ANTI-LAG3 MONOCLONAL ANTIBODY, AND PREPARATION METHOD THEREFOR AND USE THEREOF

20230074657 · 2023-03-09

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided in the present invention are an anti-LAG3 monoclonal antibody and the use thereof. Further provided are a nucleotide molecule for encoding the antibody, an expression vector and a host cell for expressing the antibody, a composition containing the antibody, and the use of the antibody in the preparation of drugs for resisting tumors, treating autoimmune diseases, and treating infectious diseases and/or resisting transplantation rejection reactions.

    Claims

    1. An anti-LAG3 monoclonal antibody, wherein the anti-LAG3 monoclonal antibody comprises a heavy chain variable region comprising HCDR1, HCDR2 and HCDR3 identical to CDR sequences of the heavy chain variable region as shown in SEQ ID NO: 2, 6 or 10, and a light chain variable region comprising LCDR1, LCDR2 and LCDR3 identical to CDR sequences of the light chain variable region as shown in SEQ ID NO: 4, 8 or 12.

    2. The anti-LAG3 monoclonal antibody of claim 1, wherein the anti-LAG3 monoclonal antibody comprises: 1) heavy chain complementarity determining regions: HCDR1 having an amino acid sequence as shown in SEQ ID No: 18, HCDR2 having an amino acid sequence as shown in SEQ ID No: 19, and HCDR3 having an amino acid sequence as shown in SEQ ID No: 20 or 21; and 2) light chain complementarity determining regions: LCDR1 having an amino acid sequence as shown in SEQ ID No: 22 or 23, LCDR2 having an amino acid sequence as shown in SEQ ID No: 24, and LCDR3 having an amino acid sequence as shown in SEQ ID No: 25.

    3. The anti-LAG3 monoclonal antibody of claim 2, wherein the anti-LAG3 monoclonal antibody comprises a heavy chain variable region having an amino acid sequence as shown in SEQ ID NO: 2, 6 or 10, or a sequence with at least 85% homology thereto; and a light chain variable region having an amino acid sequence as shown in SEQ ID NO: 4, 8 or 12, or a sequence with at least 85% homology thereto.

    4. The anti-LAG3 monoclonal antibody of claim 2, wherein the anti-LAG3 monoclonal antibody comprises a heavy chain composed of a heavy chain variable region having an amino acid sequence as shown in SEQ ID NO: 2, 6 or 10, or a sequence with at least 85% homology thereto, and a heavy chain constant region as shown in SEQ ID NO: 14; and a light chain composed of a light chain variable region having an amino acid sequence as shown in SEQ ID NO: 4, 8 or 12, or a sequence with at least 85% homology thereto, and a light chain constant region as shown in SEQ ID NO: 16.

    5. The anti-LAG3 monoclonal antibody of claim 1, wherein the anti-LAG3 monoclonal antibody is a full-length sequence of the antibody or an antigen-binding fragment comprising the anti-LAG3 antibody, wherein the antigen-binding fragment of the anti-LAG3 antibody is Fab, Fab′, F(ab′)2, Fv or scFv.

    6. A nucleotide molecule, wherein the nucleotide molecule encodes the anti-LAG3 monoclonal antibody of claim 1.

    7. The nucleotide molecule of claim 6, wherein in the nucleotide molecule, the nucleotide sequence encoding the heavy chain variable region of the anti-LAG3 monoclonal antibody is as shown in SEQ ID NO: 3, 7 or 11, and the nucleotide sequence encoding the light chain variable region of the anti-LAG3 monoclonal antibody is as shown in SEQ ID NO: 5, 9 or 13.

    8. An expression vector, wherein the expression vector contains the nucleotide molecule of claim 6.

    9. The expression vector of claim 8, wherein the expression vector is selected from one or more of pHLX101, pEE14.4, pCHO 1.0 or pcDNA3.1.

    10. A host cell, wherein the host cell contains the expression vector of claim 8.

    11. The host cell of claim 10, wherein the host cell is selected from one or more of COS, CHO, an HeLa cell line, a myeloid cell line such as an SP2/0 cell line, NS0, sf9, sf21, DH5α, BL21(DE3) or E. coli TG1, a YB2/0 cell line and a transformed B cell or a hybridoma cell.

    12. A method for preparing the anti-LAG3 monoclonal antibody of claim 1, comprising the following steps: a) culturing a host cell containing an expression vector containing a nucleotide molecule encoding the anti-LAG3 monoclonal antibody of claim 1 to express the anti-LAG3 monoclonal antibody under an expression condition; and b) isolating and purifying the anti-LAG3 monoclonal antibody obtained in step a).

    13. A composition, wherein the composition comprises the anti-LAG3 monoclonal antibody of claim 1 and a pharmaceutically acceptable carrier.

    14. A method for resisting tumors, treating autoimmune diseases, and treating infectious diseases and/or resisting transplantation rejection reactions, comprising administering the anti-LAG3 monoclonal antibody of claim 1 or a composition comprising the anti-LAG3 monoclonal antibody of claim 1.

    15. The method of claim 14, wherein the anti-LAG3 monoclonal antibody is administered alone or in combination with a drug for resisting tumors selected from an antibody drug and a small-molecule drug for resisting tumors.

    16. A method of resisting tumors, treating autoimmune diseases, and treating infectious diseases and/or resisting transplantation rejection reactions, comprising administering the composition of claim 13.

    17. The method of claim 14, the composition further comprises a drug for resisting tumors selected from an antibody drug and a small-molecule drug for resisting tumors.

    18. The method of claim 15, wherein the antibody drug is an anti-PD-1 monoclonal antibody.

    19. The method of claim 15, wherein the small-molecule drug is paclitaxel or 5-fluorouracil.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0061] FIG. 1 shows experimental results of binding ability of the anti-LAG3 antibody to LAG3 on the cell surface.

    [0062] FIG. 2 shows experimental results of the anti-LAG3 antibody blocking the binding of LAG3 to the ligand WIC II thereof.

    [0063] FIG. 3 shows experimental results of binding ability of the anti-LAG3 chimeric antibody to LAG3.

    [0064] FIG. 4 shows experimental results of binding ability of the anti-LAG3 chimeric antibody to LAG3 on the cell surface.

    [0065] FIG. 5 shows experimental results of binding ability of the anti-LAG3 humanized antibody to LAG3.

    [0066] FIG. 6 shows experimental results of binding ability of the anti-LAG3 humanized antibody to LAG3 on the cell surface.

    [0067] FIG. 7 shows surface plasmon resonance experimental results of affinity of the anti-LAG3 humanized antibody for LAG3.

    [0068] FIG. 8 shows experimental results of the anti-LAG3 humanized antibody blocking the binding of LAG3 to the ligand WIC II thereof.

    [0069] FIG. 9 shows experimental results of the anti-LAG3 humanized antibody blocking the binding of LAG3 to the ligand LSECtin thereof.

    [0070] FIG. 10 shows experimental results of the anti-LAG3 humanized antibody blocking the binding of LAG3 to the ligand FGL1 thereof.

    [0071] FIG. 11 shows ELISA experimental results of species cross-reactivity of the anti-LAG3 humanized antibody.

    [0072] FIG. 12 shows flow cytometry experimental results of species cross-reactivity of the anti-LAG3 humanized antibody.

    [0073] FIG. 13 shows surface plasmon resonance experimental results of species cross-reactivity of the anti-LAG3 humanized antibody.

    [0074] FIG. 14 shows experimental results of T cell activation by the anti-LAG3 humanized antibody.

    [0075] FIG. 15 shows experimental results of tumor growth inhibition in the hLAG3 KI mouse model by the anti-LAG3 humanized antibody.

    [0076] FIG. 16 shows that h6H11B10#40 is administered in combination with HLX10 to activate the release of IL-2.

    [0077] FIG. 17 shows that h6H11B10#40 is administered in combination with HLX10 to activate the release of IFN-γ.

    [0078] FIG. 18 shows the growth curve of the tumor volume in each group of mice in the MC38 model.

    [0079] Notes: data is expressed as “mean±standard error”.

    [0080] FIG. 19 shows the growth curve of the tumor volume in each group of mice in the A20 model.

    [0081] Notes: 1. data is expressed as “mean±standard error”.

    DETAILED DESCRIPTION OF EMBODIMENTS

    [0082] The present invention is further illustrated by way of examples below; however, the present invention is not limited to the scope of the described examples. For the experimental methods in which no specific conditions are specified in the examples, selections are made according to conventional methods and conditions or according to the product instructions. The room temperature described in the examples is a conventional room temperature in the art, generally 10° C.-30° C. Unless otherwise specified, the reagents and raw materials used are commercially available.

    [0083] It should be understood that the scope of protection of the present invention is not limited to the following particular specific embodiments; and the terms used in the examples of the present invention are intended to describe the specific embodiments of the present invention, rather than limiting the scope of protection of the present invention. In the specification and claims of the present invention, unless otherwise clearly stated in the context, the singular forms “a”, “an”, and “the” include the plural forms.

    [0084] The term “variable region” of an antibody refers to a light chain variable region (VL) of an antibody or a heavy chain variable region (VH) of an antibody, either alone or in combination. As known in the art, each of the heavy and light chain variable regions consists of four framework regions (FRs) connected by three complementarity determining regions (CDRs) (also known as hypervariable regions). The CDRs in each chain are held together in close proximity by the FRs, and together with the CDRs from another chain contribute to the formation of the antigen-binding site of the antibody. There are at least two techniques for determining CDRs: (1) a method based on cross-species sequence variability (i.e., Kabat et al., Sequences of Proteins of Immunological Interest, 5th Edition, 1991, National Institutes of Health, Bethesda Md.); and (2) a method based on crystallographic studies of antigen-antibody complexes (Al-Lazikani et al., J. Molec. Biol. 273:927-948 (1997)). As used herein, CDRs may refer to those determined by either method or by a combination of the two methods.

    [0085] The term “antibody framework” or “FR region” refers to a moiety of the variable domain VL or VH, which serves as a scaffold for the antigen binding loops (CDRs) of the variable domain. Essentially, it is a variable domain without CDRs.

    [0086] The terms “complementarity determining region” and “CDR” refer to one of six hypervariable regions in the variable domain of an antibody that mainly contribute to antigen binding. Typically, there are three CDRs in each heavy chain variable region (CDR-H1, CDR-H2, and CDR-H3) and three CDRs in each light chain variable region (CDR-L1, CDR-L2, and CDR-L3). The amino acid sequence boundaries of CDRs can be determined using any of a variety of well-known schemes, including “Kabat” numbering rule (see Kabat et al. (1991), “Sequences of Proteins of Immunological Interest”, 5th Edition, Public Health Service, National Institutes of Health, Bethesda, Md.), “Chothia” numbering rule (Al-Lazikani et al. (1997), JMB 273:927-948), ImMunoGenTics (IMGT) numbering rule (Lefranc M. P., Immunologist, 7, 132-136 (1999); Lefranc, M. P. et al., Dev. Comp. Immunol., 27, 55-77 (2003)), etc. For example, for the classical format, following the Kabat rule, CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2) and 95-102 (HCDR3); and CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1), 50-56 (LCDR2) and 89-97 (LCDR3). Following the Chothia rule, CDR amino acids in VH are numbered 26-32 (HCDR1), 52-56 (HCDR2) and 95-102 (HCDR3); and amino acid residues in VL are numbered 26-32 (LCDR1), 50-52 (LCDR2) and 91-96 (LCDR3). By combining the CDR definitions of both Kabat and Chothia, CDRs consist of amino acid residues 26-35 (HCDR1), 50-65 (HCDR2) and 95-102 (HCDR3) in human VH and amino acid residues 24-34 (LCDR1), 50-56 (LCDR2) and 89-97 (LCDR3) in human VL. Following the IMGT rule, CDR amino acid residues in VH are numbered approximately 26-35 (HCDR1), 51-57 (HCDR2) and 93-102 (HCDR3); and CDR amino acid residues in VL are numbered approximately 27-32 (LCDR1), 50-52 (LCDR2) and 89-97 (LCDR3). Following the IMGT rule, the CDRs of an antibody can be determined using the program IMGT/DomainGap Align.

    [0087] The term “LAG3” refers to the lymphocyte activation gene-3 protein, an immune checkpoint receptor or T cell co-inhibitor, also known as CD223. The amino acid sequence of the full-length LAG3 is provided in GenBank under the accession number NP_002277.4. The term “ ” includes variants, isoforms, homologs, orthologs and paralogs, such as LAG3 protein variants, recombinant LAG3 or fragments thereof, and LAG3 or fragments thereof coupled to, for example, a histidine tag, mouse or human Fc or signal sequence (e.g., ROR1).

    [0088] When numerical ranges are given in the examples, unless otherwise indicated in the present invention, the two endpoints of each numerical range and any value between the two endpoints can be selected. Unless defined otherwise, all technical and scientific terms used in the present invention have the same meanings commonly understood by those skilled in the art. In addition to the specific methods, devices, and materials used in the examples, according to the knowledge in the prior art and the description of the present invention, those skilled in the art can also use any prior art methods, devices, and materials which are similar or equivalent to the methods, devices, and materials described in the examples of the present invention to realize the present invention.

    [0089] Unless otherwise specified, the experimental methods, detection methods and preparation methods disclosed in the present invention all use conventional molecular biology, biochemistry, chromatin structure and analysis, analytical chemistry, cell culture, recombinant DNA techniques in the art and other conventional techniques in related arts. The techniques have been completely described in existing documents. For details, reference can be made to: Sambrook et al., MOLECULAR CLONING: A LABORATORY MANUAL, Second edition, Cold Spring Harbor Laboratory Press, 1989 and Third edition, 2001; Ausubel et al., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, 1987 and periodic updates; the series METHODS IN ENZYMOLOGY, Academic Press, San Diego; Wolfe, CHROMATIN STRUCTURE AND FUNCTION, Third edition, Academic Press, San Diego, 1998; METHODS IN ENZYMOLOGY, Vol. 304, Chromatin (P. M. Wassarman and A. P. Wolffe, eds.), Academic Press, San Diego, 1999; and METHODS IN MOLECULAR BIOLOGY, Vol. 119, Chromatin Protocols (P. B. Becker, ed.) Humana Press, Totowa, 1999.

    [0090] Positive control antibody BMS986016: the amino acid sequence thereof is disclosed in the patent application WO 2015/042246 A1 of Bristol-Myers Squibb Company. In the present invention, the nucleotide sequence encoding the amino acid sequence is cloned into a pURO vector using a restriction endonuclease, and then the plasmid is transfected into CHO-S cells which are screened according to carbenicillin resistance to obtain a high-expression cell line. The cell line is expanded and cultured, the supernatant of the culture medium is collected, and the control antibody is obtained by a protein A affinity chromatography preparation process.

    [0091] Negative control HLX10 (h1G4): the sequence thereof is cited from CN109923126A.

    [0092] Positive control ab40465: Abcam, Cat. No. ab40465.

    [0093] Isotype—Human IgG4 (hIgG4): CrownBio, Cat: AB180018.

    [0094] Recombinant mouse LAG3-Fc fusion protein: purchased from Sino Biological, Cat: 53069-M02H.

    [0095] Recombinant cynomolgus monkey LAG3-Fc fusion protein: purchased from Sino Biological, Cat: 90841-C08H.

    [0096] Anti-mouse PD1 antibody RMP1-14: BioXCell, Cat: 71791801

    Example 1 Screening of the Anti-LAG3 Antibody

    [0097] In this example, mice are co-immunized with an LAG3-His protein (the amino acid sequence thereof as shown in SEQ ID No: 1) that is house-constructed, expressed and purified, and CHO-S cells expressing a full-length LAG3; spleen cells are fused with myeloma cells to obtain hybridoma cells, and then positive clones are screened using ELISA.

    [0098] Specifically, a nucleic acid sequence encoding amino acids 23-450 of the LAG3 extracellular region is firstly cloned into a pEE14.4 vector using a restriction endonuclease, wherein the nucleic acid sequence contains a sequence encoding 6×His-tag in the C-terminus of the LAG3 coding region, and then the plasmid is electroporated into CHO-S cells; monoclones with high expression of the LAG3-his fusion protein are screened out by a GS (Glutamine Synthetase) screening system, and expanded and cultured; the supernatant of the culture medium is collected, and the target protein is prepared by a nickel-column affinity chromatography method. Subsequently, mice are co-immunized with the protein and the CHO-S cells expressing the full-length LAG3. In the process of screening positive hybridomas, a 96-well half-well plate is firstly coated with an LAG3-His recombinant protein at 2 μg/ml (a working volume of 30 μl), and then coated overnight at 4° C. Excess LAG3-His is washed away by washing 3 times with PBS containing 0.05% Tween 20 (PBST). The plate is blocked with PBS containing 5% skimmed milk for 1 hour at room temperature. The plate is washed 3 times with PBST, and then the diluted hybridoma cell culture supernatant is added thereto; the reaction is allowed to stand for 1 hour at room temperature, and then the plate is washed 3 times with PBST; 30 μl of the horseradish peroxidase-labeled goat anti-mouse IgG secondary antibody (CoWin Biosciences) diluted with PBS is added to the plate, with a dilution ratio of 1:2000; and after standing at room temperature for 1 hour, the plate is washed 6 times with PBST, and TMB is added thereto for color development; and the reaction is stopped with 30 μl of 2M H2504. The light absorption at a wavelength of 450 nm is read with a microplate reader.

    [0099] The positive hybridoma clones expressing antibodies screened by ELISA are further determined by a flow cytometry method. First, the CHO-S cells expressing the full-length human LAG3 gene with normal growth are washed twice with PBS (2% FBS), and the cell concentration is adjusted to 5×10.sup.5/100 μl. A hybridoma supernatant is added and incubated at 4° C. for 30 min. The cells are centrifuged at 500×g for 5 min. No antibody is added to the negative control group. The cells are washed twice with PBS (2% FBS). 1:100 diluted goat anti-mouse IgG-FITC (CoWin Biosciences) is added, and incubated at 4° C. for 30 min. The cells are washed twice with PBS (2% FBS). The cells are suspended in 200 μl PBS and analyzed by flow cytometry. The results are shown in FIG. 1. Most of the positive clones screened by ELISA can bind to LAG3 on the cell surface.

    [0100] The ability of the antibodies expressed by the hybridoma positive clones screened by ELISA to block the binding of MHC II to LAG3-Fc (Acro) on the cell surface is tested by a flow cytometry method. Daudi cells are washed twice with PBS (2% FBS), and the cell concentration is adjusted to 3×10.sup.5/100 μl. The hybridoma supernatant is mixed with LAG3-Fc at a concentration of 2 μg/ml, then mixed with Daudi cells, and incubated at 4° C. for 30 min. The cells are centrifuged at 500×g for 5 min. Meanwhile, no antibody control is used as a negative control, and the anti-LAG3 antibody BMS986016 is used as a positive control. The cells are washed twice with PBS (2% FBS). 1:300 diluted goat anti-human IgG-Fc-FITC (Thermo) is added, and incubated at 4° C. for 30 min. The cells are washed twice with PBS (2% FBS). The cells are suspended in 200 μl PBS and analyzed by flow cytometry. The results are shown in FIG. 2. Finally, a plurality of monoclonal hybridoma cell lines with the ability to block the binding of MHC II to LAG3-Fc on the cell surface are obtained by screening, and the best monoclonal hybridoma cell line is 6H11B10. 6H11B10 comprises a heavy chain variable region having an amino acid sequence as shown in SEQ ID No: 2 and a nucleotide sequence as shown in SEQ ID No: 3; and a light chain variable region having an amino acid sequence as shown in SEQ ID No: 4 and a nucleotide sequence as shown in SEQ ID No: 5.

    Example 2 Determination of Affinity of the Anti-LAG3 Chimeric Antibody

    [0101] Amplification of mouse light and heavy chain variable regions is performed as described by Anke Krebber et al. (Journal of Immunological Methods 201.1997.35-55). The general method comprises preparing total RNA from the monoclonal hybridoma cell line 6H11B10, and preparing single-stranded cDNA using a reverse transcription kit (TaKaRa). The genes of the heavy chain variable region (SEQ ID No: 3) and the light chain variable region (SEQ ID No: 5) of the antibody are amplified by a PCR reaction using primers that can be complementary to and paired with the mouse light and heavy chain variable regions according to Anke Krebber et al. Then, the genes of the light and heavy chain variable regions of 6H11B10 are fused with those of the heavy chain constant region (SEQ ID No: 15) and the light chain constant region (SEQ ID No: 17) of IgG4, respectively, thereby obtaining the chimeric antibody heavy and light chain genes of 6H11B10.

    [0102] The chimeric antibody genes of 6H11B10 are respectively transfected into CHO-S cells and expressed to obtain the chimeric antibody protein c6H11B10. The affinity of the chimeric antibody for LAG3 is detected by an ELISA technique. An ELISA plate is coated with an LAG3-Fc recombinant protein at 2 μg/ml (a working volume of 30 μl), and allowed to stand overnight at 4° C. The plate is washed 3 times with PBS containing 0.05% Tween 20 (PBST). The plate is blocked with PBS containing 5% skimmed milk for 1 hour at room temperature. The plate is washed 3 times with PBST, followed by the addition of the gradient-diluted c6H11B10, and allowed to stand at room temperature for 1 hour. Meanwhile, BMS986016 is used as a positive control. The plate is washed 3 times with PBST, and 30 μl of 1:4000 diluted horseradish peroxidase-labeled goat anti-human IgG kappa light chain secondary antibody (Millipore) is added thereto, and the plate is allowed to stand at room temperature for 1 hour. The plate is washed 6 times with PBST, and TMB is added thereto for color development. The reaction is stopped with 2M H2504, and the plate is read at 450 nm with a microplate reader. The results are shown in FIG. 3. The anti-LAG3 chimeric antibody c6H11B10 has a strong affinity for LAG3, and at low concentrations, the affinity of c6H11B10 is higher than that of the control antibody BMS986016.

    Example 3 Determination of Affinity of the Anti-LAG3 Chimeric Antibody

    [0103] The affinity of the chimeric antibody protein c6H11B10 for LAG3 on the cell surface is determined by a flow cytometry method. The transfected Jurkat cells expressing the full-length human LAG3 gene are taken and washed twice with PBS (2% FBS), and the cell concentration is adjusted to 2×10.sup.5/100 μl. The gradient-diluted chimeric antibody c6H11B10 and the murine antibody m6H11B10 are added, and incubated at 4° C. for 30 min. The cells are centrifuged at 500×g for 5 min. Meanwhile, BMS986016 is used as a positive control. The cells are washed twice with PBS (2% FBS). For the chimeric antibody and BMS986016, 1:300 diluted goat anti-human IgG Fab-FITC (Thermo Fisher) is added; for the murine antibody, 1:100 diluted goat anti-mouse IgG-FITC (CoWin Biosciences) is added; and the mixtures are incubated at 4° C. for 30 min. The cells are washed twice with PBS (2% FBS). The cells are suspended in 200 μl PBS and analyzed by flow cytometry. The results are shown in FIG. 4. The chimeric antibody c6H11B10 has a strong binding to LAG3 on the cell surface, and the affinity of c6H11B10 is better than that of the control antibody BMS986016.

    Example 4 Humanization of the Anti-LAG3 Murine Antibody 6H11B10

    [0104] For the humanization of the murine antibody 6H11B10, the framework region in the murine antibody 6H11B10 is replaced with the human antibody light chain variable region germline gene IGKV2-28*01 and heavy chain variable region germline gene IGHV3-11*06, and the original complementarity determining regions (CDRs) are retained, thereby obtaining the anti-6H11B10 humanized antibody h6H11B10. h6H11B10 comprises a heavy chain variable region having an amino acid sequence as shown in SEQ ID No: 6, and a light chain variable region having an amino acid sequence as shown in SEQ ID No: 8. h6H11B10 comprises a heavy chain variable region having a gene sequence as shown in SEQ ID No: 7, and a light chain variable region having a gene sequence as shown in SEQ ID No: 9, which are respectively fused with the gene of the heavy chain constant region (SEQ ID No: 15) and the gene of the light chain constant region (SEQ ID No: 17) of IgG4, thereby obtaining the heavy and light chain genes of the anti-LAG3 humanized antibody h6H11B10. The three CDRs of the heavy chain of h6H11B10 are: HCDR1 (SEQ ID No: 18), HCDR2 (SEQ ID No: 19) and HCDR3 (SEQ ID No: 20), respectively; and the three CDRs of the light chain thereof are: LCDR1 (SEQ ID No:22), LCDR2 (SEQ ID No: 24) and LCDR3 (SEQ ID No: 25), respectively.

    [0105] The anti-LAG3 humanized antibody h6H11B10 is subjected to affinity maturation by a phage display technique, primers with point mutations are designed, and the light chain CDRs and heavy chain CDRs of h6H11B10 are respectively mutated by PCR to obtain a mutation library. The phage display vector is transformed into E. coli TG1 or SS320 cells to generate a phage library. The phage library is screened in two rounds using a streptavidin-coupled magnetic bead M-280 (Thermo Fisher) and a biotin-labeled LAG3 protein. Then, a clone with the highest affinity (h6H11B10#40) is screened out by ELISA. h6H11B10#40 comprises a heavy chain variable region having an amino acid sequence as shown in SEQ ID No: 10, and a light chain variable region having an amino acid sequence as shown in SEQ ID No: 12. h6H11B10#40 comprises a heavy chain variable region having a gene as shown in SEQ ID No: 11, and a light chain variable region having a gene as shown in SEQ ID No: 13, which are respectively fused with the gene of the heavy chain constant region (SEQ ID No: 15) and the gene of the light chain constant region (SEQ ID No: 17) of IgG4, thereby obtaining the heavy and light chain genes of the anti-LAG3 humanized antibody h6H11B10#40. The three CDRs of the heavy chain of h6H11B10#40 are: HCDR1 (SEQ ID No: 18), HCDR2 (SEQ ID No: 19) and HCDR3 (SEQ ID No: 21), respectively; and the three CDRs of the light chain thereof are: LCDR1 (SEQ ID No: 23), LCDR2 (SEQ ID No: 24) and LCDR3 (SEQ ID No: 25), respectively.

    Example 5 Determination of Affinity of the Anti-LAG3 Humanized Antibody for LAG3

    [0106] The genes of the anti-LAG3 humanized antibodies h6H11B10 and h6H11B10#40 are respectively transfected into CHO-S cells and expressed to obtain the antibody proteins h6H11B10 and h6H11B10#40. The affinity of the humanized antibody for LAG3 is detected by an ELISA technique. An ELISA plate is coated with an LAG3-Fc recombinant protein at 2 μg/ml (a working volume of 30 μl), and allowed to stand overnight at 4° C. The plate is washed 3 times with PBS containing 0.05% Tween 20 (PBST). The plate is blocked with PBS containing 5% skimmed milk for 1 hour at room temperature. The plate is washed 3 times with PBST, followed by the addition of the gradient-diluted humanized antibody proteins h6H11B10 and h6H11B10#40, and allowed to stand at room temperature for 1 hour. Meanwhile, BMS986016 is used as a positive control. The plate is washed 3 times with PBST, and 30 μl of 1:4000 diluted horseradish peroxidase-labeled goat anti-human IgG kappa light chain secondary antibody (Millipore) is added thereto, and the plate is allowed to stand at room temperature for 1 hour. The plate is washed 6 times with PBST, and TMB is added thereto for color development. The reaction is stopped with 2M H.sub.2SO.sub.4. The plate is read at 450 nm with a microplate reader. The results are shown in FIG. 5. The anti-LAG3 humanized antibodies have strong affinity for LAG3, among which, h6H11B10#40 is better than h6H11B10, and both are better than the positive control BMS986016.

    [0107] The binding of the humanized antibodies to LAG3 on the cell surface is determined by a flow cytometry method. The transfected CHO-S or Jurkat cells expressing the full-length human LAG3 gene are taken and washed twice with PBS (2% FBS), and the cell concentration is adjusted to 5×10.sup.5/100 μl. 1:3 gradient-diluted anti-LAG3 humanized antibody is added, and incubated at 4° C. for 30 min. Meanwhile, BMS986016 is used as a positive control. The cells are centrifuged at 500×g for 5 min. The cells are washed twice with PBS (2% FBS). 1:300 diluted goat anti-human IgG Fab-FITC (Thermo Fisher) is added, and incubated at 4° C. for 30 min. The cells are washed twice with PBS (2% FBS). The cells are suspended in 200 μl PBS and analyzed by flow cytometry. The results are shown in FIG. 6. The anti-LAG3 humanized antibodies have strong affinity for LAG3 on the cell membrane, and both h6H11B10#40 and h6H11B10 are better than the positive control BMS986016.

    [0108] Surface plasmon resonance (SPR) is used to measure the binding affinity and kinetic constants of the anti-LAG3 humanized antibody for the LAG3 protein. The LAG3-Fc protein is first immobilized on a chip, and then the anti-LAG3 humanized antibody h6H11B10#40 and BMS986016 are subjected to gradient dilution from 80 μg/ml to 2.5 μg/ml with an HBSPE buffer, and allowed to flow through the chip respectively. The data obtained from the experiments are analyzed using an evaluation software, and the curve is fitted with a 1:1 Langmuir binding model. The kinetic association and dissociation constants and calculated affinity constants (KDs) are shown in Table 1. The results are shown in FIG. 7. After affinity maturation, the affinity of the anti-LAG3 humanized antibody h6H11B10#40 for LAG3 is greatly improved, and the association and dissociation constants thereof are better than those of the positive control antibody BMS986016.

    TABLE-US-00001 TABLE 1 Samples ka (1/Ms) kd (1/s) KD (M) BMS986016 3.22E+04 2.04E−04 6.35E−09 h6H11B10#40 4.35E+04 1.37E−05 3.13E−10

    Example 6 Ability of the Anti-LAG3 Humanized Antibody to Block the Binding of LAG3 to the Ligand Thereof

    [0109] The ability of the anti-LAG3 humanized antibody to block the binding of MHC II to LAG3-Fc on the Raji cell surface is determined by a flow cytometry method. Raji cells are washed twice with PBS (2% FBS), and the cell concentration is adjusted to 2×10.sup.5/100 μl. The anti-LAG3 humanized antibody h6H11B10#40 is diluted according to a gradient of 1:3, then mixed with LAG3-Fc at a concentration of 2 μg/ml, and then the mixture is placed at room temperature for 30 min. Meanwhile, the hIgG4 protein is used as a negative control, and the anti-LAG3 antibody BMS986016 is used as a positive control. The mixture is then mixed with the Raji cells and incubated at 4° C. for 60 min. The cells are centrifuged at 500×g for 5 min. The cells are washed twice with PBS (2% FBS). 1:500 diluted goat anti-human IgG-Fc-Alexa Fluor 488 (Jackson) is added, and incubated at 4° C. for 60 min. The cells are washed twice with PBS (2% FBS). The cells are suspended in 200 μl PBS and analyzed by flow cytometry. The results are shown in FIG. 8. The anti-LAG3 humanized antibody h6H11B10#40 has the ability to block the binding of MHC II to LAG3-Fc on the cell surface, and has the ability similar to that of BMS986016.

    [0110] The ability of the humanized antibody to block the binding of LAG3-Fc to the ligand LSECtin thereof is detected by an ELISA technique. An ELISA plate is coated with an LAG3-Fc recombinant protein at 1 μg/ml (a working volume of 100 μl), and allowed to stand overnight at 4° C. The plate is washed 3 times with PBS containing 0.05% Tween 20 (PBST). The plate is blocked with PBS containing 5% skimmed milk for 1 hour at room temperature, and washed 3 times with PBST. The humanized antibody protein h6H11B10#40 is diluted according to a gradient of 1:5. Meanwhile, the hIgG4 protein is used as a negative control, and the anti-LAG3 antibody BMS986016 is used as a positive control. In addition, the LSECtin (R&D) is formulated into 1 μg/ml, mixed with the antibody at 1:1, and allowed to stand at room temperature for 30 min. Then the mixture is added to an ELISA plate and allowed to stand at room temperature for 1 hour. The plate is washed 3 times with PBST, and 100 μl of 1:5000 diluted horseradish peroxidase-labeled mouse anti-His-tag secondary antibody (GenScript) is added thereto, and the plate is allowed to stand at room temperature for 1 hour. The plate is washed 6 times with PBST, and TMB is added thereto for color development. The reaction is stopped with 2M H.sub.2SO.sub.4. The plate is read at 450 nm with a microplate reader. The results are shown in FIG. 9. The anti-LAG3 humanized antibody h6H11B10#40 has the ability to block the binding of LAG3-Fc to the ligand LSECtin thereof.

    Example 7 Ability of the Anti-LAG3 Humanized Antibody to Block the Binding of LAG3 to the Ligand Thereof

    [0111] The ability of the anti-LAG3 humanized antibody to block the binding of LAG3 to FGL1 is tested using a commercial kit for determination of the ability of the anti-LAG3 antibody to block the binding of LAG3 to FGL1 (purchased from Cisbio, Cat. No. 63ADK000CB10PEG). In this experiment, 4 μL of a Tag1-LAG3 protein and 4 μL of a Tag2-FGL1 protein are mixed with the test samples diluted at different concentrations. The mixture is reacted at room temperature for 15 minutes, and then 10 μL of pre-mixed anti-Tag1-Tb3+ and anti-Tag2-XL665 are added thereto. The test plate is sealed and reacted at room temperature overnight, and then the fluorescence absorption value at 665/620 nm is read with a microplate reader. The results are shown in FIG. 10. The anti-LAG3 humanized antibody h6H11B10#40 has the ability to block the binding of LAG3 to the ligand FGL1 thereof.

    Example 8 Species Cross-Reactivity of the Anti-LAG3 Humanized Antibody

    [0112] Recombinant mouse and cynomolgus monkey LAG3-Fc fusion proteins are purchased from Sino Biological. An ELISA plate is coated with an LAG3-Fc recombinant protein at 1 μg/ml (a working volume of 30 μl), and allowed to stand overnight at 4° C. The plate is washed 3 times with PBS containing 0.05% Tween 20 (PBST). The plate is blocked with PBS containing 5% skimmed milk for 1 hour at room temperature. The plate is washed 3 times with PBST, followed by the addition of the gradient-diluted anti-LAG3 humanized antibodies h6H11B10 and h6H11B10#40, and allowed to stand at room temperature for 1 hour. Meanwhile, BMS986016 is used as a positive control. The plate is washed 3 times with PBST, and 30 μl of 1:2000 diluted horseradish peroxidase-labeled goat anti-human IgG kappa light chain secondary antibody (millipore) is added thereto, and the plate is allowed to stand at room temperature for 1 hour. The plate is washed 6 times with PBST, and TMB is added thereto for color development. The reaction is stopped with 2M H.sub.2SO.sub.4. The plate is read at 450 nm with a microplate reader. As shown in FIG. 11, compared with BMS986016, the anti-LAG3 humanized antibodies h6H11B10 and h6H11B10#40 have higher affinity for cynomolgus monkey LAG3, while BMS986016 has lower affinity for cynomolgus monkey LAG3. Both BMS986016 and h6H11B10 have weak affinity for mouse LAG3 (not shown in the figure).

    [0113] The binding of the humanized antibodies to cynomolgus monkey LAG3 on the cell surface is determined by a flow cytometry method. The transfected CHO-S cells expressing the full-length cynomolgus monkey LAG3 gene are taken and washed twice with PBS (2% FBS), and the cell concentration is adjusted to 5×10.sup.5/100 μl. 1:3 gradient-diluted anti-LAG3 humanized antibody is added, and incubated at 4° C. for 30 min. Meanwhile, BMS986016 is used as a positive control. The cells are centrifuged at 500×g for 5 min. The cells are washed twice with PBS (2% FBS). 1:300 diluted goat anti-human IgG Fab-FITC (Thermo Fisher) is added, and incubated at 4° C. for 30 min. The cells are washed twice with PBS (2% FBS). The cells are suspended in 200 μl PBS and analyzed by flow cytometry. The results are shown in FIG. 12. The anti-LAG3 humanized antibodies h6H11B10#40 and h6H11B10 have strong affinity for cynomolgus monkey LAG3 on the cell membrane, and both h6H11B10#40 and h6H11B10 are better than the positive control BMS986016.

    [0114] Surface plasmon resonance (SPR) is used to measure the binding affinity and kinetic constants of the anti-LAG3 humanized antibody for the cynomolgus monkey LAG3 protein. The cynomolgus monkey LAG3-Fc protein is first immobilized on a chip, and then the anti-LAG3 humanized antibody h6H11B10#40 and BMS986016 are subjected to gradient dilution from 80 μg/ml to 2.5 μg/ml with an HBSPE buffer, and allowed to flow through the chip respectively. The data obtained from the experiments are analyzed using an evaluation software, and the curve is fitted with a 1:1 Langmuir binding model. The kinetic association and dissociation constants and calculated affinity constants (KDs) are shown in Table 2. The results are shown in FIG. 13. The anti-LAG3 humanized antibody h6H11B10#40 has high affinity for cynomolgus monkey LAG3.

    TABLE-US-00002 TABLE 2 Samples ka (1/Ms) kd (1/s) KD (M) h6H11B10#40 2.17E+04 3.09E−05 1.422E−09

    Example 9 Ability of T Cell Activation by the Anti-LAG3 Humanized Antibody

    [0115] Raji cells are taken and centrifuged at 500×g for 5 min, and the cell concentration is adjusted to 1.2×10.sup.6/ml. SEE (Toxin Technology) is added to a final concentration of 0.024 ng/ml and incubated at 37° C. for 30 min. Jurkat cells (Promega) transfected with LAG3 genes and NFAT-Luc reporter genes are taken and centrifuged at 500×g for 5 min, and the cell concentration is adjusted to 1.6×10.sup.6/ml. 25 μl of the anti-LAG3 humanized antibody diluted according to a gradient of 1:3 and 25 μl of BMS986016 (used as a positive control) are respectively taken and mixed with an equal volume of Jurkat cells, and then 25 μl of SEE-treated Raji cells are added thereto. The mixture is incubated at 37° C. for 6 hours. Bio-Glo (Promega) is added, and a multi-mode microplate reader is used for reading. The results are shown in FIG. 14. The anti-LAG3 humanized antibody activates Jurkat cells to express a luciferase, and the effect thereof is similar to that of BMS986016.

    Example 10 Inhibitory Activity of the Anti-LAG3 Humanized Antibody on Tumor Growth in the hLAG3 KI Mouse Model

    [0116] hLAG3 KI mice are used to detect the inhibitory ability of the anti-LAG3 humanized antibody on tumor cell growth in vivo. Mouse colon cancer cells M38 are inoculated subcutaneously on the back of the hLAG3 KI mice at 1×10.sup.6 cells per mouse. When the tumor volume reaches about 80-120 mm.sup.3, the intraperitoneal injection of the anti-mouse PD-1 antibody RMP1-14 (CrownBio) (at a dose of 0.5 mg/kg) and the anti-LAG3 humanized antibody h6H11B10#40 (available in two doses, 30 mg/kg and 10 mg/kg, respectively) is started, and is performed twice a week for approximately 2 to 3 weeks. Meanwhile, PBS is injected as a negative control, and the anti-mouse PD-1 antibody RMP1-14 and the anti-LAG3 antibody BMS986016 are injected as positive controls. The size of tumors formed in each mouse is observed twice a week. The tumor volume is calculated as: V (mm.sup.3)=0.5×(length (mm)×width (mm)×width (mm)). The results are shown in FIG. 15. Compared with the control group injected with PBS, injection of the anti-LAG3 antibody and the anti-mouse PD-1 antibody can significantly inhibit the tumor growth. In the high-dose group, h6H11B10#40 is used in combination with the anti-mouse PD-1 antibody, which has a better efficacy than that of an antibody alone.

    Example 11 Anti-LAG3 Antibody-Mediated Reactivation of Exhausted T Cells

    [0117] Human PBMC cells are centrifuged at 500 g for 10 min to remove the supernatant, washed twice with a culture buffer (RPMI-1640 medium+2% FBS), counted, resuspended with a stimulation buffer (RPMI-1640 culture medium+2% FBS+20 ng/mL SEB), and then inoculated into a 96-well cell culture plate (5×10.sup.5 cells/well). The plate is placed in a 37° C., 7% CO.sub.2 incubator for overnight culture and stimulation. The next day, the desired test samples are subjected to gradient dilution with a culture buffer. In IL-2 and IFN-γ test experiments, the test groups include: the constant-gradient-diluted h6H11B10#40 sample group (the highest test concentration being 10 μg/mL), and the constant-gradient-diluted HLX10 group (the highest test concentration being 10 μg/mL). In a combined administration group, h6H11B10#40 is diluted with an HLX10 solution at different concentrations (1 μg/mL, 0.1 μg/mL, 0.01 μg/mL and 0.001 μg/mL). The diluted test samples are successively added to the PBMC (which has been stimulated overnight), placed in a 37° C., 7% CO.sub.2 incubator, and incubated for another 2-3 days. The supernatant is taken, and the IL-2 and IFN-γ kits are used to determine the amount of IL-2 and IFN-γ released in each test group.

    [0118] As shown by data in FIGS. 16 and 17, the amount of IL-2 and IFN-γ in the group treated with h6H11B10#40 or HLX10 alone is lower. When the HLX10 reaches a concentration of about 1 μg/mL and is administered in combination with h6H11B10#40, the release amount of IL-2 and IFN-γ is higher than that of the h6H11B10#40 single agent group and the HLX10 single agent group. In a combined administration group (the HLX10 concentration being 1 μg/mL or 0.1 μg/mL), h6H11B10#40 shows a concentration-dependent effect. This in vitro experiment demonstrates that the combined administration of h6H11B10#40 and HLX10 can reactivate exhausted T cells and increase the release of cytokines.

    Example 12 Efficacy Evaluation in the hLAG-3/hPD-1 Transgenic Mice MC38 or A20 Subcutaneously Transplanted Tumor Model

    [0119] MC38 cells are cultured in a growth medium (RPMI-1640+10% FBS). Cells in logarithmic growth phase are collected before inoculation, and resuspended in PBS and Matrigel (0.1 mL/mouse) for subcutaneous inoculation of mice. The experimental mice to be inoculated are 6-8 weeks old, and MC38 cells (1×10.sup.6 cells/mouse) are subcutaneously inoculated on the posterior-lower part of the right back. When the average tumor volume is 78.03 mm.sup.3, the mice are randomly divided into groups according to tumor size. The coefficient of variation (CV) of tumor volume among each group is calculated with the formula CV=SD/MTV×100%, which should be less than 40%. The day of grouping is defined as day 0, and administration begins on day 0. The clinical symptoms observed during the experiment are all recorded in the raw data. The calculation formula of tumor volume is as follows: tumor volume (mm.sup.3)=1/2×(a×b.sup.2) (wherein, a represents the long diameter, and b represents the short diameter). The results are shown in FIG. 18. In the MC38 model, the mice are euthanized as the tumor volume in the control mouse group reaches 2500 mm.sup.3 on day 17 of administration during the experiment. According to the data analysis of D17, for the single agent groups HLX10 and h6H11B10#40, TGI is 35.22% and 4.88%, respectively. In a combined administration group, when the dose of HLX10 is 1.5 mg/kg and the dose of h6H11B10#40 is set to 10 mg/kg and 30 mg/kg, respectively, TGI % is 62.2% and 56.7%, respectively, which are higher than those of the single agent groups. The data shows that the combined administration of h6H11B10#40 and HLX10 has better tumor-inhibiting effects than a single agent.

    [0120] A20 cells are cultured in the culture medium RPMI-1640+10% FBS. The A20 cells in exponential growth phase are collected, and then resuspended in PBS to an appropriate concentration (0.1 mL/mouse) for subcutaneous inoculation of mice. Experimental mice are subcutaneously inoculated with the A20 cells (5×10.sup.5 cells/mouse) on the right anterior scapula. When the average tumor volume reaches 90.44 mm.sup.3, the mice are randomly divided into groups according to tumor size. The coefficient of variation (CV) of tumor volume among each group is calculated with the formula CV=SD/MTV×100%, which should be less than 40%. The day of grouping is defined as day 0, and administration begins on day 0. In the A20 model, the mice are euthanized as the tumor volume is greater than 2500 mm.sup.3 on day 14 of administration, which causes reduced number of mice. TGI analysis is performed on day 14, and as shown in FIG. 19, for single agent groups HLX10 (3 mg/kg), h6H11B10#40 (10 mg/kg) and h6H11B10#40 (30 mg/kg), TGI is 13.36%, 12.83% and 22.20%, respectively. In a combined administration group, when the dose of HLX10 is 3 mg/kg and the doses of h6H11B10#40 are 10 mg/kg and 30 mg/kg, respectively, TGI % is 25.9% and 62.4%, respectively, which are better than those of the single agent groups, indicating that the combined administration group has tumor-inhibiting effects.

    [0121] It should be understood that after reading the above content of the present invention, those skilled in the art can make various changes or modifications to the present invention, and these equivalent forms also fall within the scope defined by the appended claims of this application.

    TABLE-US-00003 Sequence Listing (an amino acid sequence of LAG3-His) SEQ ID NO: 1 LQPGAEVPVVAVAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSW GPRPRRYIFVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCR LRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQV SPMDSGPWGCILTYRDGFNVSIMYNLTVIGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPG GGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTP VSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAP GALPAGHLGSGHHHHHH (a heavy chain variable region amino acid sequence of 6H11B10) SEQ ID NO: 2 EVQVVESGGGLVKPGGSLKLSCAASGFTFSDYYMFWVRQTPEERLEWVATINDGGDYTNYPDSVKGRFT ISRDNDKNKLYLQMNSLKSEDTAMYWARESGIYYDYASFGYWWGQGTLVTVSS (a heavy chain variable region nucleotide sequence of 6H11B10) SEQ ID NO: 3 gaggtgcaggtggtggagtctgggggaggtttagtgaagcctggagggtccctgaaactc tcctgtgcagcgtctggattcactttcagtgactattacatgttttgggtt cgccagactccggaagagaggctggagtgggtcgcaaccattaatgatggtggtgattac accaactatccagacagtgtgaaggggcgattcaccattctccagag acaatgacaagaacaaactgtacctgcaaatgaacagtctgaagtctgaggacacagccat gtattactgtgcaagagagagtgggatctactatgattacgcttcgttt ggttactggggccaggggactctggtcactgtctct (a light chain variable region amino acid sequence of 6H11B10) SEQ ID NO: 4 DIVMTQAAFSNPVTLGTSASISCRSSKSLLYSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSSSGS GTDFTLRISRVEAEDVGVYYCAQNLELPWTFGGGTKLEIKRNL (a light chain variable region nucleotide sequence of 6H11B10) SEQ ID NO: 5 gatattgtgatgacccaggctgcattctccaatccagtcactcttggaacatcagcttc catctcctgcaggtctagtaagagtctcttatatagtaatggcatcacttatttg tattggtatctgcagaagccaggccagtctcctcagctcctgatttatcagatgtccaacc ttgcctcaggagtcccagacaggttcagtagcagtgggtcaggaactg atttcacactgagaatcagcagagtggaggctgaggatgtgggtgtttattactgtgctca aaatctagaacttccgtggacgttcggtggaggcaccaagctggaaat caaacgtaatctg (a heavy chain variable region amino acid sequence of h6H11B10) SEQ ID NO: 6 QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMFWIRQAPGKGLEWVATINDGGDYTNYPDSVKGRFT ISRDNAKNSLYLQMNSLRAEDTAVYYCARESGIYYDYASFGYWGQGTLVTVSS (a heavy chain variable region nucleotide sequence of h6H11B10) SEQ ID NO: 7 caggtgcagctggtggagagcggaggaggactggtgaagccaggaggatctctgaggctgtc ctgcgccgctagcggcttcaccttttctgactactatatgttctgg atcagacaggctccaggcaagggactggagtgggtggctaccatcaacgacggcggcgatta cacaaattatcctgactccgtgaagggcaggtttaccatctctcg ggataacgccaagaattccctgtacctgcagatgaacagcctgagagccgaggacacagccg tgtactattgtgcccgcgagtctggcatctactatgattacgcttc cttcggctattggggccagggcaccctggtgacagtgtcctcc (a light chain variable region amino acid sequence of h6H11B10) SEQ ID NO: 8 DIVMTQSPLSLSVTPGEPASISCRSSKSLLYSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGS GTDFTLKISRVEAEDVGVYYCAQNLELPWTFGGGTKLEIKRNL (a light chain variable region nucleotide sequence of h6H11B10) SEQ ID NO: 9 gacatcgtgatgacccagtccccactgtctctgtccgtgacaccaggagagcctgctagcat ctcttgcagatccagcaagtccctgctgtatagcaacggcatcacct acctgtattggtacctgcagaagccaggccagagcccccagctgctgatctaccagatgtct aatctggcttccggagtgcctgacaggttctccggaagcggatctg gaaccgacttcaccctgaagatctctcgggtggaggccgaggatgtgggcgtgtactattgt gctcagaacctggagctgccatggaccttcggcggaggaacaaa gctggagatcaagcgcaatctg (a heavy chain variable region amino acid sequence of h6H11B10#40) SEQ ID NO: 10 QVQLVESGGGLVKPGGSLRLSCAASGFRFSDYYMFWIRQAPGKGLEWVATINDGGDYTNYPDSVKGRFT ISRDNAKNSLYLQMNSLRAEDTAVYYCARESGIYYDWASFGYWGQGTLVTVSS (a heavy chain variable region nucleotide sequence of h6H11B10#40) SEQ ID NO: 11 caggtgcagctggtggagagcggaggaggactggtgaagccaggaggatctctgaggctgt cctgcgccgctagcggcttccggttttctgactactatatgttctgg atcagacaggctccaggcaagggactggagtgggtggctaccatcaacgacggcggcgatt acacaaattatcctgactccgtgaagggcaggtttaccattctctcg ggataacgccaagaattccctgtacctgcagatgaacagcctgagagccgaggacacagcc gtgtactattgtgcccgcgagtctggcatctactatgattgggcttc cttcggctattggggccagggcaccctggtgacagtgtcctcc (a light chain variable region amino acid sequence of h6H11B10#40) SEQ ID NO: 12 DIVMTQSPLSLSVTPGEPASISCRSSKSLKYSNGITYLYWYLQKPGQSPQLLIYQMSNLASGVPDRFSGSGS GTDFTLKISRVEAEDVGVYYCAQNLELPWTFGGGTKLEIKRNL (a light chain variable region nucleotide sequence of h6H11B10#40) SEQ ID NO: 13 gacatcgtgatgacccagtccccactgtctctgtccgtgacaccaggagagcctgctagc atctcttgcagatccagcssgtccctgaagtatgcaacggcatcacc tacctgtattggtacctgcagaagccaggccagagcccccagctgctgatctaccagatg tctaatctggcttccggagtgcctgacaggttctccggaagcggatct ggaaccgacttcaccctgaagatctctcgggtggaggccgaggatgtgggcgtgtactat tgtgcgcagaacctggagctgccatggaccttcggcggaggaacaa agctggagatcaagcgcaatctg (a heavy chain constant region amino acid sequence) SEQ ID NO: 14 ASTKGPSVTPLAPCSRSTSESTAALGCLVKDYEPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP SSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFTLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK (a heavy chain constant region nucleotide sequence) SEQ ID NO: 15 gccagcacaaagggcccatcggtcttcccgctagcaccctgctccaggagcacctcc gagagcacagccgccctgggctgcctggtcaaggactacttccccgaa ccggtgacggtgtcgtggaactcaggcgccctgaccagcggcgtgcacaccttcccg gctgtcctacagtcctcaggactctactccctcagcagcgtggtgaccgt gccctccagcagcttgggcacgaagacctacacctgcaacgtagatcacaagcccag caacaccaaggtggacaagagagttgagtccaaatatggtcccccatg cccaccatgcccagcacctgagttcctggggggaccatcagtcttcctgttcccccc aaacccaaggacactctcatgatctcccggacccctgaggtcacgtgcgt ggtggtggacgtgagccaggaagaccccgaggtccagttcaactggtacgtggatgg cgtggaggtgcataatgccaagacaaagccgcgggaggagcagttca acagcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaacg gcaaggagtacaagtgcaaggtctccaacaaaggcctcccgtcctccat cgagaaaaccatctccaaagccaaagggcagccccgagagccacaggtgtacaccctg cccccatcccaggaggagatgaccaagaaccaggtcagcctgacc tgcctggtcaaaggcttctaccccagcgacatcgccgtggagtgggagagcaatgggc agccggagaacaactacaagaccacgcctcccgtgctggactccgac ggctccttcttcctctacagcaggctaaccgtggacaagagcaggtggcaggagggga atgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacaca cagaagagcctctccctgtctctgggtaaa (a light chain constant region amino acid sequence) SEQ ID NO: 16 AAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (a light chain constant region nucleotide sequence) SEQ ID NO: 17 gctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaatctggaact gcctctgttgtgtgcctgctgaataacttctatcccagagaggccaaagtacagt ggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacagagcagg acagcaaggacagcacctacagcctcagcagcaccctgacgctgagc aaagcagactacgagaaacacaaagtctacgcctgcgaagtcacccatcagggcctg agctcgcccgtcacaaagagcttcaacaggggagagtgt (HCDR1 amino acid sequences of h6H11B10 and h6H11B10#40) SEQ ID NO: 18 DYYMF (HCDR2 amino acid sequences of h6H11B10 and h6H11B10#40) SEQ ID NO: 19 TINDGGDYTNYPDSVKG (an HCDR3 amino acid sequence of h6H11B10) SEQ ID NO: 20 ESGIYYDYASFGY (an HCDR3 amino acid sequence of h6H11B10#40) SEQ ID NO: 21 ESGIYYDWASFGY (an LCDR1 amino acid sequence of h6H11B10) SEQ ID NO: 22 RSSKSLLYSNGITYLY (an LCDR1 amino acid sequence of h6H11B10#40) SEQ ID NO: 23 RSSKSLKYSNGITYLY (LCDR2 amino acid sequences of h6H11B10 and h6H11B10#40) SEQ ID NO: 24 QMSNLAS (LCDR3 amino acid sequences of h6H11B10 and h6H11B10#40) SEQ ID NO: 25 AQNLELPWT