Discriminating Parkinson's Disease from Multiple System Atrophy Using Alpha-Synuclein PMCA
20250389732 ยท 2025-12-25
Inventors
Cpc classification
G01N2800/2835
PHYSICS
International classification
Abstract
A method is provided for distinguishing between and/or diagnosing Parkinson's disease (PD) or multiple system atrophy (MSA) in a subject who is exhibiting symptoms associated with both PD and MSA. The method comprises: (A) contacting a biological sample obtained from the subject and comprising soluble, misfolded alpha-synuclein (S) protein with a pre-incubation mixture comprising a monomeric S substrate and an indicator to form an incubation mixture; (B) conducting an incubation cycle two or more times on the incubation mixture to form misfolded S aggregates; (C) subjecting the incubation mixture to excitation and detecting via indicator fluorescence emission the misfolded S aggregates; and (D) diagnosing the subject has having PD or MSA depending on the fluorescence emission intensity. In some aspects, the incubation cycles are conducted in the presence of a bead.
Claims
1-14. (canceled)
15. A method for distinguishing a cerebrospinal fluid (CSF) sample as originating from a human subject having Parkinson's disease (PD) versus originating from a human subject having Multiple System Atrophy (MSA), the method comprising: (A) contacting the CSF sample (i) obtained from the human subject and (ii) comprising soluble, misfolded alpha-synuclein (S) protein, with a pre-incubation mixture, the pre-incubation mixture comprising: (1) a monomeric S substrate; (2) a buffer composition comprising piperazine-N,N-bis(2-ethanesulfonic acid) (PIPES); (3) a salt comprising sodium chloride (NaCl); (4) a fluorescent protein aggregation indicator comprising thioflavin-T (ThT); (5) sarkosyl; and (6) a bead comprising borosilicate glass, to form an incubation mixture; (B) incubating and agitating the incubation mixture to form an incubated mixture comprising misfolded S aggregates; (C) illuminating the incubated mixture with a wavelength of light that excites the fluorescent protein aggregation indicator; and (D) determining a level of fluorescence during incubation, including: (1) determining a maximum fluorescence (Fmax); and (2) determining a time when the fluorescence reaches the Fmax.
16. The method of claim 15, further comprising comparing the Fmax and the time to a positive control of a CSF sample originating from a human subject having neuronal synuclein disease and/or a positive control of a CSF sample originating from a human subject having MSA.
17. The method of claim 15, wherein the determining further includes: (1) determining a maximum slope (Smax) of fluorescence versus time; and (2) determining a time when the Smax occurs.
18. The method of claim 17, further comprising comparing the Smax and the time to a positive control of a CSF sample originating from a human subject having neuronal synuclein disease and/or a positive control of a CSF sample originating from a human subject having MSA.
19. The method of claim 15, wherein the monomeric S substrate comprises SEQ ID NO: 2.
20. The method of claim 15, wherein the bead has a diameter of from about 2.3 mm to about 5 mm.
21. The method of claim 20, wherein the bead has a diameter of about 2.45 mm.
22. The method of claim 15, wherein the pre-incubation mixture comprises two beads, each having a diameter of about 2.45 mm.
23. The method of claim 19, wherein the monomeric S substrate is present in a concentration of about 0.3 mg/mL.
24. The method of claim 15, wherein the buffer composition has a pH of about 6.5.
25. The method of claim 15, wherein the NaCl is present in a concentration of about 300 mM to about 500 mM.
26. The method of claim 15, wherein the ThT is present in a concentration of about 5 M.
27. The method of claim 15, wherein the sarkosyl is present in a concentration of about 0.1%.
28. The method of claim 15, wherein the method is performed at a temperature of about 42 C.
29. The method of claim 15, wherein the fluorescence includes excitation and emission maxima of about 440 nm and about 490 nm, respectively.
30. A method for distinguishing a cerebrospinal fluid (CSF) sample as originating from a human subject having Parkinson's disease (PD) versus originating from a human subject having Multiple System Atrophy (MSA), the method comprising: (A) contacting a CSF sample (i) obtained from the human subject and (ii) comprising soluble, misfolded alpha-synuclein (S) protein, with a pre-incubation mixture, the pre-incubation mixture comprising: (1) a monomeric S substrate comprising SEQ ID NO: 2 in a concentration of about 0.3 mg/mL; (2) a buffer composition comprising about 100 mM piperazine-N,N-bis(2-ethanesulfonic acid) (PIPES) at a pH of about 6.5; (3) a salt comprising sodium chloride (NaCl) in a concentration of about 300 mM to about 500 mM; (4) a fluorescent protein aggregation indicator comprising thioflavin-T (ThT) in a concentration of about 5 M; (5) sarkosyl in a concentration of about 0.1%; and (6) two beads comprising borosilicate glass, each having a diameter of about 2.45 mm, to form an incubation mixture; (B) incubating and agitating the incubation mixture to form an incubated mixture comprising misfolded S aggregates; (C) illuminating the incubated mixture with a wavelength of light that excites the fluorescent protein aggregation indicator; and (D) determining a level of fluorescence during incubation, including: (1) determining a maximum fluorescence (Fmax); and (2) determining a time when the fluorescence reaches the Fmax.
31. The method of claim 30, further comprising comparing the Fmax and the time to a positive control of a CSF sample originating from a human subject having neuronal synuclein disease and/or a positive control of a CSF sample originating from a human subject having MSA.
32. The method of claim 30, wherein the determining further includes: (3) determining a maximum slope (Smax) of fluorescence versus time; and (4) determining a time when the Smax occurs.
33. The method of claim 32, further comprising comparing the Smax and the time to a positive control of a CSF sample originating from a human subject having neuronal synuclein disease and/or a positive control of a CSF sample originating from a human subject having MSA.
34. The method of claim 30, wherein the method is performed at a temperature of about 42 C.
35. The method of claim 30, wherein the fluorescence includes excitation and emission maxima of about 440 nm and about 490 nm, respectively.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0011] The present invention may be more readily understood by reference to the following figures, wherein:
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
DETAILED DESCRIPTION
[0036] A method is provided for distinguishing between and/or diagnosing PD or MSA in a subject who is exhibiting symptoms associated with both PD and MSA. The method comprises: (A) contacting a biological sample obtained from the subject and comprising soluble, misfolded S protein with a pre-incubation mixture, the pre-incubation mixture comprising: (1) a monomeric S substrate; (2) a buffer composition; (3) a salt solution; and (4) an indicator, to form an incubation mixture; (B) conducting an incubation cycle two or more times on the incubation mixture, each incubation cycle comprising: (1) incubating the incubation mixture effective to cause misfolding and/or aggregation of the monomeric S substrate in the presence of the soluble, misfolded S protein; and (2) physically disrupting the incubation mixture effective to break up at least a portion of any misfolded S aggregates formed during the incubating; (C) subjecting the incubation mixture to excitation and detecting via indicator fluorescence emission the misfolded S aggregates; and (D) diagnosing the subject has having PD, MSA, or a spectrum of aspects of both, depending on the fluorescence emission intensity. See, e.g.,
Diagnosis
[0037] The term diagnosis or diagnosing can encompass determining the likelihood that a subject will develop a disease, as well as the existence or nature of a disease in a subject. Diagnosis can also encompass diagnosis in the context of rational therapy, in which the diagnosis guides therapy, including initial selection of therapy, modification of therapy (e.g., adjustment of dose or dosage regimen), and the like.
Subjects
[0038] The terms individual, subject, and patient are used interchangeably irrespective of whether the subject has or is currently undergoing any form of treatment. The term subject generally refers to any vertebrate, including, but not limited to, a mammal. Examples of mammals include primates, including simians and humans, equines (e.g., horses), canines (e.g., dogs), felines, various domesticated livestock (e.g., ungulates, such as swine, pigs, goats, sheep, and the like), as well as domesticated pets (e.g., cats, hamsters, mice, and guinea pigs). Analysis of biological samples from human subjects is of particular interest.
[0039] In some aspects, the subject may be at risk of developing PD, of having PD, or being under treatment for PD; at risk of having a disease associated with dysregulation, misfolding, aggregation, or disposition of S, such as MSA; having a disease associated with dysregulation, misfolding, aggregation, or disposition of S; under treatment for a disease associated with dysregulation, misfolding, aggregation, or disposition of S; and the like.
[0040] The terms treatment, treating, and the like, refer to obtaining a desired pharmacologic or physiologic effect. The effect may be therapeutic in terms of a partial or complete cure for a disease or an adverse effect attributable to the disease. Treatment covers any treatment of a disease in a mammal, particularly in a human, and can include inhibiting the disease or condition, i.e., arresting its development; and relieving the disease, i.e., causing regression of the disease.
Biological Samples
[0041] Aspects of the methods described herein may include the step of obtaining a biological sample from the subject. A biological sample is meant to include any biological sample from a subject that is suitable for analysis for detection of misfolded S aggregates. Suitable biological samples include, but are not limited to, bodily fluids, such as blood-related samples (e.g., whole blood, serum, plasma, and other blood-derived samples), urine, sputum, saliva, urine, CSF, and the like. Another example of a biological sample is a tissue sample. The soluble, misfolded S protein can be assessed either quantitatively or qualitatively, and detection of misfolded S aggregates can be determined either in vitro or ex vivo.
[0042] A biological sample may be obtained by any known means, including needle stick, needle biopsy, swab, and the like. In an example method, the biological sample is a CSF sample, which may be obtained, for example, by lumbar puncture, in which a needle is inserted into the subarachnoid space and CSF is extracted.
[0043] In some aspects, the methods of the invention are carried out on a biological sample that is provided. A biological sample may be fresh or stored. Biological samples may be or have been stored or banked under suitable tissue storage conditions. The biological sample may be a biological sample expressly obtained for the assays as described herein or a sample obtained for another purpose that can be sub-sampled for the assays as described herein. Preferably, if stored, biological samples are either chilled or frozen shortly after collection to prevent deterioration of the sample. For example, CSF samples may be stored in polypropylene tubes at 80 C. CSF samples may be frozen in liquid nitrogen (snap-freezing) or by placing the samples in an environment kept at 80 C., such as a cold-room or freezer.
[0044] The biological sample may be pretreated as necessary by dilution in an appropriate buffer solution, concentrated if desired, or fractionated by any number of methods, including but not limited to, ultracentrifugation, fractionation by fast performance liquid chromatography (FPLC) or HPLC, or precipitation of proteins with dextran sulfate or other methods. Any of a number of standard aqueous buffer solutions at physiological pH, such as phosphate, Tris, or the like, can be used.
Monomeric S Substrate
[0045] As used herein, S may refer to full-length, 140 amino acid alpha-synuclein protein, e.g., S-140. Other isoforms or fragments may include S-126, alpha-synuclein-126, which lacks residues 41-54, e.g., due to loss of exon 3; and S-112 alpha-synuclein-112, which lacks residue 103-130, e.g., due to loss of exon 5. Various S isoforms may include, e.g., S-140, S-126, and S-112.
[0046] In one aspect, the monomeric S substrate comprises, consists essentially of, or consists of wild type or recombinant human S protein having 140 amino acids, having a molecular mass of 14,460 Da, and being represented by the sequence:
TABLE-US-00001 SEQIDNO.1: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYV GSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP DNEAYEMPSEEGYQDYEPEA
[0047] Also included are slightly modified forms of S, such as those including a tag for purification. Thus, in one aspect, the monomeric S substrate comprises, consists of, or consists essentially of a recombinant S protein comprising six additional histidine amino acids (i.e., a polyHis purification tag) on the C-terminus of SEQ ID NO. 1, resulting in a molecular mass of 15,283 Da and being represented by the sequence:
TABLE-US-00002 SEQIDNO.2: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYV GSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP DNEAYEMPSEEGYQDYEPEAHHHHHH
[0048] In some aspects, the monomeric S substrate may be any of the monomeric S substrates disclosed in U.S. Nonprovisional patent application Ser. No. 17/011,374.
[0049] In some aspects, the monomeric S substrate may be expressed and prepared as described in Shahnawaz, M. et al. Development of a Biochemical Diagnosis of Parkinson's Disease by Detection of alpha-Synuclein Misfolded Aggregates in Cerebrospinal Fluid. JAMA Neurol 74, 163-172 (2017), which is incorporated by reference herein in its entirety.
[0050] In some aspects, the monomeric S substrate may be expressed and prepared as described in U.S. Provisional Patent Application No. 63/026,394, which is incorporated by reference herein in its entirety.
[0051] The incubation mixture may include various concentrations of the monomeric S substrate as a function of the total volume of the incubation mixture prior to conducting an incubation cycle. In some aspects, the incubation mixture may include the monomeric S substrate in a concentration, or in a concentration range, of one or more of: between about 500 nM and about 500 M; between about 1 M and about 200 M; between about 5 M to about 100 M; between about 10 M and about 50 M; between about 50 M and about 75 M; about 65 M (i.e., about 1 mg/ml); 65 M; between about 10 M and about 30 M; greater than 10 M and less than 30 M; about 20 M; about 19.6 M (i.e., about 0.3 mg/ml); or 19.6 M.
Buffer Compositions
[0052] The incubation mixture may include various buffer compositions. The buffer composition may be effective to maintain the pH of the incubation mixture in a range from about pH 5 to about pH 9, from about pH 6 to about pH 8, from about pH 6 to about pH 7, from about pH 7 to about pH 8, about pH 7, about pH 7.4, from about pH 6.2 to about pH 6.5, including pH 6.3, 6.4, and 6.5. In some aspects, the incubation mixture comprises one or more of the buffers Tris-HCL, MES, PIPES, MOPS, BES, TES, and HEPES. In some aspects, the incubation buffer comprises PIPES in a concentration of about 100 mM, about 500 mM, about 600 mM, or about 700 mM.
Salt Solutions
[0053] In some aspects, the incubation mixture comprises salt in a given concentration. The salt may, for example, enhance signal to noise ratio in fluorescence detection. In one aspect, the salt comprises NaCl. Other suitable salts may include KCl. In one aspect, the salt, e.g., NaCl, may be present in a concentration of about 50 mM to about 1,000 mM, about 50 mM to about 500 mM, about 50 to about 150 mM, about 150 mM to about 500 mM, about 50 mM, about 150 mM, about 300 mM, about 500 mM, about 600 mM, or about 700 mM. In one aspect, the salt, e.g., NaCl, is present in a concentration of about 500 mM.
Indicators
[0054] In some aspects, the method includes the step of contacting the incubation mixture with a protein aggregation indicator to determine if a detectable amount of misfolded S aggregate is present in the incubation mixture. The protein aggregation indicator can be characterized by exhibiting an indicating state in the presence of misfolded S aggregate and a non-indicating state in the absence of misfolded S aggregate. Determining the presence of the soluble, misfolded S protein in a biological sample may include detecting the indicating state of the indicator of misfolded S aggregate. The indicating state of the indicator and the non-indicating state of the indicator may be characterized by a difference in fluorescence. Thus, the step of determining the presence of the soluble, misfolded S protein in a biological sample may include detecting the difference in fluorescence. In some aspects, a molar excess of the indicator may be used, the molar excess being, for example, greater than a total molar amount of the monomeric S substrate and the soluble, misfolded S protein in the incubation mixture.
[0055] In some aspects, the protein aggregation indicator may include one or more of: Thioflavin-T (ThT), Congo Red, m-I-Stilbene, Chrysamine G, PIB, BF-227, X-34, TZDM, FDDNP, IMPY, NIAD-4, luminescent conjugated polythiophenes, a fusion with a fluorescent protein such as green fluorescent protein and yellow fluorescent protein, derivatives thereof, and the like. A suitable protein aggregation indicator is ThT.
Incubation Conditions
[0056] The incubation mixture may be held within a suitably sized container, such as a multi-well plate having a plurality of wells. For example, the multi-well plate may include 96 wells. The wells of the multi-well plate may have a volume of from 100 L to 1000 L, from 150 L to 750 L, or from 200 L to 350 L. In some aspects of the invention, each well of the multi-well plate includes a single bead.
[0057] A variety of temperatures are suitable for carrying out the incubation cycles. The temperature of the incubation mixture, in each incubation cycle, at a temperature in C., can independently be about 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or a range between any two of the preceding values, for example, between about 15 C. and about 50 C., or between about 25 C. and about 45 C., or between about 30 C. and about 42 C. In some aspects, the incubation is carried out at about normal physiological temperatures for a warm-blooded animal. In further aspects, incubating the incubation mixture is conducted at a temperature between about 35 C. and about 40 C. or between about 37 C. and about 42 C.
[0058] Misfolded S aggregates refer to non-covalent associations of protein including soluble, misfolded S protein. Misfolded S aggregates may be de-aggregated, broken up, or disrupted to release smaller fragments or aggregates, e.g., soluble, misfolded S protein and fragmented fibrils. The catalytic activity of a collection of misfolded S aggregate seeds may scale, at least in part, with the number of seeds in a mixture. Accordingly, disruption of misfolded S aggregates in a mixture to release soluble, misfolded -S protein and fragmented fibrils seeds may lead to an increase in catalytic activity for aggregation of monomeric S substrate.
[0059] In several aspects, de-aggregating the incubation mixture may include one or more types of physical disruption selected from: shaking, sonication, stirring, freezing/thawing, laser irradiation, autoclave incubation, high pressure, homogenization, and the like. Shaking may include cyclic agitation, such as orbital agitation. The cyclic agitation may be conducted between about 50 rotations per minute (RPM) and 10,000 RPM. The cyclic agitation may be conducted between about 200 RPM and about 2000 RPM. The cyclic agitation may be conducted at about 500 RPM or about 600-800 RPM. De-aggregation of the incubation mixture may be conducted after each incubation cycle for between about 5 seconds and about 10 minutes, between about 30 seconds and about 1 minute, between about 45 seconds and about 1 minute, for about 1 minute, and the like.
[0060] The steps of incubating and de-aggregating the incubation mixture are repeated a number of times sufficient to amplify the soluble, misfolded S protein of the sample to provide a detectable amount of misfolded -S aggregate. The two steps of incubating the incubation mixture and de-aggregating the incubation mixture are referred to herein as the incubation cycle. The incubation cycle may be repeated between about two times and about 1000 times, between about five times and about 500 times, between about 50 times and about 500 times, between about 150 times and about 250 times, and the like. In one aspect, for the final round of the incubation cycle, it may be advantageous to skip the de-aggregation step before performing the detecting step.
[0061] The incubation cycle may be carried out for a time between about 1 minute and about 5 hours, between about 10 minutes and about 2 hours, between about 15 minutes and about 1 hour, between about 25 minutes and about 45 minutes, and the like. In some aspects, incubating the incubation mixture and de-aggregating at least a portion of the misfolded S aggregate comprise an incubation cycle lasting from 0.3 to 1 hours. Each incubation cycle may include independently incubating and de-aggregating the incubation mixture for one or more of: incubating between about 1 minute and about 5 hours and de-aggregating between about 5 seconds and about 10 minutes; incubating between about 10 minutes and about 2 hours and de-aggregating between about 30 sec and about 1 minute; incubating between about 15 minutes and about 1 hour and de-aggregating between about 45 seconds and about 1 minute; incubating between about 25 minutes and about 45 minutes and de-aggregating between about 45 seconds and about 1 minute; and incubating about 1 minute and de-aggregating about 1 minute.
Detection
[0062] The method of diagnosis includes repeating the steps of incubating and de-aggregating the incubation mixture a number of times necessary to amplify sufficient soluble, misfolded S protein present in the biological sample to provide an amplified incubation mixture having a detectable amount of misfolded S aggregate. The incubation mixture may then be contacted with a fluorescent aggregation indicator, and the level of fluorescence of the amplified incubation mixture may be determined. Analysis of the amplified soluble, misfolded S protein can discriminate between different types of neurological disorders.
[0063] The method includes the step of contacting the incubation mixture with a fluorescent aggregation indicator to provide a fluorescent response that can determine if a subject having a neurological disorder has PD, MSA, or a spectrum of aspects of both. The fluorescent aggregation indicator can be characterized by exhibiting an indicating state in the presence of misfolded S aggregate and a non-indicating state in the absence of misfolded S aggregate.
[0064] A suitable fluorescent aggregation indicator is ThT, which is also known as Basic yellow 1. When ThT is added to samples containing 3-sheet-rich deposits, such as the cross--sheet quaternary structure of amyloid fibrils, ThT fluoresces strongly with excitation and emission maxima at about 435 nm (or about 440 nm, depending on the fluorometer or spectrofluorometer) and about 485 nm (or about 490 nm, depending on the fluorometer or spectrofluorometer), respectively.
[0065] ThT fluorescence is typically measured by fluorescence spectroscopy using a filter fluorometer or spectrofluorometer. In some aspects, the ThT fluorescence emission intensity may be compared to the level of a corresponding control sample when carrying out the analysis to quantify the amount of soluble, misfolded S protein in the biological sample.
[0066] Once the ThT fluorescence level has been determined, it can be displayed in a variety of ways. For example, the levels can be displayed graphically on a display as numeric values, proportional bars (i.e., a bar graph), or any other display method known to those skilled in the art.
[0067] Fluorescence intensity is generally proportional to the concentration of the fluorophore. However, the inventors have discovered that the fibrils and/or plaque present in a subject having PD exhibit increased fluorescence relative to the fluorescence generated by the fibrils and/or plaque present in other neurological disorders. Accordingly, in some aspects, the method diagnoses the subject as having PD if the level of fluorescence is higher than that seen for fibrils and/or plaques found in control subjects and/or in subjects having a neurological disorder other than PD (e.g., other synucleinopathies, such as MSA).
[0068] In some aspects, a diagnosis of PD is provided if the level of fluorescence detected is above a certain threshold. In other aspects, the subject is diagnosed as having PD if the detected fluorescence falls within a certain range.
[0069] In some aspects, a diagnosis of MSA is provided if the level of fluorescence detected is above a certain threshold. In some aspects, a diagnosis of MSA is provided if the level of fluorescence detected is below a certain threshold. In other aspects, the subject is diagnosed as having MSA if the detected fluorescence falls within a certain range.
[0070] Thus, in some aspects, the initial average fluorescence (AF.sub.i) is determined, which for a given sample is the average fluorescence over a period of time less than the period of time necessary for the monomeric S substrate to form a detectable amount of misfolded S aggregates in the presence of soluble, misfolded -S protein present in the sample. For example, in some aspects, determination may be accomplished by detecting fluorescence in the sample periodically over the first 10 hours of incubation cycles. The standard deviation (SD.sub.i) of AF.sub.i should then be calculated. Once AF.sub.i and SD.sub.i have been determined, the maximum fluorescence (Fmax) of the particular sample after the monomeric S substrate has formed a detectable amount of misfolded S aggregates in the presence of soluble, misfolded -S protein present in the sample should be determined. In one aspect, at an excitation of 435 nm and an emission of 485 nm, if the Fmax is from about 22.2SD.sub.i+AF.sub.i to 250SD.sub.i+AF.sub.i, the patient is diagnosed as having MSA. If the Fmax is above 250SD.sub.i+AF.sub.i, the patient is diagnosed as having PD. In another aspect, at an excitation of 440 nm and an emission of 490 nm, if the Fmax is from about 9.6SD.sub.i+AF.sub.i to 180SD.sub.i+AF.sub.i, the patient is diagnosed as having MSA. If the Fmax is above 180SD.sub.i+AF.sub.i, the patient is diagnosed as having PD.
Neurological Disorders and Synucleinopathies
[0071] A method is provided for diagnosing PD, MSA, or a spectrum of aspects of both in a subject having a neurological disorder. A neurological disorder is any disorder of the nervous system. Examples of neurological disorders include movement disorders such as PD, autonomic nervous system diseases such as MSA, and neuropsychiatric illnesses such as Alzheimer's disease.
[0072] In some aspects, the neurological disorder is a synucleinopathy. Synucleinopathies are neurodegenerative diseases characterized by the abnormal accumulation of aggregates of S in cells of the nervous system such as neurons, nerve fibers, and glial cells. Examples of synucleinopathies include PD, MSA, dementia with Lewy bodies, and neuroaxonal dystrophies. In some aspects, the synucleinopathy has symptoms associated with both PD and MSA, including impaired cognition, sleep disorders, and gastrointestinal tract dysfunction.
[0073] In some aspects, the sample may be taken from a subject exhibiting no clinical signs of PD or MSA. In other aspects, the biological sample may be taken from a subject exhibiting clinical signs of PD, MSA, or both. The most recognizable symptom of PD is motor-related dysfunction. However, additional symptoms include autonomic dysfunction, neuropsychiatric problems (mood, cognition, behavior, or thought alterations), sensory dysfunction (especially altered sense of smell), and sleep difficulties.
[0074] In some aspects, the method includes treating a subject diagnosed as having PD with treatment for PD and/or its symptoms. Deep brain stimulation can be used to reduce motor symptoms associated with PD. Drugs useful for treating the motor symptoms of PD include levodopa, dopamine agonists, and monoamine oxidase B inhibitors. However, additional treatments for PD continue to be developed. See Radhakrishnan D M, Goyal V, Neurol India., 66(Supplement):S26-S35 (2018) and Iarkov et al., Front Aging Neurosci., 12:4 (2020).
Supplemental Diagnostic Tests
[0075] In some aspects, the method may further comprise additional tests to confirm the -PMCA-based diagnosis, that is, to further distinguish the misfolded S aggregates from a patient having PD after S-PMCA from the misfolded S aggregates from a patient having MSA after S-PMCA. Examples of additional tests include the use of ligands having a high affinity for one of PD or MSA misfolded S aggregates, creating a profile of protease-resistant fragments from the misfolded S aggregate, and evaluating the structure of the detected misfolded S aggregate using CD, FTIR, or cryo-ET.
[0076] Examples have been included to more clearly describe a particular aspect of the invention and its associated advantages. However, there are a wide variety of other aspects within the scope of the present invention, which should not be limited to the particular example provided herein.
EXAMPLES
A. Discriminating S Strains in PD and MSABlinded Study
[0077] To demonstrate that PD and MSA can be differentiated with high specificity and high sensitivity by S-PMCA, a blinded study was conducted using CSF samples from PD, from MSA, and from HC.
1. Patient Samples
[0078] CFS samples were obtained from 94 patients clinically diagnosed with PD, 75 with MSA, and 56 HC collected from people with other neurological diseases (epilepsy, cervical spondylosis, polyneuropathy, muscular dystrophy, viral myositis, myelopathy, and hydrocephalus). Table 1 displays a summary of the demographic characteristics of the patients.
TABLE-US-00003 TABLE 1 Overall demographics of PD, MSA, and control individuals studied. Healthy Controls Multiple System Parkinson's Disease (HC) Atrophy (MSA) (PD) Number of 56 75 94 samples Age (Mean 60.14 10.18 59.67 6.9 66.78 7.91 SD) Sex (M, F) M = 28 F = 28 M = 56 F = 19 M = 59 F = 36 Disease N/A 3.847 2.6 8.13 4.7 Duration (Mean SD)
[0079] Most samples were collected at the Mayo Clinic. The clinical diagnoses of probable PD and MSA were made according to internationally standardized criteria, including the UK Brain Bank guidelines. CSF samples were collected in the morning using polypropylene tubes following lumbar puncture at the L4/L5 or L3/L4 interspace with atraumatic needles after overnight fasting. The samples were centrifuged at 3,000g for 10 min at room temperature, aliquoted, and stored at 80 C. until analysis. Blood cell (red and white) counts, glucose, protein, and hemoglobin concentration were determined.
[0080] Brain tissue from PD and MSA patients was obtained from Banner Sun Health Research Institute. Control brain tissue was supplied by NDRI (National Human Tissue Resource Center). Frozen frontal cortex samples were homogenized using a tissue grinder in 10% w/v ice-cold PBS (HyClone, Cat No. SH30256.01) with Complete protease inhibitor cocktail (Roche). Presence of S aggregates was confirmed by immunohistochemistry in free-floating sections using the anti-phosphorylated S monoclonal antibody pSyn #64 (1:2,000; Wako) that recognizes S phosphorylated at Ser129, as well as by thioflavin-S staining. Human samples were manipulated following the universal precautions for working with human specimens and as directed by the Institutional Review Board of The University of Texas Health Science Center at Houston (HSC-MS-14-0608).
2. Expression and Preparation of Seed-Free S
[0081] The pET-21b plasmid carrying the coding DNA sequence for human S containing a polyHis-tag at the C-terminal (i.e., SEQ ID NO: 2) was overexpressed in BL2(DE3) pLysS (Invitrogen) E. coli at 25 C. using 0.1 mM IPTG (isopropyl -D-thiogalactoside) for 6 h. The bacterial pellets were lysed in 50 mM NaH.sub.2PO.sub.4 (pH 8.0), 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, 0.1 mM TCEP [tris-(2-carboxyethyl) phosphine], and 1 mg/ml lysozyme, followed by sonication on ice. The lysate was centrifuged at 12,000g for 15 min at 4 C., followed by ultracentrifugation at 100,000g for 30 min at 4 C. The supernatant was filtered through 0.45 m filter and loaded onto a nickel-affinity column (Nickel Sepharose Fast flow, GE Healthcare). Proteins were eluted using 250 mM imidazole, and monomeric S substrate-containing fractions were dialyzed overnight at 4 C. against Phosphate Buffered Saline (PBS) pH 7.4. To remove any preformed seeds or aggregates, the protein solution was filtered through a 100-kDa cutoff filter (Amicon Ultra from Millipore), separated into small aliquots, and stored at 80 C. until use. Protein concentration was determined by BCA Assay (Pierce). Purity of the protein was evaluated by silver staining.
3. S-PMCA
[0082] Samples of seed-free S (SEQ ID NO: 2) at a concentration of 1 mg/mL (i.e., about 65 M) in 100 mM PIPES, pH 6.5, 500 mM NaCl, were placed in opaque 96-well plates (Costar, REF 3916) in the presence of 5 M of ThT at a final volume of 200 L. For each test, 40 L of CSF from patients and controls or 40 L of brain homogenate (at a final concentration of 0.001%) were used. Positive controls consisted of a well-documented and previously screened healthy CSF sample spiked with pre-formed S oligomeric seeds. Samples were subjected to cyclic agitation (1 min at 500 rpm followed by 29 min without shaking) at 37 C. The increase in ThT fluorescence was monitored at excitation of 435 nm and emission of 485 nm, periodically, using a microplate spectrofluorometer Gemini-EM (Molecular Devices, Sunnyvale, CA).
[0083] For serial rounds of amplification, an aliquot from the amplified material was diluted 100-fold into fresh monomeric S substrate, and a new S-PMCA assay was performed otherwise using the same conditions as above. This was repeated three consecutive times to obtain materials corresponding to second (R2), third (R3), and fourth (R4) rounds of amplification. The first round of amplification corresponds to the one initiated with the biological samples (CSF or brain homogenate).
[0084] Samples at the end of the PMCA reaction were centrifuged at 20,000g for 30 min at 4 C. The resultant supernatants were separated from the pellets. The amount of aggregated product was measured in all samples by three alternative procedures: (1) Protein quantity in pellets was measured by silver staining after SDS-PAGE; (2) dot blot analysis of sedimented materials; and (3) BCA measurements of total protein content in the supernatant fraction. For SDS-PAGE, pellets were re-suspended in PBS and separated on 12% Bis-Tris gel, and protein bands were visualized by silver staining as per the manufacturer's protocol. For dot blot, 2 L of re-suspended pellets was spotted onto nitrocellulose membranes (Amersham Biosciences, Germany) and air dried for 30 min at room temperature. Blots were blocked with 5% w/v nonfat dry milk in Tris-buffered saline-Tween 20 (TBS-T, 20 mM Tris, pH 7.2, 150 mM NaCl, and 0.05% (v/v) Tween 20) at room temperature for 2 h. The membranes were probed with anti-S antibody (BD Bioscience; 1:2000) and anti-rabbit horseradish peroxidase-conjugated secondary antibodies (1:5000). The blots were visualized using enhanced chemiluminescence plus western blotting detection kit (Amersham Biosciences, Piscataway, NJ). Finally, protein concentration in supernatants was determined by BCA assay kit as per the manufacture's protocol.
[0085] As shown in
[0086] The above data was obtained in different cohorts of patients collected across distinct experiments. To illustrate the typical profile of S-PMCA aggregation for PD and MSA samples, the largest individual cohort of samples analyzed in
[0087] To determine whether the aggregates present in CSF represent those found in the brain, brain samples from three PD or MSA patients were amplified. To avoid interference from other brain components in the reaction, the PMCA assay was started with a 10.sup.4 dilution of brain homogenate. Under these conditions, amplification of brain-derived S aggregates showed the typical signature of PD or MSA, both in terms of the maximum ThT fluorescence (
4. Serial S-PMCA Amplification
[0088] The qualitative differences in ThT fluorescence were maintained when the S-PMCA reaction products (e.g., misfolded S aggregates) amplified from PD or MSA CSF were replicated serially at the expense of monomeric S substrate (
[0089] To further study the properties of the misfolded S aggregates amplified from PD or MSA patients, sufficient material was generated from the second round of amplification from 43 PD and 43 MSA samples. The selection of the 43 samples from each disease was performed by eliminating the samples that did not aggregate (false negatives) and including those that have the typical PD or MSA signatures, as indicated above (
5. Measurement of Protein Concentration in the Aggregated Product after Amplification
[0090] To rule out that the differences in ThT fluorescence simply reflect distinct amounts of misfolded S aggregates at the end of the reaction, sedimentation assays were performed to separate the pools of soluble and aggregated S. The amount of protein pelleting after centrifugation at 20,000g for 30 min was measured using silver staining after SDS-PAGE and dot blot analysis. The amount of protein remaining in the supernatant was measured using the BCA kit. The amount of aggregates produced at the end of the S-PMCA assay was the same in both PD and MSA samples. Thus, either the accessibility or the mode of interaction of ThT with PD or MSA aggregates is distinct and reflects the structural differences between them.
6. Interaction of S Aggregates with Thiophene-Based Ligands
[0091] A panel of thiophene-based ligands was used to study in more detail the differences between PD and MSA aggregates. The conjugated thiophene backbone is flexible, and thus, the binding and fluorescence emission of the molecules depends on the conformational properties of the aggregates, providing a specific spectral fingerprint of different aggregates.
[0092] Thus, seven different thiophene-based ligands (p-FTAA, h-FTAA, HS-68, HS-167, HS-169, HS-194 and HS-199) were analyzed. The compounds were synthetized and characterized as described previously (Shirani et al., Chemistry 23, 17127-17135 (2017); Shirani, et al., Chemistry 21, 15133-15137 (2015)), or as outlined below for compound HS-199. The stock solution for each compound was prepared in de-ionized water or DMSO at 1.5 mM. These stocks were diluted to reach a final concentration of 150 M.
[0093] The thiophene-based ligands showed substantially different capacities to interact with S aggregates derived from PD and MSA samples (
7. Synthesis and Characterization of HS-199
[0094] A mixture of Methyl 5-bromo-[2,2-bithiophene]-5-carboxylate (140 mg, 0.462 mM) (a below), (5-formylthiophen-2-yl)boronic acid (80 mg, 0.508 mM) (b below), K.sub.2CO.sub.3 (192 mg, 1.39 mmol) in 1,4-dioxane/methanol (8:2, 8 mL/mM, degassed), and PEPPS-IPr (2 mol %) was heated to 80 C. for 30 min. After cooling to room temperature, the pH was adjusted to 4 by 1 M HCl, and the residue was extracted with DCM (320 ml/mM), washed with water (320 ml/mM), and washed with brine (30 ml). The combined organic phase was dried over MgSO.sub.4, and the solvent was evaporated. The residue was subjected to column chromatography using CH.sub.2Cl.sub.2, followed by crystallization from DMF to yield a trimer (c below) as a yellow solid (115 mg, 74%). A few drops of pyridine were added to a cold solution of the trimer (0.05 g, 0.150 mM) and 2-methyl-3-alkylbenzothiazolium salt (d below) (46 mg, 150 mM) in an anhydrous mixture of MeOH/THF (8:2). The mixture was refluxed until completion of the reaction (monitored by TLC, eluent: DCM/MeOH 1%). The solvent was evaporated under vacuum to provide a dark red solid, which was crystallized from MeOH. The red crystals were collected by filtration, washed with cold MeOH, and dried in vacuum to afford HS-199 as a dark red solid (53 mg, 57%).
##STR00001##
[0095] The compound was characterized by infra-red (IR) spectroscopy, NMR, and mass spectrometry. IR (neat) 1697, 7594, 1582, 1525, 1446, 1421, 1304, 1245, 1210, 1165, 1098, 1054, 1035, 926, 806, 786, 758, 744 cm.sup.1. .sup.1H NMR (300 MHz, DMSO-d6) 8.48-841 (m, 2H), 8.27 (d, J=8.6 Hz, 1H), 7.97 (d, J=3.9 Hz, 1H), 7.91-7.58 (m, 7H), 7.50 (d, J=3.9 Hz, 1H), 4.92 (q, J=7.0 Hz, 2H), 3.85 (s, 3H), 1.47 (t, J=7.0 Hz, 3H). .sup.13C NMR (75 MHz, DMSO-d6) 170.53, 161.43, 143.01, 142.17, 140.89, 140.83, 138.37, 137.10, 136.14, 136.01, 134.89, 131.30, 129.48, 28.26, 128.16, 127.79, 127.69, 126.66, 125.58, 124.38, 116.44, 111.21, 52.41, 44.29, 14.14. MALDI-TOF: m/z calculated for C.sub.25H.sub.20NO.sub.2S.sub.4(M+H).sup.+: 495.0. Found: 495.0.
8. Protease Digestion and Epitope Mapping
[0096] To analyze biochemical differences between PD- and MSA-derived S aggregates, experiments were performed to test resistance to proteolytic degradation and epitope mapping. Thus, samples containing S aggregates amplified by PMCA were treated with different concentrations of proteinase K (PK) at 37 C. for 1 h. The reaction was stopped by heating the sample in NuPAGE LDS buffer at 95 C. for 10 min. The digested products were resolved by 12% Bis-Tris gels (Invitrogen). Proteins were electrophoretically transferred to nitrocellulose membranes (Amersham Biosciences). Membranes were blocked with 5% w/v nonfat dry milk in phosphate-buffered saline-Tween 20 (PBS (Hyclone SH.30258.02, pH 7.2, 0.1% (v/v) Tween 20) at room temperature for 1 h. After blocking, the membranes were probed with the following antibodies: N-19 from Santa Cruz, reactive against the N-terminus (residues 1-50) of Syn (
[0097] S aggregates derived by seeding/amplification from the CSF of patients affected by PD or MSA differed in the extent of protease resistance and the size of the core fragment resistant to degradation, as analyzed by a panel of different sequence antibodies (
[0098] The size and number of protease resistant bands detectable by antibodies directed to the middle region (residues 15-123) of the S aggregates substantially differed between PD and MSA products. Four bands with molecular weights ranging between 4-10 kDa were detected for PD vs. only two bands (4 and 6 kDa) for MSA samples (
9. Circular Dichroism (CD)
[0099] Secondary structures were studied by CD. Solutions containing 35 M of S aggregates amplified by S-PMCA were used. CD spectra were recorded at room temperature using a JASCO J815 spectropolarimeter, with 1 mm path length cuvette. CD data was collected at 0.1 nm resolution and at a 200 nm/min scan speed. The portion of the CD spectrum between 250-350 nm was fit with a quadratic function, and the baseline of the whole spectrum was calculated using the function. The calculated baseline was subtracted from the CD spectrum to obtain baseline-corrected CD spectrum.
[0100] The CD spectroscopy showed that both PD and MSA aggregates exhibit a predominant 3-sheet structure, as illustrated by a negative peak at around 220 nm (
10. Fourier-Transformed Infrared Spectroscopy (FTIR)
[0101] To confirm the CD results using a different methodology, the secondary structure composition was estimated by FTIR spectroscopy of a randomly selected group of 10 PD and 10 MSA samples. FTIR experiments were conducted in an FT/IR-4100 spectrometer from JASCO. The product of S-PMCA (5 L) was placed on the top of a diamond PR0450-S Attenuated Total Reflectance unit from JASCO adapted to the FT/IR-4100 system. System parameters included 4.0 cm.sup.1 resolution and an accumulation of 80 scans per sample. The data were processed using cosine apodization and Mertz phase correction. The data were also corrected for attenuated total reflectance and carbon dioxide vapor absorption.
[0102] The results for MSA derived aggregates showed spectra dominated by parallel 3-sheet structure (peak at 1640 cm.sup.1). For PD-derived aggregates, there was also another clear peak at 1652 cm.sup.1, which can be assigned to either an -helix or a random coil (
11. Cryo-Electron Tomography (Cryo-ET) Analysis and 3D Reconstructions
[0103] To gain further insight into the structures of both S species, cryo-ET studies were performed. Cryo-ET takes multiple shots in the same area by tilting the sample in a series of angles. A 3D tomogram can be directly reconstructed from the multiple tilt series. To increase tomographic image contrast, the fibrils amplified from the CSF of patients affected by PD and MSA were negatively stained. 17 and 22 tilt series were taken for PD and MSA specimens, respectively.
[0104] The product of S-PMCA derived from the CSF of PD or MSA samples subjected to two rounds of amplification was sedimented at 20,000g for 30 minutes at 4 C., resuspended in 100 mM PIPES, pH 6.5, 500 mM NaCl, diluted 10-fold in deionized water, and loaded onto Formvar/Carbon Copper grids. Samples were negatively stained with 2% uranyl acetate and rapidly frozen in liquid ethane, using a gravity-driven plunger apparatus. Materials were imaged at 170 C. using a Polara G2 electron microscope (FEI Company) equipped with a field emission gun and a direct detection device (Gatan K2 Summit). The microscope was operated at 300 kV with a magnification of 15,500. SerialEM (Mastronarde, D. N., J Struct Biol 152, 36-51 (2005)) was used to collect tomographic tilt series at 6 m defocus with cumulative doses of 200 e.sup./.sup.2. For each dataset, 35 image stacks were collected in a range from 51 to +51, using increments of 3. Each stack contained about 10 images, which were first aligned using MotionCor2. The tomograms were reconstructed using IMOD software and were further processed by EMAN software.
[0105] The helical models were manually built based on individual fibril density. The twist lengths of fibrils vary from one to another. Helical parameters (diameter and the twist lengths), which can be directly measured from the center slice of the tomogram in X-Y plane, were used to build a helical model. Instead of creating a mathematical helical model based on the two parameters, the helical model was manually built by tracing the filament density using Chimera software. Model dots were placed along the densities, followed by manual adjustment of the dot positions to make the model shape helix-like under the restriction of cryo-ET density.
[0106] The tomograms (
12. Cytotoxicity Assays
[0107] To explore if S aggregates derived from the CSF of PD or MSA patients have biological differences, their toxicity in cell culture was studied. For these experiments, RK13 and a human neuronal precursor cells differentiated from induced pluripotent stem cells (iPSCs) were used. iPSCs and neuronal precursors were generated and characterized from fibroblasts obtained from a healthy individual. Cytotoxicity was tested by incubating the cells with different concentrations of S aggregates derived from PD or MSA CSF.
[0108] Thus, RK13 cells (rabbit kidney cell line, ATCC CCL-37) were grown in DMEM media supplemented with 10% FBS 1 GLUTAmax, 1MEM, 1 mM sodium pyruvate. For toxicity, 10,000 cells were plated without antibiotic in a 96-well plate and incubated at 37 C. for 24 h. Neuronal precursors derived from human iPSCs were generated and characterized as previously described. Armijo et al., Neurosci. Lett 639, 74-81 (2017). These cells were maintained in neural precursor expansion medium. Approximately 20,000 cells were plated per well in a 96-well plate, precoated with Geltrex LDEV-free reduced growth factor basement membrane matrix treated dishes (1:100, Invitrogen), and incubated at 37 C. for 24 h. After 24 h, cells were treated for either 24 h (RK 13 cells) or for 48 h (neuronal precursors) with different concentrations of amplified S fibrils originated from CSF samples of MSA and PD patients. Cell viability was determined by the MTT assay, following the manufacturer's protocol.
[0109] MSA aggregates produced highly significant toxicity in RK13 cells, even at concentrations of 1.25 M, whereas PD derived aggregates began to show significant toxicity only at 5 M (
B. Discriminating S Strains in PD and MSA Using Beads
1. S-PMCA of PD and MSA CSF Samples
[0110] PD and MSA CSF samples were run under the following conditions:
TABLE-US-00004 Parameter Fast Assay (FA) Buffer ([ ] (mM) and pH) 100 mM PIPES pH 6.5 [Sigma, cat# 80635-50G] [NaCl] (mM) 500 [Lonza, cat# 51202] ThT (M) 10 [Sigma, cat# T3516-25G] Substrate Recombinant C-terminal histag Syn (MW = 15,283 mg/mmol) (SEQ ID NO: 2) [substrate] (M) 19.6 M [substrate] (mg/mL) 0.3 (19.6 M) CSF sample (L) 40 Shaking type Orbital Shaking speed (rpm) 800 Shaking time (min) 1 Incubation time (min) 29 Beads material Si.sub.3N.sub.4 Beads size (mm) 2.38 (3/32) Amount of beads 1 (ea) Temperature ( C.) 37 Reaction volume (L) 200
[0111] The beads are manufactured by Tsubaki-Nakashima. The beads were blocked with a solution of bovine serum albumin (BSA) in PIPES (1% BSA in 100 mM PIPES pH 6.50) prior to use.
[0112] The assay was assembled in 96 well ELISA plates [Corning, cat #3916]. One bead was added to each well, and the plate was covered with a pierceable optical film [Excel Scientific, cat #XP-100] to avoid cross-contamination while preparing the assay. After all of the PMCA reactions were pipetted into the plate, the pierceable optical film was removed, and a fluorescent-compatible film was used to cover the plate (Applied Biosystems, cat #4311971).
[0113] The plate was transferred to a FLUOstar Omega Microplate Reader [BMG], an instrument that shakes, incubates, and reads fluorescence automatically. The plate was orbitally shaken at 800 rpm for 1 minute, read (440-10 excitation and 490-10 emission), and incubated at 37 C. The plate was shaken for 1 minute every 29 minutes, which constitutes an S-PMCA cycle of 30 minutes.
[0114]
2. Serial S-PMCA Amplification of PD and MSA CSF Samples
[0115] The qualitative differences in ThT fluorescence were maintained when the S-PMCA reaction products (e.g., misfolded S aggregates) amplified from PD or MSA CSF were replicated serially at the expense of monomeric S substrate. For these studies, 0.6 L of the products (e.g., misfolded S aggregates) of a first round of bead-assisted S-PMCA on the CSF of a PD or MSA patient presenting pure PD or MSA pathology were used to seed a second round of S-PMCA. More specifically, the second round of S-PMCA was performed exactly as in the previous example, except that 39.4 L of CSF was used, plus 0.6 L of the seed, instead of 40 L of CSF. For PD and MSA, the product maintained the relatively high fluorescence signal for PD and relatively low fluorescence for MSA (
3. S-PMCA and Serial Amplification of an MSA Sample Presenting a Spectrum of Pathologies
[0116]
4. PK Digestion of the S-PMCA Products (e.g., Misfolded S Aggregates) of Replicates a2 and a3 from
[0117] The S-PMCA products of replicates a2 and a3 from
[0118] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
[0119] Where a range of values is provided, each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
[0120] The term about in conjunction with a number is intended to include 10% of the number. This is true whether about is modifying a stand-alone number or modifying a number at either or both ends of a range of numbers. In other words, about 10 means from 9 to 11. Likewise, about 10 to about 20 contemplates 9 to 22 and 11 to 18. In the absence of the term about, the exact number is intended. In other words, 10 means 10.
[0121] The singular forms a, and, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a sample also includes a plurality of such samples and reference to a monomeric S substrate includes reference to one or more such molecule, and so forth.
[0122] The complete disclosure of all patents, patent applications, and publications, and electronically available material cited herein are incorporated by reference, whether or not the specific citation herein so states. The foregoing detailed description and examples have been given for clarity of understanding only. No unnecessary limitations are to be understood therefrom. The invention is not limited to the exact details shown and described, for variations obvious to one skilled in the art will be included within the invention defined by the claims.