Treatment of myotonic dystrophy
12503495 ยท 2025-12-23
Assignee
- Association Institut De Myologie (Paris, FR)
- Centre National De La Recherche Scientifique (Paris, FR)
- Institut National De La Sante Et De La Recherche Medicale (Paris, FR)
- Universite Pierre Et Marie Curie (Paris 6) (Paris, FR)
Inventors
- Denis Furling (Joinville-le-Pont, FR)
- Nicolas Sergeant (Ronchin, FR)
- Marie-Laure Caillet-Boudin (Tournai, BE)
- Ludovic Arandel (Saint Maur des Fosses, FR)
Cpc classification
A61K9/0019
HUMAN NECESSITIES
A61K48/0075
HUMAN NECESSITIES
International classification
A61K48/00
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
Abstract
The present invention relates to compositions and methods for treating myotonic dystrophy.
Claims
1. A method of treating myotonic dystrophy disease or disorders caused by abnormal sequestration of the muscleblind-like RNA-binding protein (MBNL) comprising administering to a subject in need of treatment a modified muscleblind-like (MBNL) polypeptide or a nucleic acid molecule encoding said modified MBNL polypeptide, said modified MBNL polypeptide binding the MBNL YGCY RNA motif, with Y representing a pyrimidine, and having a splicing activity reduced by at least 60% as compared to wild-type MBNL protein, wherein said modified MBNL polypeptide is not a chimeric peptide consisting of MBNL polypeptide and a targeting moiety, wherein said modified MBNL polypeptide lacks the C-terminal domains of wild-type MBNL protein that are responsible for MBNL splicing regulatory activity, wherein said modified MBNL polypeptide corresponds to exons 1 to 4 of the wild-type MBNL protein, or has a sequence at least 90% identical to the amino acid sequence corresponding to exons 1 to 4 of the wild-type MBNL protein, wherein said wild-type MBNL protein is MBNL2 or MBLN3; and wherein said modified MBNL polypeptide is optionally further fused to a nuclear localization sequence (NLS) or a nuclear export sequence (NES).
2. The method of claim 1, wherein the modified MBNL polypeptide binds CUG repeats.
3. The method of claim 1, wherein the modified MBNL polypeptide has at least 90%, 95% or 99% identity to the amino acid sequence corresponding to exons 1 to 4 of the wild-type MBNL2 mRNA or to the amino acid sequence shown in SEQ ID NO: 4, or being a non-functional YGCY-binding variant thereof.
4. The method of claim 1, wherein the modified MBNL polypeptide has at least 95% identity to the amino acid sequence corresponding to exons 1 to 4 of the wild-type MBNL3 mRNA or to the amino acid sequence shown in SEQ ID NO:8, or being a non-functional YGCY-binding variant thereof.
5. The method of claim 1, comprising administering to a subject in need of treatment a viral vector comprising said nucleic acid molecule encoding said modified MBNL polypeptide, operably linked to control sequences.
6. The method of claim 5, wherein the viral vector comprises a lentivirus- or adeno-associated virus (AAV) derived genome.
7. The method of claim 5, wherein the viral vector is an AAV vector having a serotype 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11 AAV capsid.
8. The method of claim 7, wherein the AAV vector has a serotype 9 AAV capsid.
9. The method of claim 5, wherein the viral vector is an AAV vector and is administered intramuscularly or directly in the CNS.
10. The method of claim 9, wherein the AAV vector is administered as a single injection.
11. The method of claim 1, wherein the modified MBNL polypeptide has at least 99% identity to the amino acid sequence corresponding to exons 1 to 4 of the wild-type MBNL3 mRNA or to the amino acid sequence shown in SEQ ID NO:8, or being a non-functional YGCY-binding variant thereof.
Description
LEGEND OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
DETAILED DESCRIPTION OF THE INVENTION
(21) The modified MBNL polypeptide of the invention is able to bind the MBNL YGCY RNA-motif, with Y representing a pyrimidine (uridine or cytosine). In particular, the modified MBNL polypeptide of the invention is able to bind UGCU-motif, which is the building block of the pathological DM1 expanded CUG repeats. In a particular embodiment, the modified MBNL polypeptide of the invention includes or not the amino acids corresponding to exon 3 of the MBNL1 mRNA (accession number NM_021038). In a further embodiment, the modified MBNL polypeptide of the invention lacks the amino acids of SEQ ID NO:1 (SEQ ID NO:1: TQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGA TAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAAT TSATSVPFAATTANQIPIISAEHLTSHKYVTQM) corresponding to exons 5 to 10 of the MBNL1 mRNA.
(22) As used herein, the term MBNL denotes all paralogue members of the muscleblind-like RNA-binding protein family and includes in particular MBNL1, -2 and -3. In a particular embodiment, the modified MBNL polypeptide according to the invention is derived from the human MBNL1 protein sequence. In an embodiment, the modified MBNL polypeptide is a MBNL1 protein having the exon 3 encoded sequence but lacking the amino acid sequences encoded by exons 5 to 10 of the MBNL1 gene. In a specific embodiment, the modified MBNL1-derived polypeptide is referred to as CT3 having the following amino acid sequence:
(23) TABLE-US-00001 (SEQIDNO:2) MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRV IACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQM QLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEIL PTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDC RFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAA QYQVNQAAAAQAAATAAAM.
(24) In an embodiment, the modified MBNL polypeptide is a MBNL1 protein lacking both the exon 3 encoded sequence and the sequences encoded by exons 5 to 10 of the MBNL1 gene. In a specific embodiment, the non-functional MBNL1-derived polypeptide is referred to as CT having the following amino acid sequence:
(25) TABLE-US-00002 (SEQIDNO:3) MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRV IACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQM QLANAMMPGAPLQPVVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTV TVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAA M.
(26) In another embodiment, the modified MBNL polypeptide is a MBNL2 protein encoded by the amino acid sequences of exons 1 to 4 of the MBNL2 gene. In an embodiment, the modified MBNL polypeptide is a MBNL2 protein lacking the amino acid sequences encoded by exons 5 to 8 of the MBNL2 gene. Ina specific embodiment, the modified MBNL2-derived polypeptide is referred to as MBNL2-CT3 or MBNL2 having the following amino acid sequence:
(27) TABLE-US-00003 (SEQIDNO:4) MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRV IACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQ MQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPGVGLVPTEILP TTPVIVPGSPPVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFA HPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQ ANQAAVAAQAAAAAATVM.
(28) In another embodiment, the modified MBNL polypeptide is a MBNL3 protein encoded by the amino acid sequences of exons 1 to 4 of the MBNL3 protein. In an embodiment, the modified MBNL polypeptide is a MBNL3 protein lacking the amino acid sequences encoded by exons 6 to 10 of the MBNL3 gene. In a specific embodiment, the modified MBNL3-derived polypeptide is referred to as MBNL3-CT3 or MBNL3 having the following amino acid sequence:
(29) TABLE-US-00004 (SEQIDNO:8) MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGR VVACFDSLKGRCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQ QMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPN TPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHP TDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMN HSAASAM.
(30) As used herein a variant of the modified MBNL polypeptide of the invention is a protein having the same or similar binding properties to the YGCY motif, in particular to CUG repeats, as the wild-type MBNL protein it is derived from (in particular MBNL1, 2 or 3) or as the modified MBNL protein of SEQ ID NO: 2, SEQ ID NO:3 or SEQ ID NO:4 as shown above, and wherein said variant has a reduced splicing activity as compared to the wild-type MBNL protein. In other terms, the modified MBNL polypeptide used in the present invention is a non-functional MBNL polypeptide, that has low or even no splicing activity as compared to the wild-type parent MBNL protein. The use of such a non-functional MBNL polypeptide with regard to its splicing activity has never been reported in the prior art for the treatment of a myotonic dystrophy, since all previous therapeutic attempts were carried out using a functional MBNL protein, i.e. a protein that has all the features of the wild-type protein including its ability to bind to the YGCY motif and its splicing activity. Indeed, previous attempts were aimed at providing to the treated cell overexpression of a MBNL protein that will compensate for the loss of free and functionally available endogenous MBNL proteins which has been sequestered onto pathological repeats. The strategy applied in the present disclosure is unrelated. Instead of providing overexpression of a functional MBNL protein, the inventors propose to introduce into cells in need thereof a modified MBNL protein, i.e. a non-functional variant MBNL protein having reduced or even no splicing activity, to compete, displace, and replace thereon endogenous MBNL protein(s) to avoid the negative consequences of their sequestration. As provided in the experimental part of this disclosure, the results obtained with the present strategy have been extremely satisfying.
(31) In a particular embodiment, the variant according to the invention may have a sequence at least 50%, in particular at least 60%, 70%, 80%, 90% and more particularly at least 95% or even at least 99% identical to the amino acid sequence corresponding to exons 1 to 4 of the wild-type MBNL protein (e.g. of MBNL1, 2 or 3) or to the amino acid sequence shown in SEQ ID NO: 2, 3 or 4.
(32) In a particular embodiment, the variant according to the invention has a sequence at least 50% in particular at least 60%. 70%, 80%. 90% and more particularly at least 95% or even at least 99% identical to the amino acid sequence corresponding to exons 1 to 4 of the wild-type MBNL2 mRNA or to the amino acid sequence shown in SEQ ID NO: 4, or being a non-functional YGCY-binding variant thereof.
(33) In a particular embodiment, the variant according to the invention has a sequence at least 50%, in particular at least 60%, 70%, 80%, 90% and more particularly at least 95% or even at least 99% identical to the amino acid sequence corresponding to exons 1 to 4 of the wild-type MBNL3 mRNA or to the amino acid sequence shown in SEQ ID NO: 8, or being a non-functional YGCY-binding variant thereof.
(34) In a particular embodiment of the invention, the modified MBNL polypeptide of the invention is not a chimeric peptide consisting of a MBNL polypeptide and a targeting moiety.
(35) The present invention implements and modified MBNL polypeptide which has almost no splicing activity, or otherwise said as a reduced activity, as compared to wild-type MBNL protein. By almost no activity or reduced activity, it is herein intended to describe a splicing activity, which is reduced by at least 50%, in particular by at least 60%, 70%, 75%, 80%, 85%, 90% or even at least 95% as compared to the splicing activity of wild-type MBNL protein. Such activity may be determined according to methods well known by those skilled in the art such as the use of minigenes to analyze the alternative splicing of cTNT exon 5, IR exon 11 and Tau exon 2 (Tran et al., 2011).
(36) In a particular embodiment, the modified MBNL protein of the invention may comprise a localization sequence such as a nuclear localization sequence (NLS) or a nuclear export signal (NES). A representative NLS has the sequence represented in SEQ ID NO: 5: PKKKRKV. A representative NES has the sequence represented in SEQ ID NO: 6: LPPLERLTLD. The present disclosure includes any modified MBNL polypeptide as described above, combined with such a localization sequence, in particular with a NLS or NES such as those specifically mentioned above.
(37) The invention further relates to a pharmaceutical composition comprising the modified MBNL polypeptide of the invention or a variant thereof.
(38) Another aspect of the invention is a nucleic acid sequence comprising or consisting of a nucleotide sequence encoding a modified MBNL polypeptide according to the invention. The invention further relates to a genetic construct consisting of or comprising a nucleotide sequence as defined herein, and regulatory sequences (such as a suitable promoter(s), enhancer(s), terminator(s), etc. . . . ) allowing the expression (e.g. transcription and translation) of a modified MBNL polypeptide according to the invention in a host cell. The genetic constructs of the invention may be DNA or RNA, and are preferably double-stranded DNA. The genetic constructs of the invention may also be in a form suitable for transformation of the intended host cell or host organism, in a form suitable for integration into the genomic DNA of the intended host cell or in a form suitable for independent replication, maintenance and/or inheritance in the intended host organism. For instance, the genetic constructs of the invention may be in the form of a vector, such as for example a plasmid, cosmid, YAC, a viral encoding vector or transposon. In particular, the vector may be an expression vector, i.e. a vector that can provide for expression in vitro and/or in vivo (e.g. in a suitable host cell, host organism and/or expression system). In a preferred but non-limiting aspect, a genetic construct of the invention comprises i) at least one nucleic acid sequence of the invention; operably linked to ii) one or more regulatory elements, such as a promoter and optionally a suitable terminator; and optionally also iii) one or more further elements of genetic constructs such as 3- or 5-UTR sequences, leader sequences, selection markers, expression markers/reporter genes, and/or elements that may facilitate or increase (the efficiency of) transformation or integration or subcellular localization or expression of the modified MBNL polypeptide, such as nuclear localization signal (NLS) or nuclear export signal (NES).
(39) In a particular embodiment, the genetic construct corresponds to the genome of a recombinant viral vector. Suitable viral vectors used in practicing the present invention include retroviruses, lentiviruses, adenoviruses and adeno-associated viruses. In particular, the invention relates to a lentivirus comprising a nucleic acid sequence encoding a modified MBNL polypeptide according to the invention. In another particular embodiment, the invention relates to an AAV vector, in particular an AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10 or AAV11 vector, in particular an AAV9 vector, comprising a nucleic acid sequence encoding a modified MBNL protein according to the invention. The AVV vector may be a pseudotyped vector, i.e. its genome and its capsid may be derived from different AAV serotypes. For example, the genome may be derived from an, AAV2 genome and its capsid proteins may be of the AAV1, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10 or AAV11 serotype.
(40) Another aspect relates to a modified MBNL polypeptide according to the invention, for use as a medicament.
(41) The modified MBNL polypeptide of the invention is an useful therapeutic agent, in particular in the treatment of a disease or disorder linked to a sequestration of a MBNL protein, or to a deregulated function of a MBNL member such as MBNL1, or other paralogue members (including MBNL2 and MBNL3). In a preferred embodiment, the modified polypeptide of the invention is used for the treatment of a myotonic dystrophy such as DM1 and DM2, or any disease where a loss of MBNL function (e.g. sequestration, aggregation, mutations . . . ) may be rescued by ectopic delivery of the modified MBNL polypeptide of the invention.
(42) In a further aspect, the invention relates to a modified MBNL polypeptide as described above, for use in a method for the treatment of a myotonic dystrophy.
(43) As used herein, the term treatment or therapy includes curative and/or preventive treatment. More particularly, curative treatment refers to any of the alleviation, amelioration and/or elimination, reduction and/or stabilization (e.g., failure to progress to more advanced stages) of a symptom, as well as delay in progression of a symptom of a particular disorder. Preventive treatment refers to any of: halting the onset, delaying the onset, reducing the development, reducing the risk of development, reducing the incidence, reducing the severity, as well as increasing the time to onset of symptoms and survival for a given disorder.
(44) It is thus described a method for treating myotonic dystrophies in a subject in need thereof, which method comprises administering said patient with a modified MBNL polypeptide according to the invention, or with a nucleic acid sequence encoding said modified MBNL polypeptide.
(45) Within the context of the invention, subject or patient means a mammal, particularly a human, whatever its age or sex, suffering of a myotonic dystrophy. The term specifically includes domestic and common laboratory mammals, such as non-human primates, felines, canines, equines, porcines, bovines, goats, sheep, rabbits, rats and mice.
(46) Preferably the patient to treat is a human being, including a child or an adolescent.
(47) For the uses and methods according to the invention, the modified MBNL polypeptide, the nucleic acid, the genetic construct, or the viral vector (such as a lentiviral or AAV vector) may be formulated by methods known in the art. In addition, any route of administration may be envisioned. For example, the modified MBNL polypeptide, the nucleic acid, the genetic construct and the viral vector (such as a lentiviral or AAV vector) may be administered by any conventional route of administration including, but not limited to oral, pulmonary, intraperitoneal (ip), intravenous (iv), intramuscular (im), subcutaneous (sc), transdermal, buccal, nasal, sublingual, ocular, rectal and vaginal. In addition, administration directly to the nervous system may include, and are not limited to, intracerebral, intraventricular, intracerebroventricular, intrathecal, intracistemal, intraspinal or peri-spinal routes of administration by delivery via intracranial or intravertebral needles or catheters with or without pump devices. It will be readily apparent to those skilled in the art that any dose or frequency of administration that provides the therapeutic effect described herein is suitable for use in the present invention. In a particular embodiment, the subject is administered a viral vector encoding a modified MBNL polypeptide according to the invention by the intramuscular route. In a specific variant of this embodiment, the vector is an AAV vector as defined above, in particular an AAV9 vector. In a further specific aspect, the subject receives a single injection of the vector.
(48) Additionally, standard pharmaceutical methods can be employed to control the duration of action. These are well known in the art and include control release preparations and can include appropriate macromolecules, for example polymers, polyesters, polyamino acids, polyvinyl, pyrolidone, ethylenevinylacetate, methyl cellulose, carboxymethyl cellulose or protamine sulfate.
(49) In addition, the pharmaceutical composition may comprise nanoparticles that contain the modified MBNL polypeptide of the present invention.
(50) The below examples illustrate the invention without limiting its scope.
EXAMPLES
Material and Method
(51) 1) Experiments with MBNL1CT3 (Also Called CT3)
(52) Plasmids and Viral Production
(53) The plasmid containing the 3UTR of DMPK with 960 interrupted CTGs was a minigene vector also under the control of the CMV promoter (kindly gift from T. Cooper, Baylor College of Medicine, Houston TX, USA). The sequence of MBNL1 full-length variant constructs and truncated CT3 used in this study were previously described (Tran et al. 2011). NES was derived from the REV protein of HIV (Fischer et al. 1995) and fused to the CT3 construct. MBNL1, CT3 and CT3-NES splicing activity was assessed using three minigenes previously described: the RTB300 minigene containing exon 5 of human cTNT (hcTNT); the INSR minigene containing exon 11 of human insulin receptor and the pSVIRB/Tau minigene containing exons 2 and 3. All plasmids DNA were double-strand sequenced at GATC Biotech (France) and purified using the Nucleobond AX endotoxin free kit (Macherey Nagel, Germany). The cDNA coding for GFP-CT3 or for the GFP protein containing both a Kozak consensus sequence were cloned in the SIN-cPPT-PGK-WHV or pSMD2 transfer vectors. Lentiviral and AAV9 vectors were obtained as previously described (Caillierez et al. 2013; Francois et al.; Fugier et al. 2011) and stored frozen at 80 C. Recombinant GST-MBNL1 and CT3 proteins were produced and UV-cross-linking experiments performed as describe before (Laurent et al. 2012, Tran et al. 2011). The hTau minigene and Mut MBNL construct are described in (Carpentier et al., 2014). Briefly, the hTau E2 minigene consists of exon 1, exon 2 and exon 4 sequences of the human MAPT gene inserted into the pEGFPN1 eucaryote expression vector (Clontech). The exon 2 is preceded and followed by 878 and 2100 nucleotides of the intronic sequences 2 and 3 of the human MAPT gene, respectively (detailed in Carpentier et al., 2014). The Seq250 E2 250 MBNL1 mutated sites in
(54) Cell Culture, Transfection and Infection
(55) HeLa cells were grown in monolayer cultures in 6 well plates in Dulbecco's Modified Essential Medium (DMEM) (Invitrogen) supplemented with 10% fetal calf serum (FBS) at 37 C. in a humidified CO.sub.2 (5%) incubator. Cells grown to 70% confluence were transiently co-transfected with 1 g of minigene plasmid DNA, 1 g of CUG repeats and 3 g of MBNL plasmid DNA in triplicate, using FuGENE HD transfection reagent (Roche Diagnostics) according to the manufacturer's instructions.
(56) Human muscle cells were isolated from skeletal muscle biopsies as described (Furling et al, 2001), in accordance to French legislation on ethical rules. Wild-type (WT) and DM1 myoblasts were grown in HAM's F10 medium supplemented with 20% FBS and 5 g/mL gentamycin (Invitrogen), at 5% CO.sub.2 and 37 C. 100 ng P24/l were used to transduce 210.sup.5 human muscle cells. Vector transduction was performed overnight in the presence of 4 g/ml of polybrene (Sigma). To trigger differentiation, growth medium was removed from subconfluent cultures and replaced by DMEM medium supplemented with 10 g/mL insulin (Sigma).
(57) In Vivo Gene Transfer and Experiments
(58) HSA-LR mice were obtained from C. Thornton and control FVB mice from Janvier. All mouse procedures were done according to experimental protocols approved by the Ethic Committee on Animal Resources at the Centre d'Exploration Fonctionnelle of Pitie-Salpetriere animal facility and under appropriate biological containment. The gastrocnemius or tibialis anterior muscles of adult mice were injected respectively with 30 to 100 l of physiological solution containing or not AAV9 vectors. For each mouse, one muscle was injected with AAV GFP-CT3 and the contralateral muscle was injected with control AAV containing any transgene (MCS) or GFP or vehicle alone (PBS). Six weeks after injections, the isometric contractile properties of the muscles were measured as previously described (Mouisel et al. 2006). Then, the mice were killed, muscles were collected and snap-frozen in liquid nitrogen-cooled isopentane and stored at 80 C.
(59) Fluorescent In Situ Hybridization (FISH) and Immunofluorescence
(60) Fluorescent in situ hybridization (FISH) was done as described using a Cy3-labeled 2-O-methyl RNA (CAG).sub.7 probe. Combined FISH-immunofluorescence (IF) experiment was done as described (Francois et al.) using polyclonal MBNL1 (Everest Biotech.) or GFP (Invitrogen) antibodies followed respectively by secondary Cy5- or Alexa 488-conjugated antibodies. Pictures were captured using a Leica confocal microscope and software (Leica microsytems), and processed with ImageJ software. Immunofluorescence on muscle section was done as described using embryonic MyHC (Novocastra) and Laminin (Novocastra) antibodies.
(61) Protein Extraction and Western Blot Analysis
(62) Western blotting was performed with standard methods as described previously (Tran et al. 2011) using anti-GFP (Santa Cruz) or anti-GAPDH (Tebu-Bio) antibodies.
(63) RNA Extraction and Semi-Quantitative Analysis
(64) Total RNA was isolated using a total RNA extraction kit (Nucleospin RNA II kit, Macherey Nagel) or TRIzol reagent (Invitrogen) according to the manufacturer's protocol. RNA concentration was determined by measuring the absorbance at 260 nm by using the Nanodrop (Labtech). RT-PCR was performed using 1 g of total RNA using random hexamers and the M-MLV reverse transcriptase (Invitrogen) according to standard protocols. No DNA amplification was observed in the RT controls. PCR was carried out as previously described. The reaction products were resolved by electrophoresis using a 5% or 8% polyacrylamide gel, and bands were stained with SYBR Gold (Invitrogen). The intensity of SYBR Gold luminescence was measured using a FluoroImager scanner (Claravision). PCR experiments were repeated at least three times.
(65) Statistical Analyses
(66) Statistical analyses were performed using unpaired t-test with two tails P values, with the help of Prism 6 Software (GraphPad Software Inc.).
(67) 2) Experiments with MBNL1CT3, MBNL2 and MBNL3
(68) Plasmids
(69) The sequence of MBNL2 and MBNL1CT3 were described in Fardaei et al, 2001 and Tran et al. 2011, respectively. The truncated variant constructs of MBNL2 and MBNL3 are described below. The Tau minigene containing exon 10 (described in Sergeant et al, IDMC12, 2019) was used to assess splicing activity of MBNL2 and MBNL2. The minigene was generated by GeneArt (Gene Synthesis company) and the sequence of plasmid preparation was verified by double strand sequence by GATC (Biotech, Constance, Germany). All plasmids DNA were purified using the Nucleobond AX endotoxin free kit (Macherey Nagel, Germany). In addition, the cDNA coding for MBNL1, MBNL2 or MBNL3 and containing a V5-tag were also cloned in the pSMD2 transfer vectors for adeno-associated viral (AAV) production.
(70) TABLE-US-00005 Sequences V5-MBNL2cDNA(SEQIDNO:9,V5-tagis underscored) ATGGGTAAGCCTATCCCTAACCCTCTCCTCGGTCTCGATTCTACGGCTTT GAACGTTGCCCCAGTCAGAGATACAAAATGGCTGACATTAGAAGTCTGCA GACAGTTTCAAAGAGGAACATGCTCACGCTCTGATGAAGAATGCAAATTT GCTCATCCCCCCAAAAGTTGTCAGGTTGAAAATGGAAGAGTAATTGCCTG CTTTGATTCCCTAAAGGGCCGTTGTTCGAGAGAGAACTGCAAGTATCTTC ACCCTCCGACACACTTAAAAACTCAACTAGAAATTAATGGAAGGAACAAT TTGATTCAGCAAAAAACTGCAGCAGCAATGCTTGCCCAGCAGATGCAATT TATGTTTCCAGGAACACCACTTCATCCAGTGCCCACTTTCCCTGTAGGCC CCGCGATAGGGACAAATACGGCTATTAGCTTTGCTCCTTACCTAGCACCT GTAACCCCTGGAGTTGGGTTGGTCCCAACGGAAATTCTGCCCACCACGCC TGTTATTGTTCCCGGAAGTCCACCGGTCACTGTCCCGGGCTCAACTGCAA CTCAGAAACTTCTCAGGACTGACAAACTGGAGGTATGCAGGGAGTTCCAG CGAGGAAACTGTGCCCGGGGAGAGACCGACTGCCGCTTTGCACACCCCGC AGACAGCACCATGATCGACACAAGTGACAACACCGTAACCGTTTGTATGG ATTACATAAAGGGGCGTTGCATGAGGGAGAAATGCAAATATTTTCACCCT CCTGCACACTTGCAGGCCAAAATCAAAGCTGCGCAGCACCAAGCCAACCA AGCTGCGGTGGCCGCCCAGGCAGCCGCGGCCGCGGCCACAGTCATGTAAT GA V5-MBNL2protein_(SEQIDNO:10,V5-tagis underscored) MGKPIPNPLLGLDSTALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKF AHPPKSCQVENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNN LIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAP VTPGVGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRTDKLEVCREFQ RGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHP PAHLQAKIKAAQHQANQAAVAAQAAAAAATVM V5-MBNL3cDNA(SEQIDNO:11,V5-tagis underscored) ATGGGTAAGCCTATCCCTAACCCTCTCCTCGGTCTCGATTCTACGACGGC TGTCAATGTTGCCCTGATTCGTGATACCAAGTGGCTGACTTTAGAAGTCT GTAGAGAATTTCAGAGAGGAACTTGCTCTCGAGCTGATGCAGATTGCAAG TTTGCCCATCCACCAAGAGTTTGCCATGTGGAAAATGGTCGTGTGGTGGC CTGTTTTGATTCTCTAAAGGGTCGGTGTACCCGAGAGAACTGCAAGTACC TTCACCCTCCTCCACACTTAAAAACGCAGCTGGAGATTAATGGGCGGAAC AATCTGATTCAACAGAAGACTGCCGCAGCCATGTTCGCCCAGCAGATGCA GCTTATGCTCCAAAACGCTCAAATGTCATCACTTGGTTCTTTTCCTATGA CTCCATCAATTCCAGCTAATCCTCCCATGGCTTTCAATCCTTACATACCA CATCCTGGGATGGGCCTCGTTCCTGCAGAACTTGTACCAAATACACCTGT TCTGATTCCTGGAAACCCACCTCTTGCAATGCCAGGAGCTGTTGGCCCAA AACTGATGCGTTCAGATAAACTGGAGGTTTGCCGAGAATTTCAGCGTGGA AATTGTACCCGTGGGGAGAATGATTGCCGCTATGCTCACCCTACTGATGC TTCCATGATTGAAGCGAGTGATAATACTGTGACAATCTGCATGGATTACA TCAAAGGTCGATGCTCGCGGGAGAAATGCAAGTACTTTCATCCTCCTGCA CACTTGCAAGCCAGACTCAAGGCAGCTCATCATCAGATGAACCATTCAGC TGCCTCTGCCATGTAATGA V5-MBNL3protein(SEQIDNO:12,V5-tagis underscored) MGKPIPNPLLGLDSTTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCK FAHPPRVCHVENGRVVACFDSLKGRCTRENCKYLHPPPHLKTQLEINGRN NLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIP HPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRG NCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPA HLQARLKAAHHQMNHSAASAM
Cell Culture and Transfection
(71) Neuro-2a cells were grown in monolayer cultures in 12 well plates in Eagle's Minimum Essential Medium (Invitrogen) supplemented with 10% fetal bovine serum at 37 C. in a humidified CO.sub.2 (5%) incubator. Cells grown to 70% confluence were transiently co-transfected with 0.5 g of Tau minigene plasmid DNA and 0.5 g of MBNL plasmid DNA in triplicate, using JetPRIME transfection reagent (Polyplus-transfection) according to the manufacturer's instructions.
(72) In Vivo Gene Transfer
(73) HSA-LR mice were obtained from C. Thornton and control FVB mice from Janvier. All mouse procedures were done according to experimental protocols approved by the Ethic Committee on Animal Resources at the Centre d'Exploration Fonctionnelle of Pitie-Salpetriere animal facility and under appropriate biological containment. AAV9 vectors were obtained as previously described (Fugier et al. 2011) and stored frozen at 80 C. The Gastrocnemius muscle of adult HSA-LR mice were injected with 100 l of physiological solution containing or not AAV vectors. For each mouse, one muscle was injected with AAV constructs and the contralateral muscle was injected with saline vehicle alone. Five weeks after injection, muscles were collected, snap-frozen and stored at 80 C.
(74) RNA Extraction and RT-PCR
(75) Total RNA was isolated using a total RNA extraction kit (Nucleospin RNA II kit, Macherey Nagel) or TRIzol reagent (Invitrogen) according to the manufacturer's protocol. RNA concentration was determined by measuring the absorbance at 260 nm by using the Nanodrop (Labtech). RT-PCR was performed using 1 g of total RNA using random hexamers and the M-MLV reverse transcriptase (Invitrogen) according to standard protocols. No DNA amplification was observed in the RT controls. PCR was carried out as previously described. The reaction products were resolved by electrophoresis using a 5% or 8% polyacrylamide gel, and bands were stained with SYBR Gold (Invitrogen). The intensity of SYBR Gold luminescence was measured using a FluoroImager scanner (Claravision).
(76) Statistical Analyses
(77) Statistical analyses were performed using unpaired t-test with two tails P values, with the help of Prism 6 Software (GraphPad Software Inc.).
Results
(78) 1) Experiments with MBNL1CT3 (CT3)
(79) In a previous study focused on binding-affinity and splicing activity of the different MBNL1 isoforms, we showed that truncated MBNL1 construct lacking the C-terminal domain (CT3,
(80) To confirm that CT3 can bind to CUG repeats and compete with MBNL1 binding, recombinant MBNL1 protein was cross-linked to in vitro transcribed .sup.32P RNA containing 95 CUG repeats in the absence or presence of growing concentrations of recombinant CT3 protein, or vise-et-versa (
(81) To assess if CT3 can interact with CUGexp-RNA in DM1 cells and modulate DM1 molecular features as alternative splicing misregulation, human primary muscle cell cultures of DM1 and non-DM1 patients were transduced or not with lentiviral vectors expressing either GFP-CT3 or GFP. As shown in
(82) The capacity of CT3 to neutralize in vivo the RNA toxicity induced by the expanded CUG repeats was next tested in the DM1 mouse model (HSA-LR) expressing 220 CTG in the 3UTR of the human skeletal actin gene (Mankodi et al. 2000). These mice accumulate CUGexp-RNA in the nuclei of their skeletal muscle fibers and display missplicing events as well as myotonia. Gastrocnemius (GAS) muscle of HSA-LR mice was injected intramuscularly with AAV9-GFP-CT3 vectors whereas contralateral GAS was injected with saline solution. After 6 weeks, the contraction properties of these muscles were measured in situ, mice were thereafter sacrificed and the muscles were taken for histological and biochemical analysis. Among the splicing changes in the HSA-LR mice that are similar to those observed in DM1 patients, we examined the splicing misregulation of Serca1, Mbnl1 and Clc-1. As showed in
(83) At the physiological level, it has been established that myotonia observed in this DM1 mouse model results from abnormal splicing of muscle-specific chloride channel Clc-1 exon 7a (Wheeler et al. 2007). Myotonia that is characterized by muscle hyperexcitability that leads to persistent electrical discharges and delayed force relaxation. Since Clc-1 exon 7a missplicing was almost completely normalized by CT3 expression, its effect on muscle force relaxation was determined after induced-contraction (
(84) Since MBNL2 is also able to bind to expanded CUG repeats leading to its sequestration, we examined whether splicing changes related to MBNL2 deficiency can be corrected by CT3. As shown in
(85) 2) Experiments with MBNL1CT3, MBNL2 and MBNL3
(86) The inventors have also tested the effect of other modified constructs, MBNL2 and MBNL3, respectively engineered from MBNL2 and MBNL3 paralogs rather than MBNL1.
(87) MBNL1, MBNL2 and MBNM3 are paralogs from the same RNA binding protein family sharing similar YGCY binding properties. As engineered for the MBNLCT3 construct (CT3), C-terminus domains of MBNL2 and MBNL3 were truncated and only the N-terminus part containing the 4 zinc-fingers was conserved in MBNL2 and MBNL3 constructs. Splicing activity of MBNL2 was assessed in vitro using the hTau exon10 minigene. As observed in
(88) Experimental data presented in
Discussion
(89) In this study we provided evidences that non-functional MBNL (CT3), which is almost devoid of splicing activity is effective to counteract CUGexp-RNA toxicity both in vitro and in vivo. Thus, intramuscular administration of AAV vectors expressing CT3 proteins corrects both alternative splicing misregulation and myotonia in DM1 mice. CT3 expressing only the RNA-binding domain of MBNL1 interacts with the pathogenic CUG repeats and releases sequestered MBNL1 from the nuclear CUGexp-RNA foci. This mechanism restores endogenous functional MBNL1 in DM1 muscle cells and corrects DM1-associated phenotypes in vivo. This finding supports the development of a modified, non-functional MBNL gene therapy approach as an alternate or complementary therapeutic approach for DM1.
(90) Based on the ability of MBNL to bind to expanded CUG repeats with high affinity, we propose to use MBNL1 RNA-binding domain as a bait to block deleterious interaction of poly-CUG binding proteins to pathogenic repeats. To test this hypothesis, we generated a modified, non-functional MBNL (CT3) that contains only the MBNL1 RNA-binding domain and lacks the C-terminal domains encoded by exons 5 to 10 that are responsible for MBNL1 splicing regulatory activity, MBNL nucleocytoplasmic shuttling and most possibly MBNL oligomerisation (Tran et al. 2011). Our results confirm that CT3 maintains its ability to bind to CUG repeats and colocalizes with CUGexp-RNA in muscle cells, both in vitro and in vivo. As shown by in vitro crosslink assay, CT3 displaces MBNL1 from expanded CUG tracts suggesting that in vivo the binding of CT3 to pathogenic DM1 repeats is able either to block deleterious interaction of MBNL1 as well as other unidentified poly-CUG binding proteins or displace sequestered MBNL1 from the nuclear CUGexp-RNA foci. As a consequence, release of functional MBNL1 will reverse DM1-misregulated events.
(91) Normalization of alternative splicing misregulation by CT3 either in DM1 muscle cells or in skeletal muscle of DM1 mice supports the ability of CT3 to target pathogenic CUG repeats and block access to endogenous MBNL1. However, since in vitro assays have showed that YGCY binding property of CT3 are similar or slightly lower than MBNL1, we wondered whether CT3 is able to directly modulate the MBNL1-regulated events. This seems unlike because splicing activity of CT3 due to the lack of MBNL1 exon 5 to 10 is dramatically reduced when compared to MBNL1 using an in vitro minigene assay, and similar results were obtained with a CT3-NES construct that has no splicing activity due to its strong nuclear export signal. But above all, no splicing changes were detected in wt mice or control human cells expressing CT3. Rather, our results argue in favor of a release of endogenous MBNL1 from the nuclear CUG-exp-RNA foci in muscle cells expressing CT3 that restore functional MBNL1 endogenous activity. While MBNL1 is sequestered and colocalized with CUGexp-RNA foci in control HSA-LR mice, its localization is less associated with the nuclear foci than CT3 in HSA-LR injected mice. Sequestration of CT3 by CUGexp-RNA displaces endogenous MBNL1 from these abnormal structures resulting in the correction of MBNL1-misregulated events in the DM1 mice.
(92) Our AAV-CT3 strategy is the first gene therapy approach that target CUGexp-RNA to inhibit deleterious of poly-CUG binding proteins and correct their toxic effects in vivo. To date MBNL proteins are almost the only proteins in DM1 human tissue samples that were found sequestered in nuclear foci, and recently, splicing abnormalities present in affected muscles of DM1 patients were mainly associated to functional loss of MBNL1 (Nakamori et al. 2013). Depletion of functional MBNL splicing factors due to their abnormal binding and sequestration by CUGexp-RNA leads to alternative splicing misregulation of specific subset of transcripts and ultimately to pathological changes in DM1 tissues. Thus MBNL1-regulated events were associated to DM1 skeletal muscle defects whereas MBNL2-regulated events were misregulated in DM1 brain. In addition, overexpression of functional MBNL1 (isoforms-40 and -41) using AAV vectors is sufficient to reverse missplicing and myotonia in DM1 mice as confirmed by doubly transgenic HSA-LR:MBNL1-OE mice (Kanadia et al. 2006; Chamberlain and Ranum 2012). This strategy of functional MBNL1 overexpression compensates for the loss of MBNL1 in DM1 mice cells by increasing artificially the level of functional MBNL1. Thus MBNL1 isoforms-40 and -41 were successfully overexpressed in muscles however up to 10 different MBNL1 isoforms with various expression profiles and tissue-specific patterns were described. The function of different isoforms is not completely established yet as showed by the recent report indicating that MBNL1 isoform-43 can interact with Src family kinase (Wang et al. 2012; Botta et al. 2013). In addition, MBNL1 that regulates alternative splicing events is also involved in other RNA processes like mRNA decay and miRNA biogenesis (Rau et al. 2011; Masuda et al. 2012). CT3 that targets CUGexp-RNA will circumvent the question of which isoform of MBNL1 should be overexpressed since sequestered endogenous MBNL1 proteins are released in a tissue-specific manner. Moreover, missplicing of MBNL1 it-self that changes the MBNL1 isoforms ratio in DM1 tissues is corrected in the muscle tissue of DM1 mice expressing CT3. Besides it is not known whether MBNL1 overexpression can restore or compensate for the loss of other MBNL paralogues such as MBNL2. We can presume that CT3 will release other MBNL proteins from CUGexp-RNA and correct MBNL-misspliced events in other tissues than skeletal muscle. Our in vitro results indicate that CT3 is most probably able to compensate for the loss of MBNL2 in a DM1 context (
(93) Among the therapeutic approaches currently under development for DM1, various modified oligonucleotides or small compounds targeting the mutant CUGexp-RNAs have shown promising beneficial effects in vivo (Mulders et al. 2009; Warf et al. 2009; Wheeler et al. 2009; Garcia-Lopez et al. 2011; Sobczak et al. 2012; Wheeler et al. 2012; Leger et al. 2013). Most of these strategies that reverse the muscle phenotype of DM1 mice share a common feature: release of sequestered MBNL paralogues from the CUGexp-RNA foci that leads to its cellular redistribution/relocalization and restores functional MBNL paralogues, resulting ultimately to correction of DM1-associated phenotypes. This mechanism was described for strategies that cause either degradation of the CUGexp-RNAs or steric block of the expanded CUG repeats. Here we propose a novel AAV-CT3 gene therapy for DM1. A single injection of AAV-CT3 was efficient to neutralize RNA toxicity in DM1 mice. In contrast to synthetic oligonucleotides or small compounds that require repeated treatments, AAV vectors have been shown to persist several years in muscles (Rivera et al. 2005) allowing permanent expression of non-functional CT3 that can counteract the continuous expression of toxic CUGexp RNA and trigger a long-lasting effect. Thus, we propose this new gene therapy approach as a valuable alternate or complementary therapeutic approach for DM1.
(94) In addition, the present inventors have demonstrated that other modified constructs, MBNL2 and MBNL3, respectively engineered from MBNL2 and MBNL3 paralogs correct splicing defects in a DM1 mouse model in an extent similar to that of the aforementioned MBNL1CT3 construct.
(95) Thus, these data demonstrate that constructs derived from either MBNL1, MBNL2 or MBNL3, having an YGCY binding property and having a reduced splicing activity may be used as a new gene therapy approach for DM1.
REFERENCES
(96) Botta, A., A. Malena, et al. (2013). MBNL142 and MBNL143 gene isoforms, overexpressed in DM1-patient muscle, encode for nuclear proteins interacting with Src family kinases. Cell Death Dis 4: e770. Brook, J. D., M. E. McCurrach, et al. (1992). Molecular basis of myotonic dystrophy: expansion of a trinucleotide (CTG) repeat at the 3 end of a transcript encoding a protein kinase family member. Cell 69(2): 385. Chamberlain, C. M. and L. P. Ranum (2012). Mouse model of muscleblind-like 1 overexpression: skeletal muscle effects and therapeutic promise. Hum Mol Genet 21(21): 4645-54. Charizanis, K., K. Y. Lee, et al. Muscleblind-like 2-mediated alternative splicing in the developing brain and dysregulation in myotonic dystrophy. Neuron 75(3): 437-50. Charlet, B. N., R. S. Savkur, et al. (2002). Loss of the muscle-specific chloride channel in type 1 myotonic dystrophy due to misregulated alternative splicing. Mol Cell 10(1): 45-53. Caillierez R, Bgard S, et al. (2013). Lentiviral delivery of the human wild-type tau protein mediates a slow and progressive neurodegenerative tau pathology in the rat brain. Mol Ther. (7):1358-68. Carpentier C, Ghanem D, et al. (2014). Tau exon 2 responsive elements deregulated in myotonic dystrophy type I are proximal to exon 2 and synergistically regulated by MBNL1 and MBNL2. Biochim Biophys Acta. 1842(4):654-664. Du, H., M. S. Cline, et al. (2010). Aberrant alternative splicing and extracellular matrix gene expression in mouse models of myotonic dystrophy. Nat Struct Mol Biol 17(2): 187-93. Fardaei, M., K. Larkin, et al. (2001). In vivo co-localisation of MBNL protein with DMPK expanded-repeat transcripts. Nucleic Acids Res 29(13): 2766-71. Fischer, U., J. Huber, et al. (1995). The HIV-1 Rev activation domain is a nuclear export signal that accesses an export pathway used by specific cellular RNAs. Cell 82(3): 475-83. Francois, V., A. F. Klein, et al. (2011). Selective silencing of mutated mRNAs in DM1 by using modified hU7-snRNAs. Nat Struct Mol Biol 18(1): 85-7. Fugier, C., A. F. Klein, et al. (2011). Misregulated alternative splicing of BIN1 is associated with T tubule alterations and muscle weakness in myotonic dystrophy. Nat Med 17(6): 720-5. Furling. D, L. Coiffier, et al (2001). Defective satellite cells in congenital myotonic dystrophy Human Molecular Genetics 10 (19): 2079-87 Garcia-Lopez, A., B. Llamusi, et al. (2011). In vivo discovery of a peptide that prevents CUG-RNA hairpin formation and reverses RNA toxicity in myotonic dystrophy models. Proc Natl Acad Sci U S A 108(29): 11866-71. Harper, P. S. (2001). Myotonic dystrophy Third Edn., W.B. Saunder, London. Holt, I., V. Jacquemin, et al. (2009). Muscleblind-like proteins: similarities and differences in normal and myotonic dystrophy muscle. Am J Pathol 174(1): 216-27. Hunter, A., C. Tsilfidis, et al. (1992). The correlation of age of onset with CTG trinucleotide repeat amplification in myotonic dystrophy. J Med Genet 29(11): 774-9. Kanadia, R. N., K. A. Johnstone, et al. (2003). A muscleblind knockout model for myotonic dystrophy. Science 302(5652): 1978-80. Kanadia, R. N., J. Shin, et al. (2006). Reversal of RNA missplicing and myotonia after muscleblind overexpression in a mouse poly(CUG) model for myotonic dystrophy. Proc Natl Acad Sci U S A 103(31): 11748-53. Klein, A. F., E. Gasnier, et al. (2011). Gain of RNA function in pathological cases: Focus on myotonic dystrophy. Biochimie 93(11): 2006-12. Laurent F X, Sureau A, et al. (2012). New function for the RNA helicase p68/DDX5 as a modifier of MBNL1 activity on expanded CUG repeats. Nucleic Acids Res. 40(7):3159-71. Leger, A. J., L. M. Mosquea, et al. (2013). Systemic delivery of a Peptide-linked morpholino oligonucleotide neutralizes mutant RNA toxicity in a mouse model of myotonic dystrophy. Nucleic Acid Ther 23(2): 109-17. Lin, X., J. W. Miller, et al. (2006). Failure of MBNL1-dependent post-natal splicing transitions in myotonic dystrophy. Hum Mol Genet 15(13): 2087-97. Mankodi, A., E. Logigian, et al. (2000). Myotonic dystrophy in transgenic mice expressing an expanded CUG repeat. Science 289(5485): 1769-73. Mankodi, A., M. P. Takahashi, et al. (2002). Expanded CUG repeats trigger aberrant splicing of ClC-1 chloride channel pre-mRNA and hyperexcitability of skeletal muscle in myotonic dystrophy. Mol Cell 10(1): 35-44. Masuda, A., H. S. Andersen, et al. (2012). CUGBP1 and MBNL1 preferentially bind to 3 UTRs and facilitate mRNA decay. Sci Rep 2: 209. Miller, J. W., C. R. Urbinati, et al. (2000). Recruitment of human muscleblind proteins to (CUG)(n) expansions associated with myotonic dystrophy. EMBO J 19(17): 4439-48. Mouisel, E., B. Blondet, et al. (2006). Outcome of acetylcholinesterase deficiency for neuromuscular functioning. Neurosci Res 55(4): 389-96. Mulders, S. A., W. J. van den Broek, et al. (2009). Triplet-repeat oligonucleotide-mediated reversal of RNA toxicity in myotonic dystrophy. Proc Natl Acad Sci U S A 106(33): 13915-20. Nakamori, M., K. Sobczak, et al. (2013). Splicing biomarkers of disease severity in myotonic dystrophy. Ann Neurol. Pascual, M., M. Vicente, et al. (2006). The Muscleblind family of proteins: an emerging class of regulators of developmentally programmed alternative splicing. Differentiation 74(2-3): 65-80. Ranum, L. P. and T. A. Cooper (2006). RNA-mediated neuromuscular disorders. Annu Rev Neurosci 29: 259-77. Rau, F., F. Freyermuth, et al. (2011). Misregulation of miR-1 processing is associated with heart defects in myotonic dystrophy. Nat Struct Mol Biol 18(7): 840-5. Rivera, V. M., G. P. Gao, et al. (2005). Long-term pharmacologically regulated expression of erythropoietin in primates following AAV-mediated gene transfer. Blood 105(4): 1424-30. Savkur, R. S., A. V. Philips, et al. (2001). Aberrant regulation of insulin receptor alternative splicing is associated with insulin resistance in myotonic dystrophy. Nat Genet 29(1): 40-7. Sobczak, K., T. M. Wheeler, et al. (2012). RNA interference targeting CUG repeats in a mouse model of myotonic dystrophy. Mol Ther 21(2): 380-7. Taneja, K. L., M. McCurrach, et al. (1995). Foci of trinucleotide repeat transcripts in nuclei of myotonic dystrophy cells and tissues. J Cell Biol 128(6): 995-1002. Tran, H., N. Gourrier, et al. (2011). Analysis of exonic regions involved in nuclear localization, splicing activity, and dimerization of Muscleblind-like-1 isoforms. J Biol Chem 286(18): 16435-46. Tsilfidis, C., A. E. MacKenzie, et al. (1992). Correlation between CTG trinucleotide repeat length and frequency of severe congenital myotonic dystrophy. Nat Genet 1(3): 192-5. Wang, E. T., N. A. Cody, et al. (2012). Transcriptome-wide regulation of pre-mRNA splicing and mRNA localization by muscleblind proteins. Cell 150(4): 710-24. Warf, M. B., M. Nakamori, et al. (2009). Pentamidine reverses the splicing defects associated with myotonic dystrophy. Proc Natl Acad Sci U S A 106(44): 18551-6. Wheeler, T. M., A. J. Leger, et al. (2012). Targeting nuclear RNA for in vivo correction of myotonic dystrophy. Nature 488(7409): 111-5. Wheeler, T. M., J. D. Lueck, et al. (2007). Correction of ClC-1 splicing eliminates chloride channelopathy and myotonia in mouse models of myotonic dystrophy. J Clin Invest 117(12): 3952-7. Wheeler, T. M., K. Sobczak, et al. (2009). Reversal of RNA dominance by displacement of protein sequestered on triplet repeat RNA. Science 325(5938): 336-9.