequenceLength: UUCUGCCUAAUAAAAAACAUUUAUUUUCAUUGC 131 HumanChorionic GCCAGCCCCCUGAUGGGGGCGACACUCCACCAUGAAUCACUCCCCCGGC 9 GonadotropinCTP- GGGUCUACGUCUUCACGCAGAAAGCGCCUAGCCAUGGCGCUAGUAUGAG 39(5-UTR,ORF, UGUCGUGCAGCCGCCGGGACCCCCCCUCCCGGGAGAGCCAUAGCGGUCU 3-UTR) GCGGAACCGGUGCACCGGAAUGCCAGGACGACCGGGUCCUUUCUUGGAU SequenceLength: CAACCCGCUCAAUGCCUGGAGAUUUGGGCGUGCCCCCGCAGACCGCAAG 581 CCGUAGUGUUGGGUCGCGAAGGCCUUGUGGUACUGCCUGAUAGGGUGCU UGCGAGUGCCCCUUUAGGUCUCGUAGACCGUGCACCAUGGGCACCUGCG ACGACCCCAGAUUCCAGGACAGCAGCAGCAGCAAAGCCCCCCCCCCCAG CCUGCCCAGCCCCAGCAGACUGCCCGGCCCCAGCGACACCCCCAUCCUG CCCCAGUAAGCUCGCUUUCUUGCUGUCCAAUUUCUAUUAAAGGUCCUUU GUUCCCUAAGUCCAACUACUAAACUGAGGGAUAUUACAAAGGGCCUUGA GCAUCUGGAUUCUGCCUAAUAAAAAACAUUUAUUUUCAUUGC HumanChorionic GCCAGCCCCCUGAUGGGGGCGACACUCCACCAUGAAUCACUCCCCCGGC 10 GonadotropinCTP- GGGUCUACGUCUUCACGCAGAAAGCGCCUAGCCAUGGCGCUAGUAUGAG 39dimer5-UTR,2x UGUCGUGCAGCCGCCGGGACCCCCCCUCCCGGGAGAGCCAUAGCGGUCU ORF,3-UTR) GCGGAACCGGUGCACCGGAAUGCCAGGACGACCGGGUCCUUUCUUGGAU SequenceLength: CAACCCGCUCAAUGCCUGGAGAUUUGGGCGUGCCCCCGCAGACCGCAAG 701 CCGUAGUGUUGGGUCGCGAAGGCCUUGUGGUACUGCCUGAUAGGGUGCU UGCGAGUGCCCCUUUAGGUCUCGUAGACCGUGCACCAUGGGCACCUGCG ACGACCCCAGAUUCCAGGACAGCAGCAGCAGCAAAGCCCCCCCCCCCAG CCUGCCCAGCCCCAGCAGACUGCCCGGCCCCAGCGACACCCCCAUCCUG CCCCAGACCAUGGGCACCUGCGACGACCCCAGAUUCCAGGACAGCAGCA GCAGCAAAGCCCCCCCCCCCAGCCUGCCCAGCCCCAGCAGACUGCCCGG CCCCAGCGACACCCCCAUCCUGCCCCAGUAAGCUCGCUUUCUUGCUGUC CAAUUUCUAUUAAAGGUCCUUUGUUCCCUAAGUCCAACUACUAAACUGA GGGAUAUUACAAAGGGCCUUGAGCAUCUGGAUUCUGCCUAAUAAAAAAC AUUUAUUUUCAUUGC Interleukin-10exon GGAGAAATCGATGCTGAAGAA 11 4spliceacceptor antisense(IL- 10E4SA) SequenceLength: 21 CTP21 TCDDPRFQDSSSSKAPPPSLP 12 SequenceLength: 21 CTP16 SPSRLPGPSDDTPILPQ 13 SequenceLength: 16

(96) TABLE-US-00005 TABLE5 RawDNAforC-terminalpeptideofhCG. 130 acctgtgatgacccccgcttccaggactcc ThrCysAspAspProArgPheGlnAspSer 3160 tcttcctcaaaggcccctccccccagcctt SerSerSerLysAlaProProProSerLeu 6190 ccaagcccatcccgactcccggggccctcg ProSerProSerArgLeuProGlyProSer 91114 gacaccccgatcctcccacaataa AspThrProIleLeuProGlnSTOP

(97) It will be apparent to one of ordinary skill in the relevant art that suitable modifications and adaptations to the compositions, formulations, methods, processes, apparata, assemblies, and applications described herein can be made without departing from the scope of any embodiments or aspects thereof. The compositions, apparata, assemblies, and methods provided are exemplary and are not intended to limit the scope of any of the disclosed embodiments. All the various embodiments, aspects, and options disclosed herein can be combined in any variations or iterations. The scope of the compositions, formulations, methods, apparata, assemblies, and processes described herein include all actual or potential combinations of embodiments, aspects, options, examples, and preferences described herein. The compositions, formulations, apparata, assemblies, or methods described herein may omit any component or step, substitute any component or step disclosed herein, or include any component or step disclosed elsewhere herein. The ratios of the mass of any component of any of the compositions or formulations disclosed herein to the mass of any other component in the formulation or to the total mass of the other components in the formulation are hereby disclosed as if they were expressly disclosed. Should the meaning of any terms in any of the patents or publications incorporated by reference conflict with the meaning of the terms used in this disclosure, the meanings of the terms or phrases in this disclosure are controlling. All patents and publications cited herein are incorporated by reference herein for the specific teachings thereof.

REFERENCES

(98) 1. Acevedo et al., Effects of immunization against human choriogonadotropin on the growth of transplanted Lewis lung carcinoma and spontaneous mammary adenocarcinoma in mice. Cancer Detect. Prev. Suppl. 1: 477-486 (1987). 2. Alfthan et al., Elevation of free beta subunit of human choriogonadotropin and core beta fragment of human choriogonadotropin in the serum and urine of patients with malignant pancreatic and biliary disease, Cancer Res. 52 (17): 4628-4633 (1992). 3. Anderson et al., Nucleoside modifications in RNA limit activation of 2-5-oligoadenylate synthetase and increase resistance to cleavage by RNase L, Nucleic Acids Res. 39 (21): 9329-9338 (2011). 4. Buckley and Fox, An immunohistochemical study of the significance of HCG secretion by large bowel adenocarcinomata, J. Clin Pathol. 32(4): 368-372 (1979). 5. Campo et al., Human chorionic gonadotropin in colorectal carcinoma. An immunohistochemical study, Cancer 59(9): 1611-1616 (1987). 6. Han, T. Human chorionic gonadotropin. Its inhibitory effect on cell-mediated immunity in vivo and in vitro, Immunology 29(3): 509-515 (1975). 7. Henderson et al., Cap 1 Messenger RNA Synthesis with Co-transcriptional CleanCap Analog by In Vitro Transcription, Curr. Protoc. 1(2): e39 (2021). 8. Iles et al., Does hCG or hCGbeta play a role in cancer cell biology? Mol. Cell. Endocrinol. 329(1-2): 62-70 (2010). 9. Iversen et al., Monoclonal antibodies to two epitopes of beta-human chorionic gonadotropin for the treatment of cancer, Curr. Opin. Mol. Ther. 5(2):156-160 (2003). 10. Kellen et al., Effects of antibodies to choriogonadotropin in malignant growth. II. Solid transplantable rat tumors, Cancer Immunol. Immunother. 13(1): 2-4 (1982). 11. Lamb BNT162b2 mRNA COVID-19 Vaccine: First Approval, Drugs 81(4): 495-501 (2021). 12. Lapthorn et al., Crystal structure of human chorionic gonadotropin, Nature 369(6480): 455-461 (1994). 13. The National Heart, Lung, and Blood Institute Acute Respiratory Distress Syndrome (ARDS) Clinical Trials Network, Pulmonary-artery versus central venous catheter to guide treatment of acute lung injury, N. Engl. J. Med. 354(21): 2213-2224 (2006) 14. Panchal et al., Induced IL-10 splice altering approach to antiviral drug discovery, Nucleic Acid Ther. 24(3): 179-185 (2014). 15. Richard, et al. Early use of the pulmonary artery catheter and outcomes in patients with shock and acute respiratory distress syndrome: a randomized controlled trial, J. Am. Med. Assoc. 290(20): 2713-2720 (2003). 16. Skinner and Whitehead, Tumor-associated antigens in polyps and carcinoma of the human large bowel, Cancer 47(6): 1241-1245 (1981). 17. Tumban, Lead SARS-CoV-2 Candidate Vaccines: Expectations from Phase III Trials and Recommendations Post-Vaccine Approval, Viruses 13(1) 54: 10.3390/v13010054 (2020). 18. Walsh et al., Safety and Immunogenicity of Two RNA-Based Covid-19 Vaccine Candidates, N. Engl. J. Med. 383(25): 2439-2450 (2020).