COMPOSITIONS AND METHODS FOR RAPID RNA-ADENYLATION AND RNA SEQUENCING

20230074066 · 2023-03-09

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided are compositions, methods, kits, and articles of manufacture for use in RNA sequencing. The approach is referred to as easy RNA-adenylation sequencing (“Ezra-seq”). The approach provides an alternative to 3′ end linker ligation and circularization by way of an enzymatic system capable of 3′ end poly(A) tailing and 5′-end adenylation for the same RNA, using two separate enzymes, or a single fusion protein. The two enzymes or the fusion protein containing them as distinct segments are a cyclase and a polymerase. The method allows for single container processing of RNA into cDNA,

    Claims

    1. A method for determining nucleotide sequences of RNA polynucleotides, the method comprising: a) providing a plurality of RNA fragments obtained from the RNA polynucleotides; b) enzymatically phosphorylating 5′ ends of the plurality of RNA fragments to provide a plurality of RNA fragments comprising mono-phosphorylated 5′ ends; c) enzymatically dephosphorylating 3′ ends of the plurality of RNA fragments to provide a plurality of RNA fragments comprising free 3′ hydroxyls; d) enzymatically adenylylating phosphorylated 5′ ends of the plurality of RNA fragments to provide a plurality of 5′ mono-adenylated RNA fragments; e) enzymatically polyadenylating 3′ ends of the plurality of RNA fragments comprising the free 3′ hydroxyls to provide a plurality of RNA fragments comprising polyadenylated 3′ ends; f) ligating oligonucleotide adapters to the 5′ ends of the plurality of 5′ mono-adenylated RNA fragments, the oligonucleotide adapters optionally comprising a DNA/RNA hybrid 3′ end, the DNA/RNA hybrid 3′ end optionally comprising rCrC-OH or rGrG-OH as the RNA component of the DNA/RNA hybrid, to provide a plurality of RNA fragments comprising the oligonucleotide adapters at the 5′ ends; g) generating cDNAs from the plurality of RNA fragments of f); h) amplifying the cDNAs; and i) determining nucleotide sequences of the cDNAs, thereby determining the nucleotide sequences of the RNA polynucleotides.

    2. The method of claim 1, wherein at least b)-h) is performed in a single reaction container.

    3. The method of claim 2, wherein the reaction container comprises a substrate that optionally comprises streptavidin, and wherein a primer used to generate the cDNAs by reverse transcription comprises a binding partner that binds to the substrate, the binding partner optionally comprising biotin.

    4. The method of claim 2, wherein at least 80% of the 5′ ends of the plurality of RNA fragments are sequenced.

    5. The method of claim 2, wherein the plurality of RNA polynucleotide fragments comprise open reading frames, and wherein an in-frame ratio (IFR) of at least 90% is obtained for sequenced RNA polynucleotides.

    6. The method of claim 1, wherein a ligase enzymatically phosphorylates the 5′ ends of the plurality of RNA fragments to provide a plurality of RNA fragments comprising mono-phosphorylated 5′ ends, and wherein the ligase enzymatically dephosphorylates 3′ ends of the plurality of RNA fragments to provide the plurality of RNA fragments comprising the free 3′ hydroxyls, wherein the ligase is optionally T4 RNA ligase 2 (T4 Rn12tr).

    7. The method of claim 6, wherein the enzymatically adenylating the phosphorylated 5′ ends of the plurality of RNA fragments, and the polyadenylating of the 3′ ends of the plurality of RNA fragments, is performed using a cyclase and a polymerase, optionally configured as a single fusion protein.

    8. The method of claim 7, wherein the polymerase comprises poly(A) polymerase obtained or derived from E. coli poly(A) polymerase (E. coli PAP1) or Saccharomyces cerevisiae poly(A) polymerase (S. cerevisiae PAP1).

    9. The method of claim 7, wherein the cyclase catalyzes synthesis of RNA 2′,3′-cyclic phosphate ends and catalyzes adenylylation of 5′-phosphate ends of the plurality of RNA fragments, wherein the cyclase optionally comprises an RtcA enzyme.

    10. The method of claim 1, wherein the ligating the oligonucleotide adapters to the 5′ ends of the plurality of the 5′ mono-adenylated RNA fragments is optionally performed using a T4 RNA ligase.

    11.-17. (canceled)

    18. An article of manufacture comprising at least one sealed container, the at least one sealed container containing at least a mixture of two distinct proteins or the fusion protein for use in RNA sequencing, the two distinct proteins or the fusion protein comprising a poly(A) polymerase and an RNA 3′-phosphate cyclase, the article of manufacture further comprising printed material that provides an indication that contents of the article of manufacture are for use in RNA sequencing.

    19. The article of manufacture of claim 18, further comprising one or a combination of: i) at least one oligonucleotide primer for use in cDNA synthesis, wherein the oligonucleotide primer comprises a poly-T segment, and wherein the oligonucleotide primer is optionally labeled such that it can be bound to a binding partner, wherein said label optionally comprises biotin; ii) a plurality of beads comprising a moiety configured to bind to the label, wherein the moiety optionally comprises streptavidin, and wherein the plurality of beads optionally comprise magnetic beads.

    20. The article of manufacture of claim 19, further comprising at least one sealed container that comprises a buffer or components to make the buffer, the buffer having a pH of approximately 7.0, and/or an ATP concentration that is greater than 1 mM, and is optionally approximately a 2 mM concentration of the ATP.

    Description

    BRIEF DESCRIPTION OF FIGURES

    [0015] FIG. 1. Schematic representation (A) of Ezra-seq and conventional Ribo-seq methods. A direct comparison of the results in terms of IFR resolution is listed below. IFR: in-frame ratio of ribosome footprints. (B) The workflow of Ezra-seq for the application to ribosome profiling. RPF: ribosome-protected RNA fragments. (C) An overall procedure of single tube reaction using Ezra enzymes.

    [0016] FIG. 2. RtcA catalyzes the synthesis of RNA 2′,3′-cyclic phosphate ends via an ATP-dependent pathway. After pre-treatment with T4 PNK, RtcA catalyzes ligase-like adenylylation of RNA 5′-monophosphate ends.

    [0017] FIG. 3. Different buffers were tested for the Ezra system (RtcA+PAP1), shown in (A). P indicates positive control for separated steps. (B) New buffers were tested for the Ezra system (RtcA+PAP1) with different ATP concentration. P indicates positive control for separated steps. (C) The optimized buffer for the Ezra system.

    [0018] FIG. 4. The recombinant Ezra enzyme comprises PAP1 and RtcA, as shown in (A), enabling 5′ end adenylation and 3′ end polyadenylation for RNA molecules with 5′ monophosphate and 3′ OH. (B) Polyadenylation efficiency between yeast PAP1 and E. coli PAP1.

    [0019] FIG. 5. The full sequence of Biotin RT-primer (SEQ ID NO:5) is shown in (A). (B) The full sequence of 5′ adapter for ligation (SEQ ID NO:2). (C) Ligation efficiency between 5′ adapters with varied 3′ ribonucleotides and AppRNA catalyzed by T4 RNL2.

    [0020] FIG. 6. Ribo-seq of MEF cells using Ezra-seq technology coupled with sucrose gradient-based ribosome fractionation is shown in (A). (B) Ribo-seq of MEF cells using

    [0021] Ezra-seq technology without sucrose gradient-based ribosome fractionation. (C) Mitochondrial Ribo-seq and RNA-seq using Ezra-seq technology. (D) Chromatin-associated RNA-seq using Ezra-seq technology.

    [0022] FIG. 7. Graphical depiction of 3′ & 5′ adenylation.

    [0023] FIG. 8. Graphical depiction of bead binding.

    [0024] FIG. 9. Graphical depiction of ligation.

    [0025] FIG. 10. Graphical depiction of cDNA synthesis.

    [0026] FIG. 11. Graphical depiction of PCR amplification.

    DETAILED DESCRIPTION

    [0027] Unless specified to the contrary, it is intended that every maximum numerical limitation given throughout this description includes every lower numerical limitation, as if such lower numerical limitations were expressly written herein. Every minimum numerical limitation given throughout this specification will include every higher numerical limitation, as if such higher numerical limitations were expressly written herein. Every numerical range given throughout this specification will include every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein.

    [0028] The disclosure includes every amino acid sequence described herein, and every polynucleotide sequence that encodes the amino acid sequences, including but not limited to cDNA sequences, and RNA sequences. Complementary sequences, and reverse complementary sequences are also included. Expression vectors comprising such nucleotide sequences are encompassed by the disclosure.

    [0029] Polypeptides comprising amino acid sequences that are at least 80% identical to the amino acid sequence of this disclosure are included. In embodiments, the proteins comprise mutations, relative to an endogenous protein. An “endogenous” protein is a protein that is normally encoded by an unmodified gene. Likewise, an endogenous gene or other polynucleotide comprises a DNA sequence that is unmodified, such as by recombinant, gene editing, or other approaches. Mutations can include amino acid insertions, deletions, and changes.

    [0030] In embodiments, the disclosure provides compositions and methods for RNA adenylation and sequencing. The method is referred to from time to time as Ezra-seq, which stands for easy RNA-adenylation sequencing. The term “easy” should be viewed in the context of the disclosure, which provides novel compositions and methods for sequencing RNA with previously unavailable efficiency and resolution, but is not intended to signify a simplistic nature of the disclosure.

    [0031] In general, the disclosure provides compositions and methods for RNA-associated sequencing, wherein the RNA fragment is modified with a 3′ end poly(A) tailing and 5′-end adenylation, followed by direct amplification. The described modifications are achieved enzymatically (e.g., enzymes) as opposed to chemical modification performed without enzymes.

    [0032] In embodiments, methods of the disclosure can be provided with or without using fusion proteins, such as by using a mixture of different enzymes. Thus, in one aspect, the disclosure provides one or more fusion proteins that are suitable for use in the described RNA modification methods, which include but are not necessarily limited to 5′ and 3′ adenylation of RNA. A fusion protein comprises a single, contiguous polypeptide, with segments of distinct proteins within the fusion protein. In embodiments, a fusion protein of the disclosure is referred to as an “Ezra” enzyme, which stands for easy RNA-adenylation enzyme. Thus, in embodiments, all the enzymes used in the described compositions, methods and kits may be separate proteins, or some of the enzymes may be present in at least one fusion protein. In embodiments, at least two of the described enzymes may be present in a fusion protein. In embodiments, a fusion protein comprises a segment that is a cyclase and a segment that is a polymerase. In embodiments, the cyclase comprises an RNA 3′-phosphate cyclase that catalyzes the synthesis of RNA 2′,3′-cyclic phosphate ends and also catalyzes adenylylation of 5′-phosphate ends of RNA strands. In embodiments, the described proteins are obtained or derived from prokaryotes, e.g., bacteria, or eukaryotes, e.g., yeasts. In embodiments, the polymerase, which may be used as a distinct protein or as a component of a fusion protein, comprises a poly(A) polymerase. The poly(A) polymerase may be isolated or derived from a prokaryotic or eukaryotic source. “Derived from” means the endogenously produced protein may be modified, such as to include a purification tag, or one or more change in the amino acid sequence, provided the protein retains its enzymatic function. In embodiments, the described proteins include any suitable purification tag, including but not necessarily limited to a polyhistidine tag, typically containing 2-10 histidines, a Strep-tag, Small Ubiquitin-like Modifier (SUMO), Maltose Binding Protein (MBP) tag, N-terminal glutathione S-transferase (GST), and the like.

    [0033] In an embodiment, the poly(A) polymerase is an E. coli poly(A) polymerase or a Saccharomyces cerevisiae poly(A) polymerase. Representative and non-limiting embodiments of such enzymes are provided as an E. coli poly(A) polymerase (PAP1) and Saccharomyces cerevisiae poly(A) polymerase (PAP1). A representative and non-limiting example of a cyclase is E. coli RtcA. In embodiments, functional segments of enzymes described herein can be used. Functional segments comprise a segment of the described enzyme that is necessary and sufficient to perform its intended function, the functions of the described enzymes being further described herein and illustrated in certain figures.

    [0034] In connection with the present disclosure, it is known that high through-put sequencing (HTS) of RNA fragments generally requires the preparation of libraries where the RNA is placed between the known 5′- and 3′-terminal sequences. Prior to the present disclosure, available methods for library construction utilized either RNA or DNA adaptor ligation to the 5′- and 3′-ends of the target RNA molecules. The adaptors provide primer annealing sites, first for the reverse transcription (RT) primer and later for the polymerase chain reaction (PCR) and HTS sequencing. However, ligation of adaptors in this manner is not only time consuming but also a low efficiency process that requires micrograms of inputs. In addition, the resulting cDNA libraries are contaminated with cross- and self-ligation adaptor by-products and require additional purification steps both before and after pre-amplification. Additionally, small RNAs with 5′ recessed ends are poor substrates for enzymatic adapter ligation (8).

    [0035] Many previously available small RNA sequencing protocols use synthesized DNA oligonucleotide adapters with 5′ preadenylation during cDNA library preparation. Preadenylation of the adapter's 5′ end facilitates the ligation of the adapter to the 3′ end of RNA molecules without the addition of ATP, thereby avoiding ATP-dependent side reactions. However, preadenylation of the DNA adapters can be costly and difficult. The previously available methods for chemical adenylation of DNA adapters is inefficient and requires additional steps for purification. An alternative enzymatic method using a commercial RNA ligase was recently introduced, but this enzyme works best as a stoichiometric adenylating reagent rather than a catalyst (9). Thus, in embodiments, the disclosure includes the proviso that adenylation of RNA is not performed using a pre-adenylated oligonucleotide. Rather, adenylation is enzymatically performed directly on RNA polynucleotides, including but not limited to fragments of RNA polynucleotides.

    [0036] The present disclosure demonstrates use of an RNA 3′-phosphate cyclase (RtcA) that not only catalyze the synthesis of RNA 2′,3′-cyclic phosphate ends, but also catalyzes adenylylation of 5′-phosphate ends of RNA strands (FIG. 2). The adenylylation results in the “App” structure shown in FIG. 2, showing a single A with two phosphates. This adenylylation may also be referred to as adenylation, as is often the case in the art. The disclosure includes but is not limited to all enzymatic modifications of RNA shown in FIG. 2.

    [0037] When RNA fragments are pretreated with a suitable kinase that phosphorylates 5′ ends but dephosphorylate 3′ ends, the RNA fragments become active “linkers” once the 5′ end is adenylylated by RtcA. A representative and non-limiting example of a suitable kinase is illustrated herein as T4 polynucleotide kinase.

    [0038] For RNA fragments to be sequenced, both 5′ and 3′ adaptors are required for library preparation. RNA fragments as used herein may be any suitable size, non-limiting embodiments of which include RNA polynucleotides having a minimal length of approximately 20 nucleotides. In embodiments, the length is 20-100 nts, but shorter or longer polynucleotides are not excluded from the scope of the disclosure. Thus, in embodiments, an RNA fragment can include an RNA polynucleotide that has not necessarily been fragmented, such as by mechanical fragmentation. While the disclosure is suitable for sequencing intact RNA, such as intact mRNA, or small RNAs, such as certain miRNAs and tRNA, in embodiments, the disclosure pertains to sequencing RNA polynucleotides that have been fragmented. Generating RNA fragments can be achieved using any suitable technique, which generally involve mechanical disruption of intact RNA polynucleotides. Suitable methods include but are not limited to sonication, acoustic shearing, hydrodynamic shearing, but alternative methods can be used, such as heat and divalent metal cation exposure.

    [0039] Standard protocols use separate steps and require additional purification for ligated products. Compared to the commonly used 3′ linker ligation, polyadenylation at the 3′ end is efficient and free of bias. In the presence of ATP, the poly(A) polymerase (PAP1) from E. coli or Saccharomyces cerevisiae adds a poly(A) tail to the RNA fragments. Since both 5′ adenylylation and 3′ polyadenylation require ATP molecules and occur at the same temperature (37° C.), the present disclosure provides for combining these two reactions into a single reaction (e.g., Ezra). The system can greatly simplify the entire procedure by shortening the processing time from 2 hours to 30 min. Importantly, the described method prevents product loss by omitting purification steps, such as ethanol precipitation. Thus, in an embodiment, a method of the disclosure may be free of ethanol precipitation, or precipitation by other solvents.

    [0040] However, it is revealed in the present disclosure that the working buffers for PAP1 and RtcA enzymes are not compatible. Specifically, the optimal buffer for PAP1 has a pH 7.9, whereas RtcA works the best at pH 6.0. After a titration of pH values, we found that pH 7.0 works for both PAP1 and RtcA (FIG. 3A). Additionally, by increasing the ATP concentration from 1 mM to 2 mM, we obtained a higher efficiency (FIG. 3B). With these novel buffer conditions (FIG. 3C), the disclosure provides an Ezra system capable of 5′ adenylylation and 3′ polyadenylation for the same RNA samples. All of the described buffers are included within the scope of this disclosure.

    [0041] To increase the efficiency of RNA adenylation at both ends of the RNA fragments, we engineered several fusion proteins composed of RtcA and PAP1. The most active enzyme (PAP1-RtcA) with a XTEN linker was renamed as Ezra enzyme for easy RNA adenylases (FIG. 4). Therefore, the RNA 5′-adenylation and 3′-polyadenylation can be achieved in the same tube without purification. Thus, in embodiments, the cyclase and polymerase may be separated from one another within a fusion protein by any suitable linker, a non-limiting embodiment of which is the described XTEN linker. However, as is known in the art, suitable linkers can comprise varying lengths and varying amino acid sequences, and any suitable linker can be used to create a fusion protein of the cyclase and polymerase. In embodiments, linker can comprise from 1-20 amino acids, inclusive, and including all integers and ranges of integers there between. In embodiments, a flexible linker is used. In embodiments, linkers may include glycine and serine.

    [0042] Further, while non-limiting demonstrations of the disclosure are shown with the polymerase N terminally located followed by the C terminally located cyclase, other configurations can be used, such as having the polymerase located C terminally relative to the cyclase.

    [0043] In embodiments, the described compositions, methods, and kits may include two distinct proteins, or a fusion protein comprising the amino acid sequences of two distinct proteins. In an embodiment, the distinct proteins are RNA 3′-phosphate cyclase (RtcA) and a poly(A) polymerase. In a non-limiting embodiment, the poly(A) polymerase is E. coli poly(A) polymerase (PAP1) or Saccharomyces cerevisiae poly(A) polymerase (PAP1). Representative and non-limiting sequences of suitable cyclase and polymerase enzymes are described below.

    [0044] An illustration of a representative Ezra fusion protein comprising PAP1 and RtcA is provided in FIG. 4A. The activities of E. coli poly(A) polymerase (PAP1) and Saccharomyces cerevisiae poly(A) polymerase (PAP1) are similar (FIG. 4B). The Ezra fusion protein sequence is listed below, where the His-tag is shown in italics, the PAP1 sequence is shown in bold, the linker is subscripted, and the RtcA sequence is enlarged. SEQ ID NO:1 is for Ezra fusion protein containing E. coli poly(A) polymerase (PAP1), whereas SEQ ID NO:2 is for Saccharomyces cerevisiae poly(A) polymerase (PAP1).

    TABLE-US-00001 (SEQ ID NO:1) MHHHHHHHHHMKVLSREESEAEQAVARPQVTVIPREQHAISRKDISENAL KVMYRLNKAGYEAWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNC RLVGRRFRLAHVMFGPEIIEVATFRGHHEGNVSDRTTSQRGQNGMLLRDN IFGSIEEDAQRRDFTINSLYYSVADFTVRDYVGGMKDLKDGVIRLIGNPE TRYREDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLNDIPPARLFEE SLKLLQAGYGYETYKLLCEYHLFQPLFPTITRYFTENGDSPMERIIEQVL KNTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKIAQESGLTYHDAFALAM NDVLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRA AYDLLALRAEVERNAELQRLVKWWGEFQVSAPPDQKGMLNELDEEPSPRR RTRRPRKRAPRREGTA.sub.SGSETPGTSESATPESHMMKRMIALDGAQGEGGG QILRSALSLSMITGLPFTITGIRAGRAKPGLLRQHLTAVKAAAEICRATV EGAELGSQRLLFRPGTVRGGDYRFAIGSAGSCTLVLQTVLPALWFADGPS RVEVSGGTDNPSAPPADFIRRVLEPLLAKIGIHQQTTLLRHGFYPAGGGV VATEVSPVTSFNTLQLGERGNIVRLRGEVLLAGVPRHVAEREIATLAASF SLHEQNIHNLPRDQGPGNTVSLEVESENITERFFVVGEKRVSAEVVAAQL VKEVKRYLASPAAVGEYLADQLVLPMALAGAGEFTVAHPSCHLLTNIAVV ERFLPVRFGLVEADGVTRVSIE*

    [0045] Referring to SEQ ID NO:1, amino acids 1-11 correspond to a poly-His affinity tag, amino acids 12-466 correspond to E. coli PAP1, amino acids 467-484 correspond to a XTEN linker, and amino acids 485-822 correspond to RtcA.

    [0046] In embodiments, a method of the disclosure is performed using a contiguous polypeptide that comprises amino acid sequences that are at least 80% identical to segment of SEQ ID NO:1 that includes amino acids 12-466 and amino acid sequences that are at least 80% similar to segment of SEQ ID NO:1 that includes amino acids 485 to 822.

    TABLE-US-00002 (SEQ ID NO: 2) MHHHHHHHHHMSSQKVFGITGPVSTVGATAAENKLNDSLIQELKKEGSFE TEQETANRVQVLKILQELAQRFVYEVSKKKNMSDGMARDAGGKIFTYGSY RLGVHGPGSDIDTLVVVPKHVTREDFFTVFDSLLRERKELDEIAPVPDAF VPIIKIKFSGISIDLICARLDQPQVPLSLTLSDKNLLRNLDEKDLRALNG TRVTDEILELVPKPNVFRIALRAIKLWAQRRAVYANIFGFPGGVAWAMLV ARICQLYPNACSAVILNRFFIILSEWNWPQPVILKPIEDGPLQVRVWNPK IYAQDRSHRMPVITPAYPSMCATHNITESTKKVILQEFVRGVQITNDIFS NKKSWANLFEKNDFFFRYKFYLEITAYTRGSDEQHLKWSGLVESKVRLLV MKLEVLAGIKIAHPFTKPFESSYCCPTEDDYEMIQDKYGSHKTETALNAL KLVTDENKEEESIKDAPKAYLSTMYIGLDFNIENKKEKVDIHIPCTEFVN LCRSFNEDYGDHKVFNLALRFVKGYDLPDEVFDENEKRPSKKSKRKNLDA RHETVKRSKSDAASGDNINGTTAAVDVN.sub.SGSETPGTSESATPESHMMKRM IALDGAQGEGGGQILRSALSLSMITGLPFTITGIRAGRAKPGLLRQHLTA VKAAAEICRATVEGAELGSQRLLFRPGTVRGGDYRFAIGSAGSCTLVLQT VLPALWFADGPSRVEVSGGTDNPSAPPADFIRRVLEPLLAKIGIHQQTTL LRHGFYPAGGGVVATEVSPVTSFNTLQLGERGNIVRLRGEVLLAGVPRHV AEREIATLAASFSLHEQNIHNLPRDQGPGNTVSLEVESENITERFFVVGE KRVSAEVVAAQLVKEVKRYLASPAAVGEYLADQLVLPMALAGAGEFTVAH PSCHLLTNIAVVERFLPVRFGLVEADGVTRVSIE*

    [0047] Referring to SEQ ID NO:2, amino acids 1-11 correspond to a an affinity tag, amino acids 12-578 correspond to Saccharomyces cerevisiae PAP1, amino acids 579- 596 correspond to a XTEN linker, and amino acids 597-934 correspond to RtcA.

    [0048] In embodiments, a method of the disclosure is performed using a contiguous polypeptide that comprises amino acid sequences that are at least 80% identical to segment of SEQ ID NO:2 that includes amino acids 12-578 and amino acid sequences that are at least 80% similar to segment of SEQ ID NO:2 that includes amino acids 597 to 934.

    [0049] A representative and non-limiting DNA sequence encoding the Ezra fusion protein is shown below, as SEQ ID NO:3 for E. coli poly(A) polymerase (PAP1), and SEQ ID NO:4 is for Saccharomyces cerevisiae poly(A) polymerase (PAP1), using the same convention for the coding sequences as in the amino acid sequence above:

    TABLE-US-00003 (SEQ ID NO: 3) ATGCATCATCATCATCATCATCATCATCATATGAAAGTGCTGAGCCGCGA AGAAAGCGAAGCGGAACAGGCGGTGGCGCGCCCGCAGGTGACCGTGATTC CGCGCGAACAGCATGCGATTAGCCGCAAAGATATTAGCGAAAACGCGCTG AAAGTGATGTATCGCCTGAACAAAGCGGGCTATGAAGCGTGGCTGGTGGG CGGCGGCGTGCGCGATCTGCTGCTGGGCAAAAAACCGAAAGATTTTGATG TGACCACCAACGCGACCCCGGAACAGGTGCGCAAACTGTTTCGCAACTGC CGCCTGGTGGGCCGCCGCTTTCGCCTGGCGCATGTGATGTTTGGCCCGGA AATTATTGAAGTGGCGACCTTTCGCGGCCATCATGAAGGCAACGTGAGCG ATCGCACCACCAGCCAGCGCGGCCAGAACGGCATGCTGCTGCGCGATAAC ATTTTTGGCAGCATTGAAGAAGATGCGCAGCGCCGCGATTTTACCATTAA CAGCCTGTATTATAGCGTGGCGGATTTTACCGTGCGCGATTATGTGGGCG GCATGAAAGATCTGAAAGATGGCGTGATTCGCCTGATTGGCAACCCGGAA ACCCGCTATCGCGAAGATCCGGTGCGCATGCTGCGCGCGGTGCGCTTTGC GGCGAAACTGGGCATGCGCATTAGCCCGGAAACCGCGGAACCGATTCCGC GCCTGGCGACCCTGCTGAACGATATTCCGCCGGCGCGCCTGTTTGAAGAA AGCCTGAAACTGCTGCAGGCGGGCTATGGCTATGAAACCTATAAACTGCT GTGCGAATATCATCTGTTTCAGCCGCTGTTTCCGACCATTACCCGCTATT TTACCGAAAACGGCGATAGCCCGATGGAACGCATTATTGAACAGGTGCTG AAAAACACCGATACCCGCATTCATAACGATATGCGCGTGAACCCGGCGTT TCTGTTTGCGGCGATGTTTTGGTATCCGCTGCTGGAAACCGCGCAGAAAA TTGCGCAGGAAAGCGGCCTGACCTATCATGATGCGTTTGCGCTGGCGATG AACGATGTGCTGGATGAAGCGTGCCGCAGCCTGGCGATTCCGAAACGCCT GACCACCCTGACCCGCGATATTTGGCAGCTGCAGCTGCGCATGAGCCGCC GCCAGGGCAAACGCGCGTGGAAACTGCTGGAACATCCGAAATTTCGCGCG GCGTATGATCTGCTGGCGCTGCGCGCGGAAGTGGAACGCAACGCGGAACT GCAGCGCCTGGTGAAATGGTGGGGCGAATTTCAGGTGAGCGCGCCGCCGG ATCAGAAAGGCATGCTGAACGAACTGGATGAAGAACCGAGCCCGCGCCGC CGCACCCGCCGCCCGCGCAAACGCGCGCCGCGCCGCGAAGGCACCGCG.sub.AG .sub.CGGCAGCGAGACTCCCGGGACCTCAGAGTCCGCCACACCCGAAAGTCATA .sub.TGATGAAAAGGATGATTGCGCTGGATGGCGCACAGGGCGAAGGCGGCGGG CAGATCCTGCGCTCGGCGCTGAGCCTGTCGATGATAACCGGCCTGCCATT TACCATCACCGGCATTCGTGCCGGGCGGGCAAAACCGGGACTGTTGCGCC AGCATCTGACCGCGGTAAAAGCGGCTGCGGAAATTTGTAGGGCAACGGTG GAAGGTGCGGAGCTGGGATCGCAGCGTCTGCTCTTCCGGCCCGGCACCGT GCGCGGCGGCGATTACCGCTTTGCTATCGGTAGCGCCGGAAGTTGTACGC TGGTGCTGCAAACGGTGCTGCCCGCGCTGTGGTTTGCCGATGGACCTTCG CGTGTTGAAGTGAGCGGAGGCACCGATAACCCGTCGGCCCCGCCTGCGGA TTTTATCCGCCGGGTGCTGGAGCCGCTGCTGGCGAAAATAGGAATTCATC AGCAAACCACGCTGTTACGTCACGGTTTTTATCCTGCCGGAGGCGGCGTG GTGGCAACGGAAGTCTCGCCGGTGACATCGTTTAACACCTTGCAACTTGG CGAGCGCGGGAACATTGTGCGGCTGCGTGGTGAGGTGTTATTAGCTGGCG TACCGCGACATGTTGCTGAGCGTGAAATCGCTACGCTGGCGGCAAGTTTT TCCCTGCATGAGCAGAATATTCATAACCTGCCGCGTGACCAGGGGCCGGG TAATACCGTTTCGCTTGAAGTCGAAAGTGAAAATATCACCGAACGCTTTT TTGTCGTCGGTGAAAAGCGCGTCAGCGCCGAGGTGGTCGCGGCACAGTTG GTGAAAGAGGTGAAACGCTACCTGGCAAGCCCGGCGGCGGTGGGGGAATA TCTCGCCGACCAGTTGGTGCTACCGATGGCGCTGGCGGGCGCGGGAGAAT TTACGGTCGCCCATCCCTCATGCCATCTGCTGACCAATATCGCGGTGGTG GAGCGTTTCTTGCCAGTGCGGTTTGGTCTGGTGGAGGCTGATGGCGTAAC GCGGGTGAGCATTGAATAA

    TABLE-US-00004 (SEQ ID NO: 4) ATGCATCATCATCATCATCATCATCATCATATGAGCTCTCAAAAGGTTTT TGGTATTACTGGACCTGTTTCCACCGTGGGCGCCACAGCAGCAGAAAATA AATTAAATGATAGTTTAATCCAAGAACTGAAAAAGGAAGGATCGTTCGAA ACAGAGCAAGAAACTGCCAATAGGGTACAAGTGTTGAAAATATTGCAGGA ATTGGCACAAAGATTTGTTTATGAAGTATCGAAGAAGAAAAATATGTCAG ACGGGATGGCAAGGGATGCTGGTGGGAAGATTTTTACGTATGGGTCCTAT AGACTAGGAGTCCATGGGCCTGGTAGTGATATCGATACTTTGGTAGTTGT TCCAAAACATGTAACTCGGGAAGATTTTTTTACGGTATTTGATTCACTAC TGAGAGAGAGGAAGGAACTGGATGAAATTGCACCTGTACCTGATGCGTTT GTCCCGATTATCAAGATAAAGTTCAGTGGTATTTCTATCGATTTAATCTG TGCACGTCTAGACCAACCTCAAGTGCCTTTATCCTTGACTTTATCAGATA AAAATCTACTGCGAAATCTAGACGAGAAGGACTTGAGAGCTTTGAATGGT ACCAGAGTAACAGATGAGATATTAGAACTGGTACCAAAGCCGAATGTTTT CAGAATCGCTTTAAGAGCTATTAAGCTATGGGCCCAAAGAAGGGCTGTTT ATGCTAATATTTTTGGTTTTCCTGGTGGTGTGGCTTGGGCCATGCTAGTG GCTAGAATTTGTCAACTATACCCTAACGCCTGTAGCGCAGTTATATTGAA CAGATTTTTCATCATTTTGTCGGAATGGAATTGGCCACAACCTGTTATCT TGAAACCAATTGAGGATGGCCCGTTACAAGTTCGTGTATGGAATCCAAAG ATATATGCCCAAGACAGGTCTCATAGAATGCCCGTCATTACACCAGCTTA TCCATCAATGTGTGCTACCCATAACATCACGGAATCTACTAAAAAAGTCA TTTTACAGGAATTCGTAAGAGGCGTTCAAATTACGAATGATATTTTTTCC AATAAGAAGTCCTGGGCCAATTTATTCGAAAAAAACGATTTTTTCTTTCG ATACAAGTTCTATTTAGAAATTACTGCATATACAAGGGGCAGTGACGAGC AGCATTTAAAATGGAGTGGTCTTGTTGAAAGTAAGGTAAGGCTTCTAGTT ATGAAACTGGAGGTGTTAGCTGGAATAAAAATTGCACATCCTTTCACCAA ACCCTTTGAAAGTAGTTATTGTTGTCCAACCGAGGATGACTATGAAATGA TTCAAGACAAATACGGTAGTCATAAAACTGAGACAGCACTGAACGCCCTT AAACTGGTAACAGATGAAAATAAAGAGGAAGAAAGTATTAAAGATGCACC AAAGGCATATTTAAGCACCATGTACATAGGCCTTGACTTTAATATTGAAA ACAAAAAGGAAAAAGTTGACATTCACATTCCCTGCACTGAATTTGTGAAT TTATGTCGAAGTTTCAATGAGGATTATGGTGACCACAAAGTATTCAATCT AGCCCTCCGCTTCGTAAAGGGTTACGATTTGCCAGATGAAGTTTTCGATG AAAATGAAAAGAGACCATCAAAGAAGAGTAAAAGGAAGAATTTAGATGCT AGACATGAAACCGTGAAGAGATCTAAATCAGATGCTGCTTCAGGTGACAA CATCAATGGCACAACCGCAGCTGTTGACGTAAAC.sub.AGCGGCAGCGAGACTC .sub.CCGGGACCTCAGAGTCCGCCACACCCGAAAGTCATATGATGAAAAGGATG ATTGCGCTGGATGGCGCACAGGGCGAAGGCGGCGGGCAGATCCTGCGCTC GGCGCTGAGCCTGTCGATGATAACCGGCCTGCCATTTACCATCACCGGCA TTCGTGCCGGGCGGGCAAAACCGGGACTGTTGCGCCAGCATCTGACCGCG GTAAAAGCGGCTGCGGAAATTTGTAGGGCAACGGTGGAAGGTGCGGAGCT GGGATCGCAGCGTCTGCTCTTCCGGCCCGGCACCGTGCGCGGCGGCGATT ACCGCTTTGCTATCGGTAGCGCCGGAAGTTGTACGCTGGTGCTGCAAACG GTGCTGCCCGCGCTGTGGTTTGCCGATGGACCTTCGCGTGTTGAAGTGAG CGGAGGCACCGATAACCCGTCGGCCCCGCCTGCGGATTTTATCCGCCGGG TGCTGGAGCCGCTGCTGGCGAAAATAGGAATTCATCAGCAAACCACGCTG TTACGTCACGGTTTTTATCCTGCCGGAGGCGGCGTGGTGGCAACGGAAGT CTCGCCGGTGACATCGTTTAACACCTTGCAACTTGGCGAGCGCGGGAACA TTGTGCGGCTGCGTGGTGAGGTGTTATTAGCTGGCGTACCGCGACATGTT GCTGAGCGTGAAATCGCTACGCTGGCGGCAAGTTTTTCCCTGCATGAGCA GAATATTCATAACCTGCCGCGTGACCAGGGGCCGGGTAATACCGTTTCGC TTGAAGTCGAAAGTGAAAATATCACCGAACGCTTTTTTGTCGTCGGTGAA AAGCGCGTCAGCGCCGAGGTGGTCGCGGCACAGTTGGTGAAAGAGGTGAA ACGCTACCTGGCAAGCCCGGCGGCGGTGGGGGAATATCTCGCCGACCAGT TGGTGCTACCGATGGCGCTGGCGGGCGCGGGAGAATTTACGGTCGCCCAT CCCTCATGCCATCTGCTGACCAATATCGCGGTGGTGGAGCGTTTCTTGCC AGTGCGGTTTGGTCTGGTGGAGGCTGATGGCGTAACGCGGGTGAGCATTG AATAA

    [0050] As discussed above, aspects of the disclosure are illustrated using ribosome protected fragments (RFPs), but the same approach can be adapted to other RNA fragments, with the exception that if RFPs are used there is generally no requirement to remove ribosomal RNA. In this regard, a comparison of the Ezra-seq for sequencing RFPs, as a non-limiting example of a type of RNA that can be sequenced according to the present disclosure, and conventional “Ribo-seq” methods is provided schematically in FIG. 1A. A non-limiting depiction of a method of this disclosure is provided schematically in FIG. 1B. As depicted in FIG. 1B, the disclosure provides for sequencing a plurality of RNA polynucleotides. The method generally comprises: 1) contacting a plurality of RNA polynucleotides with one or more enzymes and oligonucleotides as described further below, such that the RNA polynucleotides are subjected to 5′-adenylation and 3′-polyadenylation, and 2) amplifying the RNA polynucleotides into cDNAs, which facilitates the sequence of the RNA polynucleotides.

    [0051] The type of RNA sequenced using the compositions and methods described herein is not particularly limited. In embodiments, the RNA is produced by a prokaryote, a eukaryote, or a virus. In embodiments, the RNA polynucleotides sequenced according to this disclosure include but are not limited to messenger RNA (mRNA), as described above. In embodiments, the mRNA may be fragmented so that segments of the mRNA that do not already have a poly-A tail are sequenced. Any RNA that is sequenced may also be fragmented, if desired. RNA that can be sequenced also includes transfer RNA (tRNA), ribosomal RNA (rRNA), Transfer-messenger RNA (tmRNA), small nuclear RNA (snRNA), any type of antisense RNA, ribozymes, microRNA (miRNA), small interfering RNA (siRNA), short hairpin RNA (shRNA), RNA viral genomes, any CRISPR RNA, including but not limited to guide RNA and trans-activating crRNA, double stranded RNA (dsRNA), and any other type of RNA, irrespective of whether or not the RNA contains an open reading frame, or has a known or unknown function. The RNA may be located in the nucleus or the cytoplasm of a cell, or it may be excreted from a cell, such being within RNA-containing secreted exosomes. In embodiments, RNA polynucleotides sequenced according to the disclosure comprises one or more N6 methyl adenosines. In embodiments, nascent, actively transcribed RNAs are sequenced. In embodiments, the compositions and methods described herein are adapted to be used with any existing or later developed RNA sequencing approaches. Non-limiting examples of existing approaches include RIP-seq (RNA immunoprecipitation), CLIP-seq (Cross-linking immunoprecipitation), ChIP-seq (chromatin-immunoprecipitation), as well as genome-wide detection of RNA modifications (for instance, m.sup.6A-seq, as described above).

    [0052] In embodiments which pertain to sequencing RPFs, segments of RNA that are protected by ribosomes from nuclease digestion are sequenced. Thus, in embodiments, ribosome-protected fragments of mRNA are sequenced. In one embodiment, the entire set of ribosome-protected mRNA RPFs from a sample are sequenced. In embodiments, the compositions and methods are thus suitable for use in, for example, Ribosome profiling (referred to herein from time to time as “Ribo-seq”). In embodiments, the disclosure provides for an RNA sequencing approach such that ribosome positions and/or density across the transcriptome at a sub-codon resolution is provided. In embodiments, the disclosure results in a higher in-frame ratio of ribosome footprints, relative to out of frame footprints, wherein a ribosome “footprint” means the segment of an RNA polynucleotide that is protected from enzymatic degradation by a ribosome. By “in-frame” it is meant that the order of codons in the RNA is intact in the 0 frame starting with the first nucleotide in the sequenced RNA. In embodiments, Ribo-seq as described herein is performed without sucrose gradient-based ribosome separation. In embodiments, Ribo-seq can be performed using whole cell lysates to provide the RNA fragments.

    [0053] In embodiments, as an alternative to using 3′ end linker ligation and circularization, the presently provided disclosure provides for 3′ end poly(A) tailing and 5′-end adenylation on the same RNA fragment. In embodiments, 5′-adenylated RNA is referred to as AppRNA. In embodiments, by using the compositions and methods of this disclosure, RNA 5′-adenylation and 3′-polyadenylation can be achieved in a single reaction vessel without a purification step, such as purification of RNA polynucleotides or DNA polynucleotides, including but not limited to oligonucleotides, primers, and the like.

    [0054] The disclosure includes all reagents described herein, and combinations of reagents. The disclosure includes all concentrations of components as described herein, representative and non-limiting examples of which include buffers, pH values, nucleotide, RNA, and enzyme concentrations, volumes, and any other quantitative value described herein. The disclosure includes all time periods, temperatures, and value intervals. In non-limiting examples, a method of the disclosure is performed in a solution having a pH of approximately from 6.0 to 7.9, inclusive, and including all numbers there between to the first decimal point. In embodiments, a method of the disclosure is performed in a solution having a pH of approximately or precisely 7.0. In embodiments, the ATP concentration in a solution of the disclosure is greater than 1 mM. In embodiments, the ATP concentration in a solution of the disclosure is approximately or precisely 2 mM. In embodiments, the disclosure provides a buffer comprising approximately 50 mM Tris-HCL, 250 mM NaCl, 10 mM MgCl.sub.2, 1 mM DTT and 2 mM ATP. In embodiments, the sequence of a plurality of RNA polynucleotides is performed in a period of time that does not exceed approximately 8 hours. In embodiments, a cDNA library is produced in a period of time that does not exceed approximately 2 hours. In embodiments, a cDNA library is produced in a period of approximately 30 minutes.

    [0055] In embodiments, an RNA sequencing process described herein is performed using a sample comprising as little as approximately 1 nanogram of RNA. Thus, in embodiments, picogram amounts of RNA from a sample are sequenced. In embodiments, picogram amounts of RNA fragments are sequenced with ultra-resolution. In an embodiment, ultra-resolution comprises resolution of RPFs with an average IFR>90% as a fraction of the total fragments sequenced.

    [0056] In embodiments, the disclosure provides for RNA sequencing without template switching, e.g., template-switching polymerase chain reaction (TS-PCR). Thus, the disclosure is different and improved relative to the procedure offered by CLONTECH as Switching Mechanism At the 5′ end of RNA Template (SMART), and by DIAGENODE as Capture and Amplification by Tailing and Switching (CATS).

    [0057] In embodiments, RNA sequencing results produced by using the described compositions and methods are not biased by the presence of a G nucleotide in the 5′ of the RNA polynucleotides. Thus, in embodiments, the disclosure provides for sequencing a plurality of RNA polynucleotides that have 5′ nucleotides that are distributed randomly and/or without a discernable 5′ end nucleotide pattern across said plurality.

    [0058] In embodiments, a method of this disclosure provides for increased accuracy of RNA 5′ end sequencing. In embodiments, 5′ ends of 80-90% of RNA polynucleotides in a sample are sequenced. In embodiments, 5′ ends of more than 90% of the RNA polynucleotides in a sample are sequenced. In embodiments, the disclosure provides 5′ adapter ligation of polyadenylated RNA. In embodiments, the disclosure provides for producing a plurality of cDNAs, such as cDNA libraries, from RNA segments, wherein the plurality of cDNAs do not include cross- and self-ligation adaptor by-products, such as self-ligated adaptors and adaptor-RT primer ligation.

    [0059] In embodiments, the disclosure includes the sequential or concurrent use of a polynucleotide 5′-hydroxyl-kinase (e.g., a polynucleotide kinase “PNK”) and RtcA or a fusion protein comprising the RtcA amino acid sequence or homologue thereof, and the PAP1 protein or a fusion protein comprising the PAP1 amino acid sequence or a homologue thereof.

    [0060] Representative examples of fusion protein amino acid sequences are provided above. Use of these enzymes, their RNA substrates with 5′ and 3′ ends as modified according to a method of this disclosure is depicted in FIG. 2. In an embodiment, the PNK is a T4 PNK, but those skilled in the art will recognize that other PNKs may also be used instead of T4 PNK. Thus, the disclosure comprises use of a PNK or other suitable enzyme to phosphorylate RNA polynucleotides at their 5′ ends and dephosphorylate the RNA polynucleotides at their 3′ ends, as shown in FIG. 2. PNK can be used first, or concurrent with the RtcA, which may be part of a fusion protein that also comprises PAP1. The RtcA catalyzes adenylation of the RNA polynucleotide at their 5′-monophosphate ends. This results in a 5′,5′-adenyl pyrophosphoryl cap structure on the RNA polynucleotides. The PAP1 polyadenylates the 3′ end of the RNA polynucleotide.

    [0061] To rapidly enrich the adenylated RNA polynucleotides within a single tube without purification, we designed a poly(dT) oligonucleotide with 5′ end biotin labeling (Biotin-RT primer). A representative example of the Biotin-RT primer is shown in FIG. 5A and has the following sequence: /5Biosg/GTGACTGGAGTTGACGTGTGCTCTTCCGATCT.sub.(25)VN (SEQ ID NO:5), wherein V=A, C, or G, and N=A, C, G, or T. After annealing, adenylated RNA polynucleotides together with Biotin-RT primers are precipitated by streptavidin beads. A simple spin down effectively removes adenylation enzymes, which is to facilitate the subsequent 5′ end adapter ligation and reverse transcription.

    [0062] In embodiments, the compositions and methods include an oligonucleotide used as a 5′ adapter, and wherein the RNA polynucleotide prepared as described above may be considered a linker. In embodiments, the DNA/RNA hybrid oligonucleotide is shown in FIG. 5B and comprises or consists of the following sequence: ACACTCTTTCCCTACACGACGCTCTTCCGATCTrSrS (SEQ ID NO:6), where rS=rG, or rC. In embodiments, the DNA/RNA hybrid oligonucleotides comprise an RNA nucleotide at their 3′ ends. In embodiments, the oligonucleotide at the 3′ end comprises one or more rSrS-OH (refers to either rCrC-OH or rGrG-OH). In embodiments, a 5′ adapter having rSrS at its 3′ end is used. In embodiments, an oligonucleotide used in the disclosure does not have rArA at its 3′ end. In embodiments, oligonucleotides used in the compositions and methods of the disclosure do not comprise 5′ preadenylation, such as for use during conventional cDNA library preparation. In embodiments, the 5′ adapters are ligated to the anchored RNA polynucleotides using an RNA ligase, one non-limiting example of which comprises truncated T4 RNA ligase 2 (T4 Rn12tr).

    [0063] A non-limiting demonstration of ligation efficiency using certain representative oligonucleotides and AppRNA substrates as described above is shown in FIG. 5C by way of a photograph of electrophoretic separation of ligated oligonucleotides and RNA adapters prepared as described above. Representative and non-limiting examples of oligonucleotides for use as adapters are shown in FIG. 5B. In embodiments, the oligonucleotides shown in FIG. 5B provide an averaged nucleotide length. Accordingly, oligonucleotides with a shorter or longer length can be used.

    [0064] In specific and non-limiting embodiments, with the 5′,5′-adenyl pyrophosphoryl cap structure, the RNA fragments are converted into a pool of “linkers” which can be ligated to customized RNA adapters with 3′-OH by truncated T4 RNA ligase 2 (T4 Rn12tr). We designed a DNA/RNA hybrid oligonucleotide ending with varied ribonucleotides at 3′ end (rArA, rCrC, rGrG, and rUrU). We found that the truncated T4 RNA ligase 2 (T4 Rn12tr) efficiently ligated rCrC-OH and rGrG-OH to 5′-AppRNA (FIG. 5A). The poor ligation of rArA is important because it prevents self-ligation of polyadenylated AppRNA. Considering the ILLUMINA NextSeq platform, and without intending to be constrained by any particular theory, the 5′ adapter ending with rSrS is considered the most suitable for subsequent amplification and sequencing.

    [0065] In embodiments, the compositions and methods include the cDNA synthesis that directly occurs on the beads (FIG. 1B). After removal of non-ligated adapters and T4 Rn12tr, the cDNA synthesis is achieved by M-MuLV reverse transcriptase.

    [0066] The final step of PCR reaction is carried out by using common primers complementary to the ILLUMINA sequence elements and bar code sequences. The bar coding system permits pooling of different original samples into one tube, greatly reducing the sequencing cost. During data analysis, the provided bar code information allows rapid separation of original samples. This strategy minimizes technical bias introduced during sequencing. With the clean final products with the correct size (˜180 bp), the samples are ready for sequencing.

    [0067] In view of the foregoing, it will be recognized that one application of the compositions and methods described herein is in the Ribo-seq area. In this regard, a hallmark of Ribo-seq is the 3-nt periodicity of RPFs thanks to the relatively precise 5′ end protection by elongating ribosomes. As a result, the percentage of reads mapped to the reading frame 0, or in-frame ratio (IFR), has been commonly used to reflect the resolution of Ribo-seq. Optimization of library construction has improved the IFR of RPFs from ˜50% to ˜75% (FIG. 1A, middle panel vs. left panel) (7). However, prior to the present disclosure, a substantial amount of reads remain out-of-frame, imposing a significant barrier to understanding of ribosome dynamics, especially the reading frame fidelity during translation. The present disclosure addresses these deficiencies and includes additional improvements. Specifically, the presently provided Ezra-seq approach dramatically reduces the amount of starting material (˜1 ng RNA), shortens the entire library processing time from 4 days to ˜4 hr, and increases the resolution of RPFs with an averaged IFR >90%. As expected from typical Ribo-seq results, Ezra-seq revealed a prominent peaks at start codons, representing the pausing of initiating ribosomes (FIG. 6A). It reveals a size of 29-nt of RPFs when both 5′ and 3′ ends are considered.

    [0068] With the ultra-resolution of Ezra-seq, ribosome profiling can be achieved without sucrose gradient-based ribosome separation, which has become the bottleneck for its broad application. To test this, we collected whole cell lysates, digested with RNase I, and size-selected 25-35 nt RNA species. Remarkably, we obtained the similar results as the one using sucrose gradient ribosome separation (FIG. 6B).

    [0069] Mitochondria has its own genome and translation machinery. Mitochondrial translation is not as well characterized as that of bacterial and eukaryotic cytoplasmic translation (11). From the same original sample, Ezra-seq could capture mitochondrial translation with exquisite sensitivity. We treated mouse embryonic fibroblasts (MEFs) with either thapsigargin (TG, 0.1 μM) or a rhenium compound (TRIP, 25 μM) for 2 hr followed by Ezra-seq. In comparison to the vehicle control, TRIP treatment significantly reduced mitochondrial translation (FIG. 6C).

    [0070] As discussed above, the application of Ezra-seq is not limited to Ribo-seq. Ezra-seq can be readily converted to RNA-seq, serving as a Ribo-seq control in parallel. We applied Ezra-seq to monitor cellular RNA levels and found comparable mitochondria transcripts after TG or TRIP treatment (FIG. 6C, middle panel).

    [0071] Given the superior sensitivity of Ezra-seq, we also applied Ezra-seq to quantify chromatin-associated RNA species in the nucleus. For many transcripts, Ezra-seq uncovered reads from both intron and exon, an indication of unspliced nascent RNA species (FIG. 6D). Interestingly, amino acid starvation for 2 hr resulted in attenuated transcription as exemplified by GAPDH (FIG. 6D).

    [0072] The present disclosure also provides articles of manufacture, including but not necessarily limited to kits. In embodiments, the articles of manufacture contain one or more enzymes and/or primers and/or buffers provided in one or more sealed containers, non-limiting examples of which include a sealable glass or plastic vial. The articles of manufacture can include any suitable packaging material, such as a box or envelope or tube to hold the containers. The packaging can include printed material, such as on the packaging or containers themselves, or on a label, or on a paper insert. The printed material can provide a description of using any one of a combination of the enzyme(s), primers and buffer(s) in an assay described herein for the purpose of determining the sequence of any RNA. Any reagent in the article of manufacture/kit can be provided in a form for reconstitution by the user. For example, buffers, primers, enzymes and the like can be provided in dry/power/lyophilized form for making solutions with the reagents. In embodiments, a result based on a determination RNA sequences can be fixed in a tangible medium of expression, such as a digital file saved on a portable memory device, or on a hard drive. This information can be stored, for example, in a digital database for use in a variety of purposes.

    [0073] The following is an illustrative and non-limiting description of materials and methods that illustrate embodiments of the disclosure. It includes certain specific steps and compositions used in performing Ribo-seq that will be evident from the description, but is otherwise adaptable to sequencing any other plurality of RNA fragments (e.g., fragments of RNA that are not RPFs) by omitting the steps and reagents that pertain to removal of rRNA. The method may be performed using an RNA 3′ phosphate cyclase and yeast Poly(A) polymerase separately, or as components of a fusion protein.

    Materials:

    Reagents and Buffer:

    [0074] 1. rRNA depletion:
    1-1. 20×SSC: 3 M NaCl and 0.3 M sodium citrate.
    1-2. 100% ethanol and 70% ethanol.
    1-3. 3 M sodium acetate (pH 5.2).

    1-4. Glycogen (INVITROGEN, AM9510).

    [0075] 2. For adenylation:

    2-1. T4 Polynucleotide Kinase.

    [0076] 2-2. RNA 3′phosphate cyclase
    2-3. Yeast Poly(A) polymerase
    2-4. ATP solution (10 mM) (THERMO FISHER SCIENTIFIC, PV3227).
    2-5. 10×Adenylation buffer: 700 mM Tris-HCl (pH 7.5), 100 mM MgCl.sub.2 and 50 mM DTT.

    2-6. SUPERase_In RNase Inhibitor (INVITROGEN, AM2696).

    [0077] 3. For beads binding:

    3-1. Streptavidin Magnetic Beads (NEW ENGLAND BIOLABS, 514205)

    [0078] 4. For oligo ligation:
    4-1. T4 RNA Ligase 2, truncated, K227Q (NEW ENGLAND BIOLABS, M0351L), with PEG8000 50% (w/v) and 10× T4 RNA ligase buffer.
    5. For cDNA synthesis:
    5-1. 5× first strand buffer: 250 mM Tris-HCl (pH 8.3), 375 mM KCl and 15 mM MgCl.sub.2.

    5-2. 0.1 MDTT.

    [0079] 5-3. M-MuLV reverse transcriptase mut5 (homemade).

    5-4. RNaseOUT (Invitrogen, 10777-019).

    [0080] 6. For PCR reaction:

    6-1. Phusion HF Buffer (THERMO FISHER SCIENTIFIC, F518L)

    [0081] 6-2. dNTP mix (10 mM) (THERMO FISHER SCIENTIFIC, 18427013)
    6-3. Phusion DNA Polymerase (homemade).
    7. For size selection: (for Ribo-seq only)

    7-1. Novex Hi-Density TBE Sample Buffer (5×) (INVITROGEN, LC6678).

    [0082] 7-2. Novex 5× TBE running buffer (INVITROGEN, LC6675).
    7-3. DNA gel extraction buffer: 10 mM Tris (pH 8.0), 300 mM NaCl and 1 mM EDTA.
    7-4. SYBR Gold nucleic acid gel stain (INVITROGEN, S-11494).

    Equipment:

    [0083] 1. For library construction:

    1-1. DNA LoBind Tube 1.5 ml (EPPENDORF, 022431021).

    [0084] 1-2. Heat block.
    1-3. Refrigerated micro centrifuge.
    1-4. Magnetic separation rack.
    1-5. PCR tube with lid.
    2. For gel running and size selection:
    2-1. Electrophoresis power supply.
    2-2. Mini-Cell polyacrylamide gel box (THERMO FISHER SCIENTIFIC, EI0001).

    2-3. Novex TBE Gels, 8% (Invitrogen, EC6215BOX).

    [0085] 2-4. Blue light illuminator.

    2-5. Razors.

    [0086] 2-6. Spin-X centrifuge tube filters, 0.22 μm Pore CA Membrane (SIGMA, CLS8160).

    Oligos and Primers:

    [0087] 1. rRNA depletion (de-rRNA) oligos: (5′.fwdarw.3′)

    /Biotin-TEG/AGCGAGCGACCAAAGGAACCATAACTGATTT (SEQ ID NO:7)

    /Biotin-TEG/CGAGGTTATCTAGAGTCACCA (SEQ ID NO:8)

    /Biotin-TEG/TCCTAGCTGCGGTATCCAGGCG (SEQ ID NO:9)

    /Biotin-TEG/AGATAGTCAAGTTCGACCGTCTTCTCAGC (SEQ ID NO:10)

    /Biotin-TEG/GGGCCTCGATCAGAAGGACTTGGGCCCCCCACGA (SEQ ID NO:11)

    /Biotin-TEG/GCGAGACGGGCCGGTGGTGCGCCCTCGGCGG (SEQ ID NO:12)

    /Biotin-TEG/CGCTTGGCGCCAGAAGCGAGAGCC (SEQ ID NO:13)

    /Biotin-TEG/AGCGACGCTCAGACAGGCGTAGCCCCGGGAG (SEQ ID NO:14)

    /Biotin-TEG/CCGGCTATCCGAGGCCAACCG (SEQ ID NO:15)

    /Biotin-TEG/TGATCTGATAAATGCACGCATCCCCC (SEQ ID NO:16)

    /Biotin-TEG/GTGTCGAGGGCTGACTTTCAATAGATCGCAGCG (SEQ ID NO:17)

    /Biotin-TEG/AGTAGTGGTATTTCACCGGCG (SEQ ID NO:18)

    /Biotin-TEG/TAGAATTACCACAGTTATC (SEQ ID NO:19)

    2. Ligation Oligo mix:(5′→3′)

    ACACTCTTTCCCTACACGACGCTCTTCCGATCTrSrS (SEQ ID NO:6)

    [0088] rS: ribo-G or C

    3.Biotin RT-primer:(5′→3′)

    /5Biosg/GTGACTGGAGTTGACGTGTGCTCTTCCGATCT.SUB.(25).VN (SEQ ID NO:5)

    [0089] 4.PCR primers:(5′.fwdarw.3′)

    F:

    AATGATACGGCGACCACCGAGATCTACACTCTTTCCCTACACGACGCTCTTCCGA

    TCT (SEQ ID NO:20)

    R: CAAGCAGAAGACGGCATACGAGAT NNNNNN

    GTGACTGGAGTTCAGACGTGTGCTCTTCCGATCT (SEQ ID NO:21)

    [0090] * NNNNNN: barcode (index)

    Procedures:

    [0091] Starting Material: RNA fragments (10˜200 ng) in 10 μL Nuclease-Free H.sub.2O.
    1. rRNA depletion (Optional, Timing: 80 min):
    1-1. Prepare rRNA depletion master mix as in Table 1:

    TABLE-US-00005 TABLE A Components Amount 25 μM de-rRNA Oligo mix 1.0 μL 20× SSC 2.0 μL Nuclease-Free water 7.0 μL Total 10.0 μL 
    1-2. Add 10 μL rRNA depletion master mix to RNA sample (20 μL total)
    1-3. Incubate at 80° C. for 30 s, followed by slow cooling (˜3° C./min) to 37° C.
    1-4. Pre-wash streptavidin magnetic beads as below during incubation:
    1-4-1. Add suspended streptavidin magnetic beads (20 μL/sample) into a new 1.5 mL tube.
    1-4-2. Place the tube into a magnetic stand for 1-2 min. Remove and discard the supernatant.
    1-4-3. Add 200 μL of 2×SSC to the tube, vortex gently to mix. Collect the beads with a magnetic stand, then remove and discard the supernatant.
    1-4-4. Suspend streptavidin magnetic beads (20 μL/sample) in 2×SSC.
    1-5. Add 20 μL streptavidin beads (pre-washed), mix well by pipetting several times, keep at room temperature for 10 min.
    1-6. Place tube on magnet for 2 min, then transfer supernatant (40 μL total) into a new 1.5 mL tube, discard the beads.
    1-7. Precipitate RNA sample:
    1-7-1. Add 160 μL Nuclease-Free water, 4 μL glycogen and 40 μL 3M sodium acetate, and then 500 μL 100% ethanol.
    1-7-2. Precipitate for at least 30 min at −20° C.
    1-7-3. Pellet the RNA by centrifugation for 15 min at 20,000 g, 4° C.
    1-7-4. Wash RNA pellet with 500 μL 70% ethanol, followed by centrifugation for 5 min at 20,000 g, 4° C., pipette all liquid from the tube and air-dry for 5 min.
    1-8. Dissolve RNA pallet in 10 μL Nuclease-Free H.sub.2O.
    2. 3′ & 5′-Adenylation (Timing: 30 min) (depicted in FIG. 7), wherein the “insert” the RNA segment to be sequenced, and for Ribo-seq, it is ribosome-protected fragments (RPF)).
    2-1. Prepare adenylation master mix as shown in Table B:

    TABLE-US-00006 TABLE B Components Amount 10× Adenylation buffer 2.0 μL 10 mM ATP 2.0 μL 20 U/μL SUPERase_In 1.0 μL 125 μg/mL Yeast poly(A) polymerase 1.0 μL 50 μg/mL RtcA 1.0 μL 250 μg/mL T4 polynucleotide kinase 1.0 μL Total 8.0 μL
    2-2. Add 8.0 μL adenylation master mix to sample tube (20 μL total).
    2-3. Mix and incubate at 37° C. for 30 min.
    3. Bead binding (Timing: 30 min): (depicted in FIG. 8)
    3-1. Prepare beads binding master mix as described in Table C:

    TABLE-US-00007 TABLE C Components Amount 20× SSC 4.0 μL 10 μM Biotin-RT primer 1.0 μL Nuclease free H.sub.2O 15.0 μL  Total 20.0 μL
    3-2. Add 20 μL binding master mix to sample tube (40 μL total).
    3-3. Mix and incubate at 65° C. for 3 min, then cool down (˜3° C./min) to room temperature.
    3-4. Pre-wash streptavidin magnetic beads (10 μL/sample) as described at step 1-4 during incubation.
    3-5. Add 10 μL pre-washed streptavidin beads to each tube, mix by pipetting several times.
    3-6. Incubate at room temperature for 10 min.
    3-7. Place tube on magnet for 1-2 min to collect the beads and remove the supernatant.
    3-8. Re-suspend beads in 200 μL Nuclease free H.sub.2O.
    3-9. Place tube on magnet for 1-2 min and remove the supernatant.
    4. Ligation [Timing: 125 min] (depicted in FIG. 9, wherein “read1” and “read2” are primer sequences adapted for use in, for example, ILLUMINA sequencing)
    4-1. Re-suspend the beads with 9 μL Nuclease-Free H.sub.2O and 1 μl of 10 μM Ligation oligos by pipetting several times.
    4-2. Prepare ligation master mix as described in Table D:

    TABLE-US-00008 TABLE D Components Amount 10× T4 RNA ligase buffer 2.0 μL 50% PEG8000 6.0 μL 20 U/μL SUPERase_In 1.0 μL 200 U/μL T4 RNL2 Ligase 1.0 μL Total 10.0 μL 
    4-3. Add the 10 μL ligation master mix to sample tube (20 μL total volume).
    4-4. Mix and incubate at 25° C. (or room temperature) for 120 min with continuous shaking at 800 rpm.
    4-5. Place tube on magnet for 1-2 min to collect the beads and remove the supernatant.
    4-6. Re-suspend beads in 200 μL Nuclease free H.sub.2O.
    4-7. Place tube on magnet for 1-2 min and remove the all the supernatant.
    5. cDNA synthesis [Timing: 35 min] (depicted in FIG. 10)
    5-1. Re-suspend the beads with 13 μL Nuclease-Free H.sub.2O by pipetting several times.
    5-2. Incubate at 70° C. for 2 min, then let sample cool to room temperature.
    5-3. Prepare cDNA synthesis master mix as described in Table E:

    TABLE-US-00009 TABLE E Components Amount 5× first strand buffer 4.0 μL 0.1M DTT 1.0 μL 10 mM dNTP 0.5 μL 40 U/μL RNaseOUT 0.5 μL 500 μg/mL m-MLV mut-5 1.0 μL Total 7.0 μL
    5-4. Add 7 μL cDNA synthesis master mix to sample tube (20 μL total).
    5-5. Mix well and incubate at 50° C. for 30 min with continuous shaking at 800 rpm, then 85° C. for 10 min to terminate.
    6. PCR amplification [Timing: 30 min] (depicted in FIG. 11, wherein P5 and P7 are ILLUMINA sequences used for cluster formation, and the i7 index a barcode sequence).
    6-1. Prepare PCR master mix as described in Table F:

    TABLE-US-00010 TABLE F Components Amount 5*HF buffer 4.0 μL Nuclease-free H.sub.2O 12.75 μL  10 mM dNTP 1.0 μL 10 μM Forward Primer 0.5 μL 10 μM Reverse Primer (with barcode) 0.5 μL 2 U/μL Phusion ® High-Fidelity 0.25 μL  DNA Polymerase Total 7.0 μL
    6-2. Add the 2 μL cDNA from step 5 and 18 μL PCR master mix (20 μL total) into PCR tubes.

    [0092] Different PCR primers with distinct barcodes are used for each sample to be pooled.

    6-3. Perform PCR reaction as described below in Table G:

    TABLE-US-00011 TABLE G Cycle number Denature Anneal Extend 1 98° C., 30 s 10-14 98° C., 5 s 67° C., 15 s 72° C., 10 s 1 72° C., 3 min
    7. Size selection (Timing: 50 min) (only applicable to Ribo-seq):
    7-1. Add 5 μL Novex™ Hi-Density TBE Sample Buffer (5×) to each PCR tube.
    7-2. Load sample on an 8% Novex™ TBE Gels and run electrophoresis at 180V for 45 min.

    7-3. Stain the gel in 1×SYBR Gold for 3-5 min.

    [0093] 7-4. Visualize the gel and excise the target PCR product.
    7-5. Recover PCR product in 400 μL DNA gel extraction buffer at 4° C. overnight on with rotation.
    8. QC and sequencing (only applicable to Ribo-seq):
    8-1. Precipitate DNA as described at step 1-7.
    8-2. Dissolve the RNA pallet in 15 μL Nuclease-Free H.sub.2O.
    8-3. Send for QC and sequencing.

    [0094] The following reference list is not an indication that any of the references are material to patentability. [0095] 1. X. Adiconis et al., Nat Methods 15, 505 (2018). [0096] 2. N. T. Ingolia, S. Ghaemmaghami, J. R. Newman, J. S. Weissman, Science 324, 218 (2009). [0097] 3. M. V. Gerashchenko, V. N. Gladyshev, Nucleic Acids Res 42, e134 (2014). [0098] 4. D. A. Santos, L. Shi, B. P. Tu, J. S. Weissman, Nucleic Acids Res 47, 4974 (2019). [0099] 5 N. Hornstein et al., Genome Biol 17, 149 (2016). [0100] 6. A. Turchinovich et al., RNA Biol 11, 817 (2014). [0101] 7. N. T. Ingolia, G. A. Brar, S. Rouskin, A. M. McGeachy, J. S. Weissman, Nat Protoc 7, 1534 (2012). [0102] 8. L. Lama, J. Cobo, D. Buenaventura, K. Ryan, J Biol Methods 6, (2019). [0103] 9. Y. Wang, S. K. Silverman, RNA 12, 1142 (2006). [0104] 10. A. K. Chakravarty, S. Shuman, J Biol Chem 286, 4117 (2011). [0105] 11. B. E. Christian, L. L. Spremulli, Biochim Biophys Acta 1819, 1035 (2012).