RSV VIRUS-LIKE PARTICLES AND METHODS OF USE THEREOF
20260000750 ยท 2026-01-01
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
A61K39/39
HUMAN NECESSITIES
International classification
A61K39/39
HUMAN NECESSITIES
Abstract
The present disclosure relates to virus-like particles and vaccine compositions for inducing immunity and preventing respiratory syncytial virus (RSV) infection.
Claims
1. A virus like particle (VLP) comprising a respiratory syncytial virus (RSV) M protein and an RSV M2-1 protein.
2. The VLP of claim 1, wherein the VLP comprises one or more additional RSV proteins.
3. The VLP of claim 1, wherein the VLP comprises an RSV F protein.
4. The VLP of claim 3, wherein the RSV F protein is selected from a group consisting of a pre-fusion form of the RSV F protein, a post-fusion form of the RSV F protein, and a carbonyl terminal portion of the RSV F protein.
5. The VLP of claim 3, wherein the RSV F protein comprises a sequence selected from the group consisting of SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, and SEQ ID NO: 37.
6. The VLP of claim 3, wherein the carbonyl terminal portion of the RSV F protein comprises a sequence of SEQ ID NO: 32.
7. The VLP of claim 1, wherein the VLP comprises an RSV G protein.
8. The VLP of claim 7, wherein the RSV G protein is from RSV group A or RSV group B.
9. The VLP of claim 7, wherein the RSV G protein comprises a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21.
10. The VLP of claim 1, wherein the VLP comprises a recombinant RSV G protein.
11. The VLP of claim 10, wherein the recombinant RSV G protein comprises a transmembrane domain of an RSV G protein and a central conserved domain of the RSV G protein.
12. A vaccine comprising the VLP of claim 1.
13. The vaccine of claim 12, further comprising an adjuvant.
14. A method of inducing immunity to RSV infection or at least one symptom thereof in a subject, comprising administering one or more effective doses of the vaccine of claim 12.
15. The method of claim 14, wherein the one or more effective doses of the vaccine are administered to the subject via a route that is selected from the group consisting of an intramuscular route, a subcutaneous route, an intradermal route, an oral administration, a nasal administration, and inhalation.
16.-27. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0016] The accompanying figures, which are incorporated in and constitute a part of this specification, illustrate several aspects described below.
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
DETAILED DESCRIPTION
[0026] RSV is a single-stranded, negative sense RNA virus belonging to Paramyxoviridae family and Pneumoviridae subfamily with two distinct antigenic groups, A and B. The RSV genome of approximately 15.2 kb includes ten genes that encode for eleven proteins. Three proteins, the fusion (F), attachment (G), and small hydrophobic (SH) are expressed on the virion envelop. The F and G proteins are the only proteins shown to induce effective neutralizing antibodies and longer-term protective immunity. The F protein is more conserved among RSV strains and induces cross-protective immunity and is most effective at inducing neutralizing antibodies. The SH protein does induce some protection likely through Fc receptor-mediated activity such as antibody dependent cellular cytotoxicity or complement activation. Most neutralizing antibodies in human serum specimens are against the pre-fusion form of F and pre-fusion F is currently a prime candidate for RSV vaccines. The G protein, though eliciting less potent neutralizing antibody, has been shown to be an important factor for RSV disease pathogenesis making it also a candidate for inclusion in an RSV vaccine. The G protein structure consists of a conserved region that contains a CX3C chemokine motif that enables binding to the CX3C chemokine receptor, CX3CR1, and has some activities similar to the CX3C chemokine fractalkine. The G protein induces disease causing inflammatory responses that can be inhibited by blocking G binding to CX3CR1 with passive administration of an anti-G monoclonal antibody, G peptide vaccine induced antibodies, or by mutating the CX3C motif. Thus, a vaccine that induces both anti-F and anti-G antibodies can decrease disease by both decreasing viral replication and producing an anti-inflammatory effect.
[0027] Despite over 60 years of research, no effective vaccine or antiviral drug is available. Studies, however, show most neutralizing antibodies produced after RSV infection are against the surface fusion F and attachment G glycoproteins, thus making these the prime candidates for vaccines. In fact, antibodies induced by the F protein reduce viral titers. Antibodies induced by the G protein are less effective at reducing viral titers than those induced by F but reduce inflammation and disease more effectively. Among different strategies for RSV vaccines, virus-like particles (VLPs) are safe, immunogenic, and used in licensed human vaccines.
[0028] Disclosed herein is a vaccine that includes both the F and G proteins utilizing M based virus-like particles (VLPs). An RSV-based vaccine platform is optimal since all components can contribute to vaccine-induced immunity and the protein structures in the VLP better reflect natural structures. A VLP that better reflects the structure in the virus can induce a more effective immune response and provide a better model for structural studies. RSV VLPs have previously been developed using the Newcastle disease, influenza, or bacterial phage P22 platforms with the RSV F and/or G proteins or M and M2 proteins.
[0029] Disclosed herein are novel RSV VLPs with F and/or G proteins using an RSV platform with M plus P or M plus M2-1. Since M2-1 is important for structural stability of RSV, M2-1 can also contribute to VLP formation. The data herein show that an RSV-based vaccine platform can be used to efficiently form RSV VLPs with either M plus P or M plus M2-1 with F and/or G proteins. Unexpectedly, the inventors found that the G protein was only efficiently incorporated into these VLPs in the presence of the intracellular and transmembrane domains of F.
[0030] Described herein are virus like-particles (VLPs) and methods for inducing immunity to respiratory syncytial virus (RSV) infections or symptoms thereof. In one aspect, disclosed herein is a virus like particle (VLP) comprising a respiratory syncytial virus (RSV) M protein and an RSV M2-1 protein, wherein the VLP further comprises an RSV F protein and/or an RSV G protein. In one aspect, disclosed herein is a virus like particle (VLP) comprising a respiratory syncytial virus (RSV) M protein, an RSV P protein, an RSV F protein, and an RSV G protein.
[0031] Reference will now be made in detail to the embodiments of the invention, examples of which are illustrated in the drawings and the examples. This invention may, however, be embodied in many different forms and should not be construed as limited to the embodiments set forth herein.
[0032] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this disclosure belongs.
Terminology
[0033] Terms used throughout this application are to be construed with ordinary and typical meaning to those of ordinary skill in the art. However, Applicant desires that the following terms be given the particular definition as defined below.
[0034] As used herein, the article a, an, and the means at least one, unless the context in which the article is used clearly indicates otherwise.
[0035] The term comprising and variations thereof as used herein is used synonymously with the term including and variations thereof and are open, non-limiting terms. Although the terms comprising and including have been used herein to describe various embodiments, the terms consisting essentially of and consisting of can be used in place of comprising and including to provide for more specific embodiments and are also disclosed.
[0036] As used herein, the terms may, optionally, and may optionally are used interchangeably and are meant to include cases in which the condition occurs as well as cases in which the condition does not occur. Thus, for example, the statement that a formulation may include an excipient is meant to include cases in which the formulation includes an excipient as well as cases in which the formulation does not include an excipient.
[0037] The terms about and approximately are defined as being close to as understood by one of ordinary skill in the art. In one non-limiting embodiment, the terms are defined to be within 10%. In another non-limiting embodiment, the terms are defined to be within 5%. In still another non-limiting embodiment, the terms are defined to be within 1%.
[0038] As used herein the term adjuvant refers to a compound that, when used in combination with a specific immunogen in a formulation, will augment or otherwise alter or modify the resultant immune response. Modification of the immune response includes intensification or broadening the specificity of either or both antibody and cellular immune responses. Modification of the immune response can also mean decreasing or suppressing certain antigen-specific immune responses.
[0039] A composition is intended to include a combination of active agent and another compound or composition, inert (for example, a detectable agent or label) or active, such as an adjuvant.
[0040] As used herein, the term virus-like particle (VLP) refers to a structure that in at least one attribute resembles a virus but which has not been demonstrated to be infectious. In general, virus-like particles lack a viral genome and, therefore, are noninfectious. In addition, virus-like particles can often be produced in large quantities by heterologous expression and can be easily purified.
[0041] As used herein, the term vaccine refers to a formulation which contains VLPs of the present invention, which is in a form that is capable of being administered to a subject and which induces a protective immune response sufficient to induce immunity to prevent and/or ameliorate an infection and/or to reduce at least one symptom of an infection and/or to enhance the efficacy of another dose of VLPs. Typically, the vaccine comprises a conventional saline or buffered aqueous solution medium in which the composition of the present invention is suspended or dissolved. In this form, the composition of the present invention can be used conveniently to prevent, ameliorate, or otherwise treat an infection. Upon introduction into a host, the vaccine is able to provoke an immune response including, but not limited to, the production of antibodies and/or cytokines and/or the activation of CD8+ T cells, antigen presenting cells, CD4+ T cells, dendritic cells and/or other cellular responses.
[0042] As used herein an effective dose generally refers to that amount of VLPs or vaccines of the invention sufficient to induce immunity, to prevent and/or ameliorate an infection or to reduce at least one symptom of an infection and/or to enhance the efficacy of another dose of a VLP or a vaccine. An effective dose may refer to the amount of VLPs or vaccines sufficient to delay or minimize the onset of an infection or a symptom of an infection. An effective dose may also refer to the amount of VLPs or vaccines that provides a therapeutic benefit in the treatment or management of an infection a symptom of an infection. Further, an effective dose is the amount with respect to VLPs or vaccines of the invention alone, or in combination with other therapies, that provides a therapeutic benefit in the treatment or management of an infection. An effective dose may also be the amount sufficient to enhance a subject's (e.g., a human's) own immune response against a subsequent exposure to an infectious agent. Levels of immunity can be monitored, e.g., by measuring amounts of neutralizing secretory and/or serum antibodies, (e.g., by plaque neutralization, complement fixation, or enzyme-linked immunosorbent, microneutralization assay) and/or responses of virus-specific CD4+ T cells and CD8+ T cells, and/or responses of other immune cells. In the case of a vaccine, an effective dose is one that prevents or reduces disease and/or prevents or reduces the severity of symptoms.
[0043] As used herein, the term effective amount refers to an amount of VLPs or vaccines comprising VLPs necessary or sufficient to realize a desired biologic effect. An effective amount of the composition would be the amount that achieves a selected result, and such an amount could be determined as a matter of routine experimentation by a person skilled in the art. For example, an effective amount for preventing, treating and/or ameliorating an infection could be that amount necessary to cause activation of the immune system, resulting in the development of an antigen specific immune response upon exposure to VLPs or vaccines comprising VLPs of the invention. The term is also synonymous with sufficient amount.
[0044] An immunological response or immunity to a composition or vaccine is the development in the host of a cellular and/or antibody-mediated immune response to a composition or vaccine of interest. Usually, an immunological response includes but is not limited to one or more of the following effects: the production of antibodies, B cells, helper T cells, and/or cytotoxic T cells, directed specifically to an antigen or antigens included in the composition or vaccine of interest. Preferably, the host will display either a therapeutic or protective immunological response such that resistance to new infection will be enhanced and/or the clinical severity of the disease reduced. Such protection will be demonstrated by either a reduction or lack of symptoms normally displayed by an infected host, a quicker recovery time and/or a lowered viral titer in the infected host.
[0045] As used herein the term protective immune response, protective response, or protective immunity refers to an immune response mediated by antibodies against an infectious agent, which is exhibited by a vertebrate (e.g., a human), that prevents or ameliorates an infection or reduces at least one symptom thereof. VLPs of the invention can stimulate the production of antibodies that, for example, neutralize infectious agents, block infectious agents from entering cells, block replication of said infectious agents, and/or protect host cells from infection and destruction. The term can also refer to an immune response that is mediated by T cells, B cells, and/or other white blood cells against an infectious agent, exhibited by a vertebrate (e.g., a human), that prevents or ameliorates RSV infection or reduces at least one symptom thereof.
[0046] The term subject is defined herein to include animals such as mammals, including, but not limited to, primates (e.g., humans), cows, sheep, goats, horses, dogs, cats, rabbits, rats, mice and the like. In some embodiments, the subject is a human.
[0047] Pharmaceutically acceptable carrier (sometimes referred to as a carrier) means a carrier or excipient that is useful in preparing a pharmaceutical or therapeutic composition that is generally safe and non-toxic, and includes a carrier that is acceptable for veterinary and/or human pharmaceutical or therapeutic use. The terms carrier or pharmaceutically acceptable carrier can include, but are not limited to, phosphate buffered saline solution, water, emulsions (such as an oil/water or water/oil emulsion) and/or various types of wetting agents.
[0048] As used herein, the term carrier encompasses any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, lipid, stabilizer, or other material well known in the art for use in pharmaceutical formulations. The choice of a carrier for use in a composition will depend upon the intended route of administration for the composition. The preparation of pharmaceutically acceptable carriers and formulations containing these materials is described in, e.g., Remington's Pharmaceutical Sciences, 21st Edition, ed. University of the Sciences in Philadelphia, Lippincott, Williams & Wilkins, Philadelphia, PA, 2005. Examples of physiologically acceptable carriers include saline, glycerol, DMSO, buffers such as phosphate buffers, citrate buffer, and buffers with other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEEN (ICI, Inc.; Bridgewater, New Jersey), polyethylene glycol (PEG), and PLURONICS (BASF; Florham Park, NJ). To provide for the administration of such dosages for the desired therapeutic treatment, compositions disclosed herein can advantageously comprise between about 0.1% and 99% by weight of the total of one or more of the subject compounds based on the weight of the total composition including carrier or diluent.
[0049] As used herein, the terms treating or treatment of a subject includes the administration of a drug to a subject with the purpose of curing, healing, alleviating, relieving, altering, remedying, ameliorating, improving, stabilizing or affecting a disease or disorder, or a symptom of a disease or disorder. The terms treating and treatment can also refer to reduction in severity and/or frequency of symptoms, elimination of symptoms and/or underlying cause, and improvement or remediation of damage.
[0050] Therapeutically effective amount or therapeutically effective dose of a composition (e.g. a VLP or a vaccine comprising a VLP) refers to an amount that is effective to achieve a desired therapeutic result. In some embodiments, a desired therapeutic result is the prevention of an RSV infection and/or a symptom thereof. In some embodiments, a desired therapeutic result is the treatment of an RSV infection and/or a symptom thereof. Therapeutically effective amounts of a given therapeutic agent will typically vary with respect to factors such as the type and severity of the disorder or disease being treated and the age, gender, and weight of the subject. The term can also refer to an amount of a therapeutic agent, or a rate of delivery of a therapeutic agent (e.g., amount over time), effective to facilitate a desired therapeutic effect, such as coughing relief. The precise desired therapeutic effect will vary according to the condition to be treated, the tolerance of the subject, the agent and/or agent formulation to be administered (e.g., the potency of the therapeutic agent, the concentration of agent in the formulation, and the like), and a variety of other factors that are appreciated by those of ordinary skill in the art. In some instances, a desired biological or medical response is achieved following administration of multiple dosages of the composition to the subject over a period of days, weeks, or years.
[0051] The term nucleic acid as used herein means a polymer composed of nucleotides, e.g. deoxyribonucleotides or ribonucleotides.
[0052] The terms ribonucleic acid and RNA as used herein mean a polymer composed of ribonucleotides.
[0053] The terms deoxyribonucleic acid and DNA as used herein mean a polymer composed of deoxyribonucleotides.
[0054] The term oligonucleotide denotes single- or double-stranded nucleotide multimers of from about 2 to up to about 100 nucleotides in length. Suitable oligonucleotides may be prepared by the phosphoramidite method described by Beaucage and Carruthers, Tetrahedron Lett., 22:1859-1862 (1981), or by the triester method according to Matteucci, et al., J. Am. Chem. Soc., 103:3185 (1981), both incorporated herein by reference, or by other chemical methods using either a commercial automated oligonucleotide synthesizer or VLSIPS technology. When oligonucleotides are referred to as double-stranded, it is understood by those of skill in the art that a pair of oligonucleotides exist in a hydrogen-bonded, helical array typically associated with, for example, DNA. In addition to the 100% complementary form of double-stranded oligonucleotides, the term double-stranded, as used herein is also meant to refer to those forms which include such structural features as bulges and loops, described more fully in such biochemistry texts as Stryer, Biochemistry, Third Ed., (1988), incorporated herein by reference for all purposes.
[0055] The term polynucleotide refers to a single or double stranded polymer composed of nucleotide monomers.
[0056] The term polypeptide refers to a compound made up of a single chain of D- or L-amino acids or a mixture of D- and L-amino acids joined by peptide bonds.
[0057] The terms identical or percent identity, in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 60% identity, preferably 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or higher identity over a specified region when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI web site or the like). Such sequences are then said to be substantially identical. This definition also refers to, or may be applied to, the compliment of a test sequence. The definition also includes sequences that have deletions and/or additions, as well as those that have substitutions. As described below, the preferred algorithms can account for gaps and the like. Preferably, identity exists over a region that is at least about 10 amino acids or 20 nucleotides in length, or more preferably over a region that is 10-50 amino acids or 20-50 nucleotides in length. As used herein, percent (%) nucleotide sequence identity is defined as the percentage of amino acids in a candidate sequence that are identical to the nucleotides in a reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST,
[0058] BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared can be determined by known methods.
[0059] For sequence comparisons, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Preferably, default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
[0060] One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1977) Nuc. Acids Res. 25:3389-3402, and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al. (1990) J. Mol. Biol. 215:403-410). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) or 10, M=5, N=4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=4, and a comparison of both strands.
[0061] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01.
[0062] The term engineered or recombinant means a polynucleotide or polypeptide of semisynthetic, or synthetic origin that either does not occur in nature or is operably linked to another polynucleotide in an arrangement not found in nature.
[0063] Nucleic acid is operably linked when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, operably linked means that the DNA sequences being linked are near each other, and, in the case of a secretory leader, contiguous and in reading phase. However, operably linked nucleic acids (e.g. enhancers and coding sequences) do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice. In some embodiments, a promoter is operably linked with a coding sequence when it is capable of affecting (e.g. modulating relative to the absence of the promoter) the expression of a protein from that coding sequence (i.e., the coding sequence is under the transcriptional control of the promoter).
[0064] A vector refers to a recombinant DNA plasmid, bacteriophage, or virus that comprises a heterologous polynucleotide to be delivered to a target cell, either in vitro or in vivo. The heterologous polynucleotide may comprise a sequence of interest for purposes of prevention or therapy, and may optionally be in the form of an expression cassette. As used herein, a vector may be able to but does not need to be capable of replication in the ultimate target cell or subject. The term includes vectors for cloning as well as viral vectors.
[0065] The term gene or gene sequence refers to the coding sequence or control sequence, or fragments thereof. A gene may include any combination of coding sequence and control sequence, or fragments thereof. Thus, a gene as referred to herein may be all or part of a native gene. A polynucleotide sequence as referred to herein may be used interchangeably with the term gene, or may include any coding sequence, non-coding sequence or control sequence, fragments thereof, and combinations thereof. The term gene or gene sequence includes, for example, control sequences upstream of the coding sequence (for example, the ribosome binding site).
[0066] Throughout this application, various publications are referenced. The disclosures of these publications in their entireties are hereby incorporated by reference into this application in order to more fully describe the state of the art to which this pertains. The references disclosed are also individually and specifically incorporated by reference herein for the material contained in them that is discussed in the sentence in which the reference is relied upon.
Virus-Like Particles and Vaccines
[0067] Respiratory Syncytial Virus (RSV) is the leading cause of severe bronchiolitis in infants and young children and a high priority for vaccine development. Disclosed herein are virus-like particles (VLPs) and the use thereof for inducing immune responses to RSV infection or at least one symptom thereof in a subject. VLPs are used herein for vaccines since they are immunogenic and are safe to human. The present disclosure provides RSV VLPs with F and/or G using an RSV platform with M plus P or M plus M2-1, and uses thereof for inducing protective immune responses.
[0068] The respiratory syncytial virus (RSV), a member of the species orthopneumovirus of Orthopneumovirus genus, is a syncytial virus that causes respiratory tract infections. RSV has a single stranded negative sense RNA genome which is approximately 15.2 Kb long. RSV has been classified into two groups (group A and group B, or termed as strain A and strain B herein) on the basis of genetic and antigenic heterogeneity. The two major glycoprotein on the surface of the RSV virion are the attachment glycoprotein (G) and fusion protein (F). G is involved in attachment of virion to the host cells, and F cause the virion membrane to fuse with cell membrane. In addition, four of the viral genes code for intracellular proteins that are involved in genome transcription, replication, and particle budding, namely N (nucleoprotein), P (phosphoprotein), M (matrix protein), and L (large protein, containing the RNA polymerase catalytic motifs).
[0069] In some aspects, disclosed herein is a virus like particle (VLP) comprising a respiratory syncytial virus (RSV) M protein and an RSV M2-1 protein.
[0070] As used herein, the term RSV Matrix or RSV M protein refers to an RSV protein that, when expressed in a host cell, induces formation of VLPs. An example of an RSV M protein is represented by SEQ ID NO: 39 or SEQ ID NO: 41. The term also comprises any variants, derivatives and/or fragments of RSV M protein that, when expressed in a host cell, induces formation of VLPs. In some embodiments, the M polypeptide comprises the sequence set forth in SEQ ID NO: 39 or SEQ ID NO: 41, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 39 or SEQ ID NO: 41, or a polypeptide comprising a portion of SEQ ID NO: 39 or SEQ ID NO: 41. In some embodiments, the M polypeptide comprises the sequence set forth in SEQ ID NO: 39. In some embodiments, the M polypeptide comprises the sequence set forth in SEQ ID NO: 41. The term also encompasses nucleotide sequences which encode for RSV M and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express RSV M protein and induce formation of VLPs. In some embodiments, In some embodiments, the nucleotide sequence encoding M polypeptide comprises the sequence set forth in SEQ ID NO: 40 or SEQ ID NO: 42, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 40 or SEQ ID NO: 42, or a polynucleotide comprising a portion of SEQ ID NO: 40 or SEQ ID NO: 42.
[0071] As used herein, the term RSV M2-1 protein or M2-1 protein refers to a cofactor of the RSV viral RNA polymerase complex and functions as a transcriptional processivity and antitermination factor. An example of an RSV M2-1 protein is represented by SEQ ID NO: 43 or SEQ ID NO: 45. The term also comprises any variants, derivatives and/or fragments of RSV M2-1 protein that, when expressed in a host cell, induces formation of VLPs. In some embodiments, the M2-1 polypeptide comprises the sequence set forth in SEQ ID NO: 43 or SEQ ID NO: 45, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 43 or SEQ ID NO: 45, or a polypeptide comprising a portion of SEQ ID NO: 43 or SEQ ID NO: 45. In some embodiments, the M2-1 polypeptide comprises the sequence set forth in SEQ ID NO: 43. In some embodiments, the M2-1 polypeptide comprises the sequence set forth in SEQ ID NO: 45. The term also encompasses nucleotide sequences which encode for RSV M2-1 and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express RSV M2-1 protein and induce formation of VLPs. In some embodiments, the nucleotide sequence encoding M2-1 polypeptide comprises the sequence set forth in SEQ ID NO: 44 or SEQ ID NO: 46, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 44 or SEQ ID NO: 46, or a polynucleotide comprising a portion of SEQ ID NO: 44 or SEQ ID NO: 46.
[0072] In some embodiments, the VLP of any preceding aspect comprises one or more additional RSV proteins. In some embodiments, the VLP comprises an RSV F protein. As used herein, the terms RSV F protein, F protein refers to an RSV fusion protein. The RSV F protein directs penetration of RSV by fusion between the virion's envelope protein and the host cell plasma membrane. Later in infection, the F protein expressed on the cell surface can mediate fusion with neighboring cells to form syncytia. The F protein is a type I transmembrane surface protein that has a N-terminal cleaved signal peptide and a membrane anchor near the C-terminus. RSV F is synthesized as an inactive F0 precursor that assembles into a homotrimer and is activated by cleavage in the trans-Golgi complex by a cellular endoprotease to yield two disulfide-linked subunits. The N-terminus of the F1 subunit that is created by cleavage contains a hydrophobic domain (the fusion peptide) that inserts directly into the target membrane to initiate fusion. The F1 subunit also contains heptad repeats that associate during fusion, driving a conformational shift that brings the viral and cellular membranes into close proximity. Because the F protein is expressed on the surface of infected cells and is responsible for subsequent fusion with other cells leading to syncytia formation, antibodies or cellular immune responses to the F protein can neutralize virus and/or block entry of the virus into the cell or prevent syncytia formation.
[0073] Accordingly, in some embodiments, the RSV F protein of any preceding aspect is selected from a group consisting of a pre-fusion form of the RSV F protein, a post-fusion form of the RSV
[0074] F protein, and a carbonyl terminal portion of the RSV F protein. In some embodiments, the RSV F protein is the pre-fusion form of the RSV F protein. In some embodiments, the RSV F protein is the post-fusion form of the RSV F protein. In some embodiments, the RSV F protein is the carbonyl terminal portion of the RSV F protein. In some embodiments, the RSV F protein comprises a sequence selected from the group consisting of SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, and SEQ ID NO: 37.
[0075] In some embodiments, the F polypeptide comprises the sequence set forth in SEQ ID NO: 23. In some embodiments, the F polypeptide comprises the sequence set forth in SEQ ID NO: 26. In some embodiments, the F polypeptide comprises the sequence set forth in SEQ ID NO: 29. In some embodiments, the F polypeptide comprises the sequence set forth in SEQ ID NO: 32. In some embodiments, the F polypeptide comprises the sequence set forth in SEQ ID NO: 34. In some embodiments, the F polypeptide comprises the sequence set forth in SEQ ID NO: 36. In some embodiments, the F polypeptide comprises the sequence set forth in SEQ ID NO: 37.
[0076] The term RSV F protein or F protein also encompasses nucleotide sequences which encode for an RSV F and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express an RSV F protein and induce formation of VLPs. In some embodiments, the RSV F polypeptide comprises the sequence set forth in SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, or SEQ ID NO: 37, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with the sequence set forth in SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, or SEQ ID NO: 37, or a polypeptide comprising a portion of the sequence set forth in SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, or SEQ ID NO: 37. In some embodiments, the nucleotide sequence encoding the RSV F polypeptide comprises the sequence set forth in SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, or SEQ ID NO: 38, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, or SEQ ID NO: 38, or a polynucleotide comprising a portion of SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, or SEQ ID NO: 38.
[0077] In some embodiments, the carbonyl terminal portion form of the RSV F polypeptide comprises the sequence set forth in SEQ ID NO: 32, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 32, or a polypeptide comprising a portion of SEQ ID NO: 32. The term also encompasses nucleotide sequences which encode for the carbonyl terminal portion form of the RSV F polypeptide and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express the carbonyl terminal portion form of the RSV F polypeptide and induce formation of VLPs. In some embodiments, the nucleotide sequence encoding the carbonyl terminal portion form of the RSV F polypeptide comprises the sequence set forth in SEQ ID NO: 33, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 33, or a polynucleotide comprising a portion of SEQ ID NO: 33.
[0078] In some embodiments, the VLP of any preceding aspect further comprises an RSV G protein. In some embodiments, the RSV G protein is from RSV group A or RSV group B. In some embodiments, the RSV G protein is from RSV group A. In some embodiments, the RSV G protein is from RSV group B. In some embodiments, the RSV G protein is from RSV group A and RSV group B.
[0079] As used herein, the terms RSV G protein or G protein refers to a type II transmembrane glycoprotein with a single hydrophobic region near the N-terminal end that serves as both an uncleaved signal peptide and a membrane anchor, leaving the C-terminal two-thirds of the molecule oriented externally. In some embodiments, the RSV G polypeptide comprises a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, or a polypeptide comprising a portion of a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21. The term also encompasses nucleotide sequences which encode for the RSV G polypeptide and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express various forms of the RSV G protein and induce formation of VLPs (for example, secreted or membrane-bound G proteins). In some embodiments, the nucleotide sequence encoding the RSV G protein comprises a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22, or a polynucleotide comprising a portion of a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22. In some embodiments, the G protein comprises a sequence of SEQ ID NO: 1. In some embodiments, the G protein comprises a sequence of SEQ ID NO: 11. In some embodiments, the G protein comprises a sequence of SEQ ID NO: 15. In some embodiments, the G protein comprises a sequence of SEQ ID NO: 17.
[0080] The G protein structure consists of a central conserved region (CCD-G) that contains a CX3C chemokine motif that enables binding to the CX3C chemokine receptor, CX3CR1 (HGNC: 2558, Entrez Gene: 1524, Ensembl: ENSG00000168329, OMIM: 601470, UniProtKB: P49238), a crucial chemokine receptor involved in migration and adhesion of leukocytes. The CX3C motif is known to those of skill in the art. In some embodiments, the CX3C motif is from amino acid 182 to 186 of an RSV G protein from group A. G protein induced inflammatory responses can be reduce by blocking G protein binding to CX3CR1. The present disclosure shows that the anti-G protein antibodies induced by the vaccine disclosed herein and reduces RSV infection related inflammation. Therefore, in some embodiments, the VLPs of any preceding aspect comprises a recombinant RSV G protein, wherein the recombinant RSV G protein comprises an intracellular and transmembrane domain plus about 20 to about 25 aa of the extracellular domain and/or a CCD-G of an RSV G protein, wherein the RSV G protein is from RSV group A and/or group B. In some embodiments, the transmembrane domain term used herein can indicate intracellular and transmembrane domains plus about 20 to about 25 aa of the extracellular domain (e.g. aa 1-86 or 1-91). In some embodiments, the intracellular plus transmembrane plus initial sequences of the extracellular domain of an RSV G protein comprises amino acids 1-86 of an RSV from group A or amino acids 1-77 of an RSV from group B. In some embodiments, the CCD-G domain of an RSV G protein comprises amino acid 155-206 of an RSV G protein of group A or B or amino acid 146-197 of an RSV G protein of group A or B or 146-206 of group A or B. In some embodiments, the RSV G protein of group A comprises a sequence of SEQ ID NO: 7 or SEQ ID NO: 9. In some embodiments, the RSV G protein of group B comprises a sequence of SEQ ID NO: SEQ ID NO: 19 or SEQ ID NO: 21. The CX3C motif can be mutated for preventing the G protein in the VLP from binding to CX3CR1, such that the VLP can be more immunogenic and safer. Therefore, in some embodiments, the CCD-G comprises a mutated CX3C motif that has one or more amino acids inserted between the two cysteines of the CX3C motif. The one or more amino acids can be any amino acid. In some embodiments, the one or more amino acids are alanines. Accordingly, in some embodiments, the recombinant G protein of any preceding aspect further comprises mutated CX3C motif, wherein the recombinant G protein comprises a sequence selected from the group consisting of SEQ ID NO: 11 and SEQ ID NO: 13.
[0081] As noted above, the term engineered or recombinant means a polynucleotide or polypeptide of semisynthetic, or synthetic origin that either does not occur in nature or is operably linked to another polynucleotide in an arrangement not found in nature. In some embodiments, recombinant RSV G protein is a G protein comprising one or more transmembrane domains of RSV G proteins and one or more CCD-G domains of RSV G proteins, wherein the transmembrane domain and the CCD-G domain can be from a same RSV group or different RSV groups. In some embodiments, the recombinant RSV G protein comprises a transmembrane domain of an RSV G protein and a CCD-G domain of an RSV G protein, wherein the transmembrane domain and the CCD-G domain can be from a same RSV group or different RSV groups. Thus, in some embodiments, the VLP disclosed herein comprises a recombinant RSV G protein comprising a transmembrane domain of an RSV G protein of RSV group A and a CCD-G domain of an RSV G protein of RSV group A. In some embodiments, the VLP disclosed herein comprises a recombinant
[0082] RSV G protein comprising a transmembrane domain of an RSV G protein of RSV group A and a CCD-G domain of an RSV G protein of RSV group B. In some embodiments, the VLP disclosed herein comprises a recombinant RSV G protein comprising a transmembrane domain of an RSV G protein of RSV group B and a CCD-G domain of an RSV G protein of RSV group B. In some embodiments, the recombinant RSV G protein comprises a transmembrane domain of an RSV G protein and a group A CCD-G domain and a group B CCD-G domain of RSV G protein, wherein the transmembrane domain can be from either a group A or B RSV groups. In some embodiments, the VLP can have two recombinant G proteins, one for group A and one for group B. The recombinant RSV G protein of any preceding aspect, the transmembrane domain is operably linked to the CCD-G domain and the VLP also contains a form of the F protein.
[0083] Accordingly, in some embodiments, the recombinant G protein of any preceding aspect comprises a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21. In some embodiments, the recombinant G protein comprises a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, [0084] SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, or a polypeptide comprising a portion of a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21. In some embodiments, the nucleotide sequence encoding the recombinant G protein comprises a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, [0085] SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22, or a polynucleotide comprising a portion of a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22.
[0086] In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 1. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 3. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 5. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 7. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 9. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 11. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 13. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 15. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 17. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 19. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 21.
[0087] In some embodiments, the VLP of any preceding aspect further comprises an RSV P protein, an RSV N protein, or an RSV L protein.
[0088] In some aspects, disclosed herein is a virus like particle (VLP) comprising a respiratory syncytial virus (RSV) M protein, an RSV P protein, an RSV F protein, and an RSV G protein.
[0089] In some embodiments, the RSV F protein is selected from a group consisting of a pre-fusion form of the RSV F protein, a post-fusion form of the RSV F protein, and a carbonyl terminal portion of the RSV F protein. In some embodiments, the RSV F protein comprises a sequence selected from the group consisting of SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, and SEQ ID NO: 37. In some embodiments, the carbonyl terminal portion of the RSV F protein comprises a sequence of SEQ ID NO: 32.
[0090] In some embodiments, the VLP comprises an RSV G protein. In some embodiments, the RSV G protein is from RSV group A or RSV group B. In some embodiments, the RSV G protein comprises a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21.
[0091] In some embodiments, the VLP comprises a recombinant RSV G protein. In some embodiments, the recombinant RSV G protein comprises a transmembrane domain of the RSV G protein and a central conserved domain of the RSV G protein.
[0092] As used herein, the term RSVP protein or P protein refers to an RSV phosphorylation. The colocalization of M2-1 protein with N protein and P protein as part of the ribonucleoprotein (RNP) complex contributes RSV viral gene transcription and replication. An example of an RSV P protein is represented by SEQ ID NO: 47 or SEQ ID NO: 49. The term also comprises any variants, derivatives and/or fragments of RSV P protein that, when expressed in a host cell, induces formation of VLPs. In some embodiments, the P polypeptide comprises the sequence set forth in
[0093] SEQ ID NO: 47 or SEQ ID NO: 49, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 47 or SEQ ID NO: 49, or a polypeptide comprising a portion of SEQ ID NO: 47 or SEQ ID NO: 49. The term also encompasses nucleotide sequences which encode for RSVP and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express RSV P protein and induce formation of VLPs. In some embodiments, the nucleotide sequence encoding RSV P protein comprises the sequence set forth in SEQ ID NO: 48 or SEQ ID NO: 50, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 48 or SEQ ID NO: 50, or a polypeptide comprising a portion of SEQ ID NO: 48 or SEQ ID NO: 50.
[0094] In some embodiments, disclosed herein is a virus like particle (VLP) comprising a respiratory syncytial virus (RSV) M protein, an RSV P protein, an RSV F protein, and an RSV G protein, wherein the VLP further comprises an RSV M2-1 protein, an RSV N protein, or an RSV L protein. Additional examples of RSV sequences and proteins are further described in U.S. Patent Application Publication U.S. 2008/0233150, which is incorporated herein by reference for all purposes.
[0095] In some aspects, disclosed herein are vaccines comprising VLPs of any preceding aspect. In some embodiments, the vaccine further comprises an adjuvant.
[0096] Optionally, the vaccine contemplated herein can be combined with an adjuvant such as Freund's incomplete adjuvant, Freund's Complete adjuvant, alum, monophosphoryl lipid A, alum phosphate or hydroxide, QS-21, salts, i.e., AlK(SO4)2, AlNa(SO4)2, AlNH4(SO4)2, silica, kaolin, carbon polynucleotides, i.e., poly IC and poly AU. Additional adjuvants can include QuilA and Alhydrogel and the like. Optionally, the vaccine contemplated herein can be combined with immunomodulators and immunostimulants such as interleukins, interferons and the like. Many vaccine formulations are known to those of skill in the art.
[0097] 5 In some embodiments, the vaccine further comprises a pharmaceutically acceptable carrier.
Methods of Use
[0098] In some aspects, disclosed herein is a method of inducing immunity to RSV infection or at least one symptom thereof in a subject, comprising administering one or more effective doses of a vaccine comprising a virus like particle (VLP), wherein the VLP comprises a respiratory syncytial virus (RSV) M protein and an RSV M2-1 protein.
[0099] In some embodiments, the VLP further comprises an F protein. In some embodiments, the VLP further comprises a G protein. In some embodiments, the VLP further comprises an F protein and a G protein.
[0100] In some aspects, disclosed herein is a method of inducing immunity to RSV infection or at least one symptom thereof in a subject, comprising administering one or more effective doses of a vaccine comprising a virus like particle (VLP), wherein the VLP comprises a respiratory syncytial virus (RSV) M protein, an RSV P protein, an RSV F protein, and an RSV G protein.
[0101] In some aspects, disclosed herein is a method of preventing an RSV infection or at least one symptom thereof in a subject, comprising administering one or more effective doses of a vaccine comprising a virus like particle (VLP), wherein the VLP comprises a respiratory syncytial virus (RSV) M protein and an RSV M2-1 protein. In some embodiments, the VLP further comprises an F protein. In some embodiments, the VLP further comprises a G protein. In some embodiments, the VLP further comprises an F protein and a G protein.
[0102] In some aspects, disclosed herein is a method of preventing an RSV infection or at least one symptom thereof in a subject, comprising administering one or more effective doses of a vaccine comprising a virus like particle (VLP), wherein the VLP comprises a respiratory syncytial virus (RSV) M protein, an RSV P protein, an RSV F protein, and an RSV G protein.
[0103] As used herein, the terms RSV Matrix or RSV M protein refer to an RSV protein that, when expressed in a host cell, induces formation of VLPs. An example of an RSV M protein is represented by SEQ ID NO: 39 or SEQ ID NO: 41. The term also comprises any variants, derivatives and/or fragments of RSV M protein that, when expressed in a host cell, induces formation of VLPs. In some embodiments, the M polypeptide comprises the sequence set forth in SEQ ID NO: 39 or SEQ ID NO: 41, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 39 or SEQ ID NO: 41, or a polypeptide comprising a portion of SEQ ID NO: 39 or SEQ ID NO: 41. The term also encompasses nucleotide sequences which encode for RSV M and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express RSV M protein and induce formation of VLPs. In some embodiments, In some embodiments, the nucleotide sequence encoding M polypeptide comprises the sequence set forth in SEQ ID NO: 40 or SEQ ID NO: 42, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 40 or SEQ ID NO: 42, or a polynucleotide comprising a portion of SEQ ID NO: 40 or SEQ ID NO: 42.
[0104] As used herein, the terms RSV M2-1 protein, M2-1 protein refers to a cofactor of the RSV viral RNA polymerase complex and functions as a transcriptional processivity and antitermination factor. An example of an RSV M2-1 protein is represented by SEQ ID NO: 43 or SEQ ID NO: 45. The term also comprises any variants, derivatives and/or fragments of RSV M2-1 protein that, when expressed in a host cell, induces formation of VLPs. In some embodiments, the M2-1 polypeptide comprises the sequence set forth in SEQ ID NO: 43 or SEQ ID NO: 45, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 43 or SEQ ID NO: 45, or a polypeptide comprising a portion of SEQ ID NO: 43 or SEQ ID NO: 45. The term also encompasses nucleotide sequences which encode for RSV M2-1 and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express RSV M2-1 protein and induce formation of VLPs. In some embodiments, the nucleotide sequence encoding M2-1 polypeptide comprises the sequence set forth in SEQ ID NO: 44 or SEQ ID NO: 46, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 44 or SEQ ID NO: 46, or a polynucleotide comprising a portion of SEQ ID NO: 44 or SEQ ID NO: 46.
[0105] In some embodiments, the VLP of any preceding aspect comprises one or more additional RSV proteins. In some embodiments, the VLP comprises an RSV F protein. As used herein, the terms RSV F protein, F protein refers to an RSV fusion protein.
[0106] Accordingly, in some embodiments, the RSV F protein of any preceding aspect is selected from a group consisting of a pre-fusion form of the RSV F protein, a post-fusion form of the RSV F protein, and a carbonyl terminal portion of the RSV F protein. In some embodiments, the RSV F protein is the pre-fusion form of the RSV F protein. In some embodiments, the RSV F protein is the post-fusion form of the RSV F protein. In some embodiments, the RSV F protein is the carbonyl terminal portion of the RSV F protein. Accordingly, in some embodiments, the RSV F protein of any preceding aspect is selected from a group consisting of a pre-fusion form of the RSV F protein, a post-fusion form of the RSV F protein, and a carbonyl terminal portion of the RSV F protein. In some embodiments, the RSV F protein is the pre-fusion form of the RSV F protein. In some embodiments, the RSV F protein is the post-fusion form of the RSV F protein. In some embodiments, the RSV F protein is the carbonyl terminal portion of the RSV F protein. In some embodiments, the RSV F protein comprises a sequence selected from the group consisting of SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, and SEQ ID NO: 37.
[0107] The term RSV F protein or F protein also encompasses nucleotide sequences which encode for an RSV F and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express an RSV F protein and induce formation of VLPs. In some embodiments, the RSV F polypeptide comprises the sequence set forth in SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, or SEQ ID NO: 37, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with the sequence set forth in SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, or SEQ ID NO: 37, or a polypeptide comprising a portion of the sequence set forth in SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, or SEQ ID NO: 37. In some embodiments, the nucleotide sequence encoding the RSV F polypeptide comprises the sequence set forth in SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, or SEQ ID NO: 38, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, or SEQ ID NO: 38, or a polynucleotide comprising a portion of SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, or SEQ ID NO: 38.
[0108] In some embodiments, the carbonyl terminal portion form of the RSV F polypeptide comprises the sequence set forth in SEQ ID NO: 32, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 32, or a polypeptide comprising a portion of SEQ ID NO: 32. The term also encompasses nucleotide sequences which encode for the carbonyl terminal portion form of the RSV F polypeptide and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express the carbonyl terminal portion form of the RSV F polypeptide and induce formation of VLPs. In some embodiments, the nucleotide sequence encoding the carbonyl terminal portion form of the RSV F polypeptide comprises the sequence set forth in SEQ ID NO: 33, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 33, or a polynucleotide comprising a portion of SEQ ID NO: 33.
[0109] In some embodiments, the VLP of any preceding aspect further comprises an RSV G protein. In some embodiments, the RSV G protein is from RSV group A or RSV group B. In some embodiments, the RSV G protein is from RSV group A. In some embodiments, the RSV G protein is from RSV group B. In some embodiments, the RSV G protein is from RSV group A and RSV group B.
[0110] As used herein, the terms RSV G protein or G protein refers to a type II transmembrane glycoprotein with a single hydrophobic region near the N-terminal end that serves as both an uncleaved signal peptide and a membrane anchor, leaving the C-terminal two-thirds of the molecule oriented externally. In some embodiments, the RSV G polypeptide comprises a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, or a polypeptide comprising a portion of a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21. The term also encompasses nucleotide sequences which encode for the RSV G polypeptide and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express the post-fusion form of the RSV G and induce formation of VLPs. In some embodiments, the nucleotide sequence encoding the RSV G protein comprises a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22, or a polynucleotide comprising a portion of a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22. In some embodiments, the G protein comprises a sequence of SEQ ID NO: 1. In some embodiments, the G protein comprises a sequence of SEQ ID NO: 11. In some embodiments, the G protein comprises a sequence of SEQ ID NO: 15. In some embodiments, the G protein comprises a sequence of SEQ ID NO: 17.
[0111] The G protein structure consists of a central conserved region (CCD-G) that contains a CX3C chemokine motif that enables binding to the CX3C chemokine receptor, CX3CR1 (HGNC: 2558, Entrez Gene: 1524, Ensembl: ENSG00000168329, OMIM: 601470, UniProtKB: P49238), a crucial chemokine receptor involved in migration and adhesion of leukocytes. G protein induced inflammatory responses can be reduce by blocking G protein binding to CX3CR1. The present disclosure shows that the anti-G protein antibodies induced by the vaccine disclosed herein reduce RSV infection related inflammation. Therefore, in some embodiments, the VLPs of any preceding aspect comprises a recombinant RSV G protein, wherein the recombinant RSV G protein comprises a transmembrane domain of an RSV G protein and/or a CCD-G of an RSV G protein, wherein the RSV G protein is from RSV group A and/or group B. In some embodiments, the transmembrane domain of an RSV G protein comprises amino acid 1-86 of an RSV from group A, amino acid 1-86 of an RSV from group B, or amino acid 1-77 of an RSV from group B. In some embodiments, the CCD-G domain of an RSV G protein comprises amino acid 155-206 of an RSV G protein of group A, amino acid 155-206 of an RSV G protein of group B, or amino acid 146-197 of an RSV G protein of group B. In some embodiments, the RSV G protein of group A comprises a sequence of SEQ ID NO: 7 or SEQ ID NO: 9. In some embodiments, the RSV G protein of group B comprises a sequence of SEQ ID NO: SEQ ID NO: 19 or SEQ ID NO: 21.
[0112] In some embodiments, recombinant RSV G protein is a G protein comprising one or more transmembrane domains of RSV G proteins and one or more CCD-G domains of RSV G proteins, wherein the transmembrane domain and the CCD-G domain can be from a same RSV group or different RSV groups. In some embodiments, the recombinant RSV G protein comprises a transmembrane domain of an RSV G protein and a CCD-G domain of an RSV G protein, wherein the transmembrane domain and the CCD-G domain can be from a same RSV group or different RSV groups. Thus, in some embodiments, the VLP disclosed herein comprises a recombinant RSV G protein comprising a transmembrane domain of an RSV G protein of RSV group A and a CCD-G domain of an RSV G protein of RSV group A. In some embodiments, the VLP disclosed herein comprises a recombinant RSV G protein comprising a transmembrane domain of an RSV G protein of RSV group A and a CCD-G domain of an RSV G protein of RSV group B. In some embodiments, the VLP disclosed herein comprises a recombinant RSV G protein comprising a transmembrane domain of an RSV G protein of RSV group B and a CCD-G domain of an RSV G protein of RSV group B. In some embodiments, the recombinant RSV G protein comprises more than one transmembrane domain of an RSV G protein and more than one CCD-G domain of an
[0113] RSV G protein, wherein the transmembrane domain and the CCD-G domain can be from a same RSV group or different RSV groups, wherein the RSV group can be RSV group A and/or group B. The recombinant RSV G protein of any preceding aspect, the transmembrane domain is operably linked to the CCD-G domain.
[0114] Accordingly, in some embodiments, the recombinant G protein of any preceding aspect comprises a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21. In some embodiments, the recombinant G protein comprises a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21, or a polypeptide comprising a portion of a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21. In some embodiments, the nucleotide sequence encoding the recombinant G protein comprises a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22, or a polynucleotide comprising a portion of a sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO: 20, and SEQ ID NO: 22. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 1. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 3. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 5. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 7. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 9. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 11. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 13. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 15. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 17. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 19. In some embodiments, the recombinant G protein comprises a sequence of SEQ ID NO: 21.
[0115] In some embodiments, the VLP of any preceding aspect further comprises an RSV P protein, an RSV N protein, or an RSV L protein.
[0116] In some aspects, disclosed herein is a virus like particle (VLP) comprising a respiratory syncytial virus (RSV) M protein, an RSV P protein, an RSV F protein, and an RSV G protein.
[0117] In some embodiments, the RSV F protein is selected from a group consisting of a pre-fusion form of the RSV F protein, a post-fusion form of the RSV F protein, and a carbonyl terminal portion of the RSV F protein. In some embodiments, the RSV F protein comprises a sequence selected from the group consisting of SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, and SEQ ID NO: 37. In some embodiments, the carbonyl terminal portion of the RSV F protein comprises a sequence of SEQ ID NO: 32.
[0118] In some embodiments, the VLP comprises an RSV G protein. In some embodiments, the RSV G protein is from RSV group A or RSV group B. In some embodiments, the RSV G protein comprises a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 17, SEQ ID NO: 19, and SEQ ID NO: 21.
[0119] As used herein, the terms RSV P protein, P protein refers to an RSV phosphorylation. The colocalization of M2-1 protein with N protein and P protein as part of the ribonucleoprotein (RNP) complex contributes RSV viral gene transcription and replication. An example of an RSV P protein is represented by SEQ ID NO: 47 or SEQ ID NO: 49. The term also comprises any variants, derivatives and/or fragments of RSV P protein that, when expressed in a host cell, induces formation of VLPs. In some embodiments, the P polypeptide comprises the sequence set forth in
[0120] SEQ ID NO: 47 or SEQ ID NO: 49, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 47 or SEQ ID NO: 49, or a polypeptide comprising a portion of SEQ ID NO: 47 or SEQ ID NO: 49. The term also encompasses nucleotide sequences which encode for RSVP and/or any variants, derivatives and/or fragments thereof that when transfected (or infected) into a host cell will express RSV P protein and induce formation of VLPs. In some embodiments, the nucleotide sequence encoding RSV P protein comprises the sequence set forth in SEQ ID NO: 48 or SEQ ID NO: 50, or sequence having at or greater than about 80%, about 85%, about 90%, about 95%, about 98%, or about 99% homology with SEQ ID NO: 48 or SEQ ID NO: 50, or a polypeptide comprising a portion of SEQ ID NO: 48 or SEQ ID NO: 50.
[0121] In some embodiments, disclosed herein is a virus like particle (VLP) comprising a respiratory syncytial virus (RSV) M protein, an RSV P protein, an RSV F protein, and an RSV G protein, wherein the VLP further comprises an RSV M2-1 protein, an RSV N protein, or an RSV L protein.
[0122] In some aspects, disclosed herein are vaccines comprising VLPs of any preceding aspect.
[0123] In some embodiments, the vaccine further comprises an adjuvant.
[0124] Optionally, the vaccine contemplated herein can be combined with an adjuvant such as Freund's incomplete adjuvant, Freund's Complete adjuvant, alum, monophosphoryl lipid A, alum phosphate or hydroxide, QS-21, salts, i.e., AlK(SO4) 2, AlNa(SO4) 2, AlNH4 (SO4) 2, silica, kaolin, carbon polynucleotides, i.e., poly IC and poly AU. Additional adjuvants can include QuilA and Alhydrogel and the like. Optionally, the vaccine contemplated herein can be combined with immunomodulators and immunostimulants such as interleukins, interferons and the like. Many vaccine formulations are known to those of skill in the art.
[0125] In some embodiments, the vaccine further comprises a pharmaceutically acceptable carrier. The vaccines of the present invention can be administered to the appropriate subject in any manner known in the art, e.g., orally intramuscularly, intravenously, sublingual mucosal, intraarterially, intrathecally, intradermally, intraperitoneally, intranasally, intrapulmonarily, intraocularly, intravaginally, intrarectally or subcutaneously. They can be introduced into the gastrointestinal tract or the respiratory tract, e.g., by inhalation of a solution or powder containing the conjugates. In some embodiments, the compositions can be administered via absorption via a skin patch. Parenteral administration, if used, is generally characterized by injection. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspension in liquid prior to injection, or as emulsions. A more recently revised approach for parenteral administration involves use of a slow release or sustained release system, such that a constant level of dosage is maintained. In some embodiments, the one or more effective doses of the vaccine are administered to the subject via a route that is selected from the group consisting of an intramuscular route, a subcutaneous route, an intradermal route, an oral administration, a nasal administration, and inhalation.
[0126] A pharmaceutical composition (e.g., a vaccine) is administered in an amount sufficient to elicit production of antibodies and activation of CD4+ T cells and CD8+ T cells as part of an immunogenic response. Dosage for any given patient depends upon many factors, including the patient's size, general health, sex, body surface area, age, the particular compound to be administered, time and route of administration, and other drugs being administered concurrently. Determination of optimal dosage is well within the abilities of a pharmacologist of ordinary skill.
[0127] The vaccine compositions are administered to subjects which may become infected by a
[0128] Listeria described herein, including but not limited to dogs, cats, rabbits, rodents, horses, livestock (e.g., cattle, sheep, goats, and pigs), zoo animals, ungulates, primates, and humans. In some embodiments, the preferred subject is a human. In some embodiments, the subject is an infant or a child. In some embodiments, the human has an age less than 15 years old, 12 years old, 11 years old, 10 years old, 9 years old, 8 years old, 7 years old, 6 years old, 5 years old, 4 years old, 3 years old, 2 years old, or 1 year old.
EXAMPLES
[0129] The following examples are set forth below to illustrate the compounds, systems, methods, and results according to the disclosed subject matter. These examples are not intended to be inclusive of all aspects of the subject matter disclosed herein, but rather to illustrate representative methods and results. These examples are not intended to exclude equivalents and variations of the present invention which are apparent to one skilled in the art.
Example 1. Expression of G and F on RSV M Based Virus-Like Particles
[0130] VLPs were generated from sequentially transfecting 293F cells with codon-optimized DNA plasmids containing RSV genes. The order of transfection is listed in Table 1. Western blot studies showed the successful development of VLPs with the M plus phosphoprotein P or the M plus M2-1 protein platforms with F or F and G (
TABLE-US-00001 TABLE 1 Generation of RSV VLPs Order of transfection VLPs 1.sup.st 2.sup.nd 3.sup.rd 4.sup.th M M MFP M P F MFPG M P F G MFPG.sub.P M P F G.sub.P MFM2-1 M M2-1 F MFM2-1G M M2-1 F G MFM2-1G.sub.P M M2-1 F G.sub.P
[0131] Since this platform allows incorporating different F and G constructs into the VLPs, further modification was done to make the F protein constructs most effective at inducing an anti-viral response and G protein constructs most effective at inducing anti-viral, anti-inflammatory responses. For example, RSV VLPs with M, M2-1, F and a truncated G (referred to as G.sub.P; intra-cellular, transmembrane, and the 1.sup.st 20 aa of the extracellular domain plus aa 155-206 of the G protein) were developed. This construct focuses on inducing antibodies against CCD-G, not other parts of G, and improves anti-CCD-G antibody titers. Because G's central conserved domain is crucial for the vaccines developed herein, the current study generated a G peptide that consisted of amino acids 1-86+155-206 (G.sub.P) and generated full-length F and this G.sub.P on the same VLPs utilizing either M+P or M+M2-1 flatform. Immunoblotting results from sucrose gradient show F, GP, and M bands from the same fractions, indicating that they were from the same particles (
[0132] RSV M protein based VLPs with M2-1+F, M2-1+F+G, and P+F+G have not been reported previously. The M2-1 protein has two advantages over the P protein; it is part of the structural proteins that stabilize the RSV virion structure, i.e. better models the natural virus, and it facilitates T-cells immune responses, making RSV M+M2-1 VLPs an ideal RSV vaccine. Importantly, with either the RSV M+P or M+M2-1 VLPs, the structure of G can be modified to focus the response on the part of G important for inducing anti-inflammatory and anti-viral immune responses, i.e. the central conserved domain of G (CCD-G). CCD-G includes amino acids 155-206 on the G protein. The sequences are highly conserved within but not between the two antigenic/genetic groups of RSV, A and B. In primary human airway epithelial cells and in human infection,
[0133] CX3CR1 is an important receptor for infection and anti-CCD-G antibodies have an added anti-viral effect in humans.
Example 2. Electron Microscopic Study of VLPs
[0134] Electron microscopic studies of both MGFP and MFGM2-1 were performed to confirm the expression of G and F on VLPs. Negative stain showing spikes on VLP surface which were confirmed to include F spikes and/or G spikes by immunogold labeling with human anti-F motavizumab or human anti-G 3D3 monoclonal antibodies. Thus, the above data confirm successful generation of RSV matrix protein M+P or M+M2-1 based VLPs expressing both G and F.
Example 3. Immunogenicity of VLPs
[0135] To determine the immunogenicity of the VLPs, BALB/c mice (n=4) were immunized with various VLPs as detailed in Table 2. All immunized animals were challenged with 106 TCID50 of RSV r19F at 4 weeks after the 2nd, booster, immunization (
TABLE-US-00002 TABLE 2 Immunization schedule RSV Dose Immuni- challenge (per zation TCID50/ Days of Group N mouse) days Route mouse harvest M 4 50 g VLPs 0, 21 IM 10.sup.6 at 54 day 49 MFP 10.sup.6 at day 49 MFGP 10.sup.6 at day 49 MFG.sub.PP 10.sup.6 at day 49 MFM2-1 10.sup.6 at day 49 MFGM2-1 10.sup.6 at day 49 MFG.sub.PM2-1 10.sup.6 at day 49
Example 4. Immunized Animals have Reduced Lung Viral Titers
[0136] Next, the ability of the VLPs to prevent virus replication after challenge was investigated. The relative cycle threshold (CT) values were significant higher indicating less virus replication in animal groups that had P protein as part of the antigen VLPs, i.e. MFP, MFGP, and MFG.sub.PP compared to the control antigen (M only VLPs). A higher value of CT correlates with low copy of the gene being evaluated. Also, there were significant differences between MFG.sub.PP and MFP or MFGP (
Example 5. Lung Histopathology
[0137] Since one of the manifestations of RSV infection with r19F virus is overproduction of mucin, pulmonary inflammation was examined in challenged animals by Periodic acid-Schiff staining (PAS). The stained slides were analyzed by Aperio ImageScope software (Leica, Germany) and scored blindly using 0-4 severity scale then converted to 0-100 histopathology scale. Positive PAS staining was found, indicating the presence of mucin, in the lungs of all immunized animals but less so than the control animals immunized with M only VLPs (
Example 6. Discussion
[0138] An RSV based VLP platform is developed herein to express F+G, F+G peptide, or G plus a truncated F. The G plus truncated F VLP makes it possible to study G without most of the extracellular F protein, and approximates the structure, function, and immunogenicity of G in an RSV VLP platform without F. The carboxy terminal intracellular plus transmembrane plus a part of the initial extracellular domain of F was needed to efficiently incorporate G into the VLPs. These data show that the RSV VLP platform has advantages over the platforms previously used in Newcastle disease or influenza virus or bacterial phage P22 platforms with the RSV F and/or G proteins.
[0139] The RSV platform VLPs better represent native structures of F and G, and facilitate studies of their structure and function relationships. It also provides an all RSV antigen platform to develop F and G VLP vaccines. A truncated F (F.sub.t) that consists of the carbonyl terminus+transmembrane+26 amino acids of the amino terminus was generated and was co-expressed with a full-length G in M+P RSV VLP platform. This led to efficient G+F.sub.t VLPs which can be used to study G with minimal interference by extracellular F. The data also determined that peptides of extracellular G can be incorporated as a mean to focus responses to certain regions of G. Studies show a critical role of the central conserved domain of G (CCD-G) in RSV disease pathogenesis and generating anti-CCD-G antibodies decreases disease through both an anti-viral and anti-inflammatory effect. CCD-G contains the CX3C motif through which G binds to CX3CR1 and antibodies that block binding to CX3CR1 decreases infection since CX3CR1 is an important receptor for infection of human airway epithelial cells. Studies in animals and in human cells in vitro show that blocking binding to CX3CR1 effects the inflammatory response to RSV. The present disclosure shows the successful generation of VLPs with a truncated G composed of amino acids 1-86+155-206 of G (G.sub.P) with F in both M+P and M+M2-1 platforms.
[0140] P plays a crucial role in RSV polymerase activity interacting with both N and L protein in the process and also interacts with M2-1, but these roles do not suggest how it might help VLP formation when co-expressed with M. The M2-1 protein has transcription anti-termination activity and directly interacts with the M matrix protein providing a link to the RNA containing nucleocapsid.
[0141] Electron microscope negative stain studies revealed that both MFGP and MFGM2-1 VLPs expressed glycoproteins F and G as spikes. Immunoelectron microscopic studies confirmed the presence of F and G on VLP surfaces. No significant electron microscopic differences were observed between the two platforms of VLPs. The mouse studies show that the VLPs were immunogenic and induced serum antibodies against both F and G proteins at similar levels with either platform. Notably, the VLPs with Gp induced higher antibody titers and were more effective than VLPs with full length G. The M2-1 protein is effective at inducing short term protective T cell immunity, making it an ideal antigen for vaccine design. Of note, the G protein sequences used in this study are from a group A strain, A2 and these G sequences efficiently induced antibodies against a group A but not a group B G protein. Note that though CCD-G region, with the exception of a 13 amino acid sequence, is distinct between group A and group B strains, most of CCD-G is conserved within a group. Also, serum neutralizing antibody titers were tested, showing that immunized animals developed low levels of neutralizing antibodies. VLPs with a pre-fusion stabilized F protein can be more effective at inducing neutralizing antibodies.
[0142] Furthermore, animals immunized with G.sub.P and F expressed in either M plus P or M plus M2-1 VLPs had reduced lung viral titer and lung inflammation compared to those immunized with the control VLPs, demonstrating that both VLP platforms were effective.
[0143] The current VLPs described herein can express F and/or G with two RSV platforms (M+P proteins or M+M2-1 proteins). With both platforms F and/or G can be modified to focus specific structural and antigenic features of the proteins. Given the failures in RSV vaccine development, combining the highly effective anti-viral activity of F-induced antibodies plus anti-inflammatory and immune-enhancing features of G provides an effective RSV vaccine.
Example 7. Materials and Methods
[0144] Cells, Media and Plasmids: 293F cells stably transfected with plasmid pcDNA6/TR were provide by Dr. Xuemin Chen (Emory University) and cultured in freestyle 293 media (Gibco) on a shaker at 37 C., 8% CO.sub.2. pcDNA3.1 DNA plasmids containing codon-optimized RSV genes M, M2-1, P, G from A2 strain, and F from A2 strain were provided by Dr. Marty Moore (now at Meissa Vaccines) were digested by KpnI and XhOI enzymes and cloned into KpnI and XhOI double digested pcDNA4/TO or pcDNA5/TO vector. Human codon optimized truncated Gof amino acids 1-86+155-206 and synthesized by Genescript (Piscataway, NJ). The gene provided in pUC57 plasmid was double digested by BamHI and XhOI enzymes and cloned into BamHI and XhOI double digested pcDNA5/TO vector. All genes were sequenced to confirm authenticity prior to transfection. To generate VLPs, 293F cells were sequentially and stably transfected with the RSV genes noted below.
[0145] Virus-like particles expression and purification: 20-3010.sup.6 293F cells were induced with 2 ug/ml of doxycycline for 72 h. Cells were centrifuged at 300g for 10 min and the VLP-containing media was filtered through 0.45 m filter followed by centrifugation through 20% sucrose cushion at 12,200g for 2 h at 4 C. (SW Ti 32 rotor, Optima L-90K Ultracentrifuge, Beckman Coulter). The top layer of cell media and sucrose was thoroughly removed and the pellet was soaked in sterile PBS for 1 h on ice and resuspended. For sucrose gradient experiments, preparation of a linear sucrose gradient was described previously [Stone A B et al., 2009], 1 ml of the gradient was removed before the resuspended VLPs was layered onto the gradient and centrifuged with a Beckman Coulter SW 41 rotor at 11,000g for 12 h at 4 C. A total of 10 1-ml fractions were removed from top, diluted 3 with sterile PBS, and centrifuged at 12,000g for 1 h at 4 C. on a bench-top refrigerator. Supernatants were completely removed and pellets were soaked in sterile PBS for 1 h on ice before being resuspended.
[0146] Antibodies and Immunoblotting: the anti-G protein monoclonal antibody (mAb) 3D3 was provide by Trellis Bioscience (Redwood City, CA); the anti-F protein mAb motavizumab was provided by MedImmune (Gaithersburg, MD); rabbit serum anti-M antibody was provided by Dr. Oomens (Oklahoma State University); and goat anti RSV antibody was obtained from Millipore
[0147] (Burlington, MA). All anti-species fluorescent-conjugated secondary antibodies used in immunoblotting were obtained from LI-COR biosciences (Lincoln, NE). All HRP-conjugated secondary antibodies used in enzyme-linked immunosorbent assays (EIAs) were obtained from Jackson ImmunoResearch (West Grove, PA). For immunoblotting experiments, VLP samples were mixed with 2x Laemmli sample buffer (Bio-Rad) and boiled at 95 C. for 5 min. Samples were run on SDS-PAGE, transferred to a nitrocellulose membrane, blocked for 30 min in blocking buffer (5% dry milk in TTBS). After blotting with primary antibody (incubation period), membrane was washed 3x in TTBS following secondary antibody incubation (time) and 3x washes in TTBS. Signals were visualized by Odyssey CLX imaging system (LI-COR).
[0148] F, Ga, and Gb antibody EIAs: the secreted form of F, Ga or Gb protein antigens was produced from stably transfected 293F cells in serum-free media and coated onto 96-well microtiter plate in buffer. The plates were incubated in 2% nonfat dry milk dissolved in PBS blocking solution for 2 h at 37 C., washed with PBS-T, and serum specimens at 1:200 dilution added to the wells, incubated for 1 h at 37 C., the plates washed with PBS-T, and goat anti mouse IgG-HRP (1:5,000) added and incubated for 1 h at 37 C. Color was developed with OPD substrate and the reaction stopped after r 30 min at RT with 4N H.sub.2SO.sub.4. Optical density (OD) was measured at 490 nm and geometric mean of the OD490 was calculated from the triplicate wells.
[0149] RSV neutralizing antibody assay: heat inactivated sera were serially 2-fold diluted starting with a 1:10 dilution in MEM containing 0.5% FBS, incubated with RSV/A2 (100 TCID50) for 1 h at RT, and inoculated in triplicates onto non-confluent HEp-2 monolayers in 96-well plates for 1 h at 37 C. in a 5% CO.sub.2 incubator. MEM containing 5% FBS was added to all the wells and cells were incubated for 3 days at 37 C. in a 5% CO.sub.2 incubator. Cells were washed with PBS and fixed with 4% paraformaldehyde and RSV antigens detected by EIA with goat anti RSV antibody (1:5,000) followed with donkey anti goat IgG-HRP secondary antibody (1:5,000). Color was developed with OPD substrate and neutralization defined as a 50% reduction in OD value. The titer was estimated using the Reed and Much method. The geometric means+SEM for all animals in a group at any given time were calculated.
[0150] Virus: A recombinant virus of RSV A2 backbone expressing the F protein from L19 virus (r19F) [Moore M L et al., 2009] was chosen as the challenge virus since it induces airway disease that parallel RSV infection in humans but not seen with RSV A2. Stock virus was prepared by inoculating onto subconfluent HEp-2 at a multiplicity of infection (MOI) 0.01 for 2 h at 37 C. in 5% CO.sub.2 incubator using 0.5% fetal bovine serum (FBS)-containing minimal essential medium (MEM). 5% FBS MEM was added and cells were incubated in 37 C., 5% CO.sub.2 incubator for 3 days. Cells were frozen and thawed twice at 80C and 4 C., respectively, and centrifuged at 2,000 rpm for 15 min at 4 C. to remove cellular debris. The supernatant was layered onto 20% sucrose layer and centrifuged at 12,200g for 2 h at 4 C. Pellet was resuspended in serum free MEM, divided into aliquots, and snap frozen in liquid nitrogen. The aliquots were stored at 80 C. until use. The infectivity titer of the inoculum was determined by serial 10-fold dilutions in subconfluent HEp-2 cell monolayer for 3 days and virus replication detected by EIA for RSV antigens with goat-anti RSV antibody. Titer was estimated from wells with absorbance >3standard deviations above the mean absorbance for wells without virus by Reed and Muench method.
[0151] Animal study: 4-6 weeks old female BALB/c mice were purchased from Charles River Lab (Wilmington, MA) and housed at Emory's Pediatric animal facility under food ad libitum in microisolator cages with auto sterilized water. All animal handlings and procedures were carried out according to protocol approved by Emory University (Atlanta, GA) Institutional Animals Care and Use Committee. For challenge study, mice were intranasally infected with 106 CTID50 RSV r19F A2 in 40 l.
[0152] Real-time PCR: total RNA was extracted and purified from lung homogenates using Qiagen RNeasy kit (QIAGEN). RNA was reverse transcribed into cDNA using iScript cDNA synthesis kit (Bio-Rad) following the manufacturer's instruction. Quantitative PCR was carried out on a 7500 Fast Real-time PCR system (Applied Biosystems) using Power SYBR Green PCR master mix (Applied Biosystems). CT values were normalized using control -actin CT values from the same samples. RSV matrix M gene primers and amplification cycles were described previously [Boyoglu-Barnum S et al., 2017]. Other primer pairs used were: B-actin, forward 5-CAC CAA CTG GGA CGA CAT-3, reverse 5-ACA GCC TGG ATA GCA ACG-3. mRNA levels were expressed as the geometric meanSEM for all animals in a group.
[0153] Pulmonary histopathology: lungs were isolated and fixed in 10% neutral buffered formalin for 24 h. The lungs were then embedded in paraffin, sectioned, and stained with Periodic acid-Schiff (PAS). Slides were analyzed by Aperio ImageScope software (Leica) and scored blinded to treatment on a 0-4 scale and subsequently converted to a 0-100% histopathology scale.
[0154] Statistical Analysis: unless otherwise indicated, different groups were compared by Wilcoxon rank sum test or Wilcoxon matched pairs test. A p value of <0.05 was considered statistically significant. Data are shown as means and standard errors of the mean (SEM).
REFERENCES
[0155] 1. Hall C B, Simoes E A, Anderson L J. Clinical and epidemiologic features of respiratory syncytial virus. Curr Top Microbiol Immunol. 2013; 372:39-57. [0156] 2. Shi T, McAllister D A, O'Brien K L, et al. Global, regional, and national disease burden estimates of acute lower respiratory infections due to respiratory syncytial virus in young children in 2015: a systematic review and modelling study. Lancet. 2017; 390 (10098): 946-958. [0157] 3. Jartti T, Gern J E. Role of viral infections in the development and exacerbation of asthma in children. J Allergy Clin Immunol. 2017; 140 (4): 895-906. [0158] 4. Wu P, Hartert T V. Evidence for a causal relationship between respiratory syncytial virus infection and asthma. Expert Rev Anti Infect Ther. 2011; 9 (9): 731-745. [0159] 5. Stockman L J, Curns A T, Anderson L J, Fischer-Langley G. Respiratory Syncytial Virus-associated Hospitalizations Among Infants and Young Children in the United States, 1997-2006. Pediatr Infect Dis J. 2012; 31 (1): 5-9. [0160] 6. Hall C B, Weinberg G A, Iwane M K, et al. The burden of respiratory syncytial virus infection in young children. N Engl J Med. 2009; 360 (6): 588-598. [0161] 7. Mazur N I, Higgins D, Nunes M C, et al. The respiratory syncytial virus vaccine landscape: lessons from the graveyard and promising candidates. Lancet Infect Dis. 2018; 18 (10):e295-e311. [0162] 8. Collins P L, Fearns R, Graham B S. Respiratory Syncytial Virus: Virology, Reverse Genetics, and Pathogenesis of Disease. In: Anderson L J, Graham B S, eds. Challenges and Opportunities for Respiratory Syncytial Virus Vaccines. Current Topics in Microbiology and Immunology, vol 372. Vol 372. Berlin, Heidelberg Springer; 2013:3-38. [0163] 9. Anderson L J. Respiratory syncytial virus vaccine development. Seminars in immunology. 2013; 25 (2): 160-171. [0164] 10. Schepens B, Sedeyn K, Vande Ginste L, et al. Protection and mechanism of action of a novel human respiratory syncytial virus vaccine candidate based on the extracellular domain of small hydrophobic protein. EMBO Mol Med. 2014; 6 (11): 1436-1454. [0165] 11. Ngwuta J O, Chen M, Modjarrad K, et al. Prefusion F-specific antibodies determine the magnitude of RSV neutralizing activity in human sera. Science translational medicine. 2015; 7 (309): 309ra162. [0166] 12. Graham B S. Immunological goals for respiratory syncytial virus vaccine development. Curr Opin Immunol. 2019; 59:57-64. [0167] 13. Tripp R A, Power U F, Openshaw PJM, Kauvar L M. Respiratory Syncytial Virus: Targeting the G Protein Provides a New Approach for an Old Problem. J Virol. 2018; 92 (3). [0168] 14. Tripp R A. CX3C chemokine mimicry by respiratory syncytial virus G glycoprotein. In: Mahalingam S, ed. Chemokines in Viral Infection. Landes Bioscience; 2003. [0169] 15. Boyoglu-Barnum S, Gaston K A, Todd S O, et al. A respiratory syncytial virus (RSV) anti-G protein F(ab)2 monoclonal antibody suppresses mucous production and breathing effort in RSV rA2-line19F-infected BALB/c mice. J Virol. 2013; 87 (20): 10955-10967. [0170] 16. Boyoglu-Barnum S, Todd S O, Chirkova T, et al. An anti-G protein monoclonal antibody treats RSV disease more effectively than an anti-F monoclonal antibody in BALB/c mice. Virology. 2015; 483:117-125. [0171] 17. Radu G U, Caidi H, Miao C, Tripp R A, Anderson L J, Haynes L M. Prophylactic treatment with a G glycoprotein monoclonal antibody reduces pulmonary inflammation in respiratory syncytial virus (RSV)-challenged naive and formalin-inactivated RSV-immunized BALB/c mice. J Virol. 2010; 84 (18): 9632-9636. [0172] 18. Rey G U, Miao C, Caidi H, et al. Decrease in formalin-inactivated respiratory syncytial virus (FI-RSV) enhanced disease with RSV G glycoprotein peptide immunization in BALB/c mice. PLOS One. 2013; 8 (12):e83075. [0173] 19. Jorquera P A, Choi Y, Oakley K E, et al. Nanoparticle vaccines encompassing the respiratory syncytial virus (RSV) G protein CX3C chemokine motif induce robust immunity protecting from challenge and disease. PLOS One. 2013; 8 (9):e74905. [0174] 20. Zhang W, Choi Y, Haynes L M, et al. Vaccination to induce antibodies blocking the CX3C-CX3CR1 interaction of respiratory syncytial virus G protein reduces pulmonary inflammation and virus replication in mice. J Virol. 2010; 84 (2): 1148-1157. [0175] 21. Murawski M R, McGinnes L W, Finberg R W, et al. Newcastle disease virus-like particles containing respiratory syncytial virus G protein induced protection in BALB/c mice, with no evidence of immunopathology. J Virol. 2010; 84 (2): 1110-1123. [0176] 22. Quan F S, Kim Y, Lee S, et al. Viruslike particle vaccine induces protection against respiratory syncytial virus infection in mice. J Infect Dis. 2011; 204 (7): 987-995. [0177] 23. Schwarz B, Morabito K M, Ruckwardt T J, et al. Viruslike Particles Encapsidating Respiratory Syncytial Virus M and M2 Proteins Induce Robust T Cell Responses. ACS Biomater Sci Eng. 2016; 2 (12): 2324-2332.
[0178] 24 Meshram C D, Baviskar P S, Ognibene C M, Oomens AGP. The Respiratory Syncytial Virus Phosphoprotein, Matrix Protein, and Fusion Protein Carboxy-Terminal Domain Drive Efficient Filamentous Virus-Like Particle Formation. J Virol. 2016; 90 (23): 10612-10628. [0179] 25. Shaikh F Y, Cox R G, Lifland A W, et al. A critical phenylalanine residue in the respiratory syncytial virus fusion protein cytoplasmic tail mediates assembly of internal viral proteins into viral filaments and particles. mBio. 2012; 3 (1). [0180] 26. Walpita P, Johns L M, Tandon R, Moore M L. Mammalian Cell-Derived Respiratory Syncytial Virus-Like Particles Protect the Lower as well as the Upper Respiratory Tract. PLOS One. 2015; 10 (7):e0130755. [0181] 27. Stone A B. A simplified method for preparing sucrose gradients. Biochem J. 1974; 137 (1): 117-118. [0182] 28. Moore M L, Chi M H, Luongo C, et al. A chimeric A2 strain of respiratory syncytial virus (RSV) with the fusion protein of RSV strain line 19 exhibits enhanced viral load, mucus, and airway dysfunction. J Virol. 2009; 83 (9): 4185-4194. [0183] 29. Boyoglu-Barnum S, Todd S O, Meng J, et al. Mutating the CX3C Motif in the G Protein Should Make a Live Respiratory Syncytial Virus Vaccine Safer and More Effective. J Virol. 2017; 91 (10). [0184] 30. Liu J, Haddad E K, Marceau J, et al. A Numerically Subdominant CD8 T Cell Response to Matrix Protein of Respiratory Syncytial Virus Controls Infection with Limited Immunopathology. PLOS Pathog. 2016; 12 (3):e1005486. [0185] 31. Kiss G, Holl J M, Williams G M, et al. Structural analysis of respiratory syncytial virus reveals the position of M2-1 between the matrix protein and the ribonucleoprotein complex. J Virol. 2014; 88 (13): 7602-7617. [0186] 32. Li D, Jans D A, Bardin P G, Meanger J, Mills J, Ghildyal R. Association of respiratory syncytial virus M protein with viral nucleocapsids is mediated by the M2-1 protein. J Virol. 2008; 82 (17): 8863-8870. [0187] 33. Chirkova T, Lin S, Oomens A G, et al. CX3CR1 is an important surface molecule for respiratory syncytial virus infection in human airway epithelial cells. J Gen Virol. 2015; 96 (9): 2543-2556. [0188] 34. Jeong K I, Piepenhagen P A, Kishko M, et al. CX3CR1 Is Expressed in Differentiated Human Ciliated Airway Cells and Co-Localizes with Respiratory Syncytial Virus on Cilia in a G Protein-Dependent Manner. PLOS One. 2015; 10 (6):e0130517. [0189] 35. Johnson S M, McNally B A, Ioannidis I, et al. Respiratory Syncytial Virus Uses CX3CR1 as a Receptor on Primary Human Airway Epithelial Cultures. PLOS Pathog. 2015; 11 (12):e1005318. [0190] 36. Chirkova T, Boyoglu-Barnum S, Gaston K A, et al. Respiratory syncytial virus G protein CX3C motif impairs human airway epithelial and immune cell responses. J Virol. 2013; 87 (24): 13466-13479. [0191] 37. Meshram C D, Baviskar P S, Ognibene C M, Oomens A G. The Respiratory Syncytial Virus Phosphoprotein, Matrix Protein, and Fusion Protein Carboxy-Terminal Domain Drive Efficient Filamentous Virus-Like Particle Formation. J Virol. 2016; 90 (23): 10612-10628. [0192] 38. Cowton V M, McGivern D R, Fearns R. Unravelling the complexities of respiratory syncytial virus RNA synthesis. J Gen Virol. 2006; 87 (Pt 7): 1805-1821. [0193] 39. Bakker S E, Duquerroy S, Galloux M, et al. The respiratory syncytial virus nucleoprotein-RNA complex forms a left-handed helical nucleocapsid. J Gen Virol. 2013; 94 (Pt 8): 1734-1738. [0194] 40. Tawar R G, Duquerroy S, Vonrhein C, et al. Crystal structure of a nucleocapsid-like nucleoprotein-RNA complex of respiratory syncytial virus. Science. 2009; 326 (5957): 1279-1283. [0195] 41. Esperante S A, Paris G, de Prat-Gay G. Modular unfolding and dissociation of the human respiratory syncytial virus phosphoprotein p and its interaction with the m (2-1) antiterminator: a singular tetramer-tetramer interface arrangement. Biochemistry. 2012; 51 (41): 8100-8110. [0196] 42. Fearns R, Collins P L. Role of the M2-1 transcription antitermination protein of respiratory syncytial virus in sequential transcription. J Virol. 1999; 73 (7): 5852-5864. [0197] 43. Tanner S J, Ariza A, Richard C A, et al. Crystal structure of the essential transcription antiterminator M2-1 protein of human respiratory syncytial virus and implications of its phosphorylation. Proc Natl Acad Sci USA. 2014; 111 (4):1580-1585. [0198] 44. Ke Z, Dillard R S, Chirkova T, et al. The Morphology and Assembly of Respiratory Syncytial Virus Revealed by Cryo-Electron Tomography. Viruses. 2018; 10 (8). [0199] 45. Collins P L C J. Respiratory syncytial virus and metapneumovirus. In: Fields virology, 5th ed. Philadelphia, P A: Lippincott Williams & Wilkins; 2007:1601-1646. [0200] 46. Connors M, Collins P L, Firestone C-Y, Murphy B R. Respiratory syncytial virus (RSV) F, G, M2 (22K), and N proteins each induce resistance to RSV Challenge, but resistance induced by M2 and N proteins is relatively short-lived. J Virol. 1991; 65:1634-1637. [0201] 47. Green C A, Scarselli E, Sande C J, et al. Chimpanzee adenovirus- and MVA-vectored respiratory syncytial virus vaccine is safe and immunogenic in adults. Science translational medicine. 2015; 7 (300): 300ra126. [0202] 48. Mclellan J S, Ray W C, Peeples M E. Structure and function of respiratory syncytial virus surface glycoproteins. Curr Top Microbiol Immunol. 2013; 372:83-104. [0203] 49. McLellan J S, Chen M, Joyce M G, et al. Structure-based design of a fusion glycoprotein vaccine for respiratory syncytial virus. Science. 2013; 342 (6158): 592-598. [0204] 50. Krarup A, Truan D, Furmanova-Hollenstein P, et al. A highly stable prefusion RSV F vaccine derived from structural analysis of the fusion mechanism. Nat Commun. 2015; 6:8143. [0205] 51. McLellan J S, Chen M, Joyce M G, et al. Structure-based design of a fusion glycoprotein vaccine for respiratory syncytial virus. Science. 2013; 342 (6158): 592-598. [0206] 51. Krarup A, Truan D, Furmanova-Hollenstein P, et al. A highly stable prefusion RSV F vaccine derived from structural analysis of the fusion mechanism. Nat Commun. 2015; 6:8143.
[0207] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed invention belongs. Publications cited herein and the materials for which they are cited are specifically incorporated by reference.
[0208] Those skilled in the art will appreciate that numerous changes and modifications can be made to the preferred embodiments of the invention and that such changes and modifications can be made without departing from the spirit of the invention. It is, therefore, intended that the appended claims cover all such equivalent variations as fall within the true spirit and scope of the invention.
TABLE-US-00003 SEQUENCES SEQIDNO:1(aminoacidsequenceforRSVGtruncatedCX3Caa1-86+155-206codon- optimized(Astrain)) MSKNKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSVAQITLSILAIVISTSLIIAAIIFIASANHKVTPTTAIIQDATSQIKNT PPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKP SEQIDNO:2(nucleotidesequenceforRSVGtruncatedCX3Caa1-86+155-206codon- optimized(Astrain)) ATGAGCAAGAACAAGGACCAGCGGACCGCCAAGACACTGGAAAGAACCTGGGACACCCTGAACCATCTGCTGTTC ATCAGCAGCTGCCTGTACAAGCTGAACCTGAAGTCTGTGGCCCAGATCACCCTGAGCATCCTGGCCATCGTGATCA GCACCAGCCTGATCATTGCCGCCATCATCTTTATCGCCAGCGCCAACCACAAAGTGACCCCTACCACAGCCATCATC CAGGACGCCACAAGCCAGATCAAGAACACCCCTCCAAGCAAGCCCAACAACGACTTCCACTTCGAGGTGTTCAACT TCGTGCCCTGCAGCATCTGCAGCAACAATCCTACCTGCTGGGCCATCTGCAAGAGAATCCCCAACAAGAAGCCCGG CAAAAAGACCACCACAAAGCCCACAAAGAAGCCCTAG SEQIDNO:3(aminoacidsequencefortruncatedRSVGproteinaminoacid1-206(Astrain)) MSKNKDQRTTKTLEKTWDTLNHLLFISSCLYKLNLKSIAQITLSILAMIISTSLIIAAIIFIASANHKVTLT TAIIQDATSQIKNTTPTYLTQNPQLGISFSNLSETTSQTTTILASTTPSVKSTLQSTTVKTKNTTTTKIQ PSKPTTKQRQNKPPNKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKP SEQIDNO:4(nucleotidesequencefortruncatedRSVGproteinaminoacid1-206(Astrain)) ATGTCCAAAAACAAGGACCAACGCACCACCAAGACACTAGAAAAG ACCTGGGACACTCTCAATCATCTATTATTCATATCATCGTGCTTATACAAGTTAAATCTTAAATC TATAGCACAAATCACATTATCCATTCTGGCAATGATAATCTCAACTTCACTTATAATTGCAGCCA TCATATTCATAGCCTCGGCAAACCACAAAGTCACACTAACAACTGCAATCATACAAGATGCAAC AAGCCAGATCAAGAACACAACCCCAACATACCTCACCCAGAATCCCCAGCTTGGAATCAGCTT CTCCAATCTGTCTGAAACTACATCACAAACCACCACCATACTAGCTTCAACAACACCAAGTGTC AAGTCAACCCTGCAATCCACAACAGTCAAGACCAAAAACACAACAACAACCAAAATACAACCC AGCAAGCCCACCACAAAACAACGCCAAAACAAACCACCAAACAAACCCAATAATGATTTTCAC TTTGAAGTGTTCAACTTTGTACCTTGCAGCATATGCAGCAACAATCCAACCTGCTGGGCTATCT GTAAAAGAATACCAAACAAAAAACCTGGAAAGAAAACCACCACCAAGCCCACAAAAAAACCA SEQIDNO:5(aminoacidsequenceforRSVGprotein1-206codon-optimized(Astrain)) MSKNKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSVAQITLSILAIVISTSLIIAAIIFIASANHKVTPTTAIIQDATSQIKNT TPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVF NFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKP SEQIDNO:6(nucleotidesequenceforRSVGprotein1-206codon-optimized(Astrain)) ATGAGCAAGAACAAGGACCAGCGGACCGCCAAGACACTGGAAAGAACCTGGGACACCCTGAACCATCTGCTGTT CATCAGCAGCTGCCTGTACAAGCTGAACCTGAAGTCTGTGGCCCAGATCACCCTGAGCATCCTGGCCATCGTGATC AGCACCAGCCTGATCATTGCCGCCATCATCTTTATCGCCAGCGCCAACCACAAAGTGACCCCTACCACAGCCATCAT CCAGGACGCCACAAGCCAGATCAAGAACACCACACCTACCTACCTGACACAGAACCCTCAGCTGGGCATCAGCCCT AGCAATCCTAGCGAGATCACCTCTCAGATCACCACAATCCTGGCCAGCACAACCCCTGGCGTGAAGTCTACACTGC AGAGCACCACCGTGAAAACGAAGAATACCACCACCACACAGACCCAGCCTAGCAAGCCTACCACCAAGCAGAGAC AGAACAAGCCTCCAAGCAAGCCCAACAACGACTTCCACTTCGAGGTGTTCAACTTCGTGCCCTGCAGCATCTGCAG CAACAATCCTACCTGCTGGGCCATCTGCAAGAGAATCCCCAACAAGAAGCCCGGCAAAAAGACCACCACAAAGCC CACAAAGAAGCCCTAG SEQIDNO:7(aminoacidsequenceforRSVGprotein(Astrain),NCBIReferenceSequence: NC_001803.1) MSKNKDQRTTKTLEKTWDTLNHLLFISSCLYKLNLKSIAQITLSILAMIISTSLIIAAIIFIASANHKVTLT TAIIQDATSQIKNTTPTYLTQNPQLGISFSNLSETTSQTTTILASTTPSVKSTLQSTTVKTKNTTTTKIQ PSKPTTKQRQNKPPNKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTIK TTKKDLKPQTTKPKEVPTTKPTEKPTINTTKTNIRTTLLTNNTTGNPEHTSQKGTLHSTSSDGNPSPS QVYTTSEYLSQPPSPSNTTNQ SEQIDNO:8(nucleotidesequenceforRSVGprotein(Astrain),NCBIReference Sequence:NC_001803.1) ATGTCCAAAAACAAGGACCAACGCACCACCAAGACACTAGAAAAGAAATCTATAGCACAAATC ACATTATCCATTCTGGCAATGATAATCTCAACTTCACTTATAATTGCAGCCATCATATTCATAGCC TCGGCAAACCACAAAGTCACACTAACAACTGCAATCATACAAGATGCAACAAGCCAGATCAAG AACACAACCCCAACATACCTCACCCAGAATCCCCAGCTTGGAATCAGCTTCTCCAATCTGTCTGA AACTACATCACAAACCACCACCATACTAGCTTCAACAACACCAAGTGTCAAGTCAACCCTGCAA TCCACAACAGTCAAGACCAAAAACACAACAACAACCAAAATACAACCCAGCAAGCCCACCACA AAACAACGCCAAAACAAACCACCAAACAAACCCAATAATGATTTTCACTTTGAAGTGTTCAACT TTGTACCTTGCAGCATATGCAGCAACAATCCAACCTGCTGGGCTATCTGTAAAAGAATACCAAA CAAAAAACCTGGAAAGAAAACCACCACCAAGCCCACAAAAAAACCAACCATCAAGACAACCAA AAAAGATCTCAAACCTCAAACCACAAAACCAAAGGAAGTACCTACCACCAAGCCCACAGAAAA GCCAACCATCAACACCACCAAAACAAACATCAGAACTACACTGCTCACCAACAATACCACAGGA AATCCAGAACACACAAGTCAAAAGGGAACCCTCCACTCAACCTCCTCCGATGGCAATCCAAGCC CTTCACAAGTCTATACAACATCCGAGTACCTATCACAACCTCCATCTCCATCCAACACAACAAAC CAGTAG SEQIDNO:9(aminoacidsequenceforRSVGproteinfulllengthcodon-optimized(Astrain)) MSKNKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSVAQITLSILAIVISTSLIIAAIIFIASANHKVTPTTAIIQDATSQIKNT TPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVF NFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNT TGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ SEQIDNO:10(nucleotidesequenceforRSVGproteinfulllengthcodon- optimized(Astrain)) ATGAGCAAGAACAAGGACCAGCGGACCGCCAAGACACTGGAAAGAACCTGGGACACCCTGAACCATCTGCTGTT CATCAGCAGCTGCCTGTACAAGCTGAACCTGAAGTCTGTGGCCCAGATCACCCTGAGCATCCTGGCCATCGTGATC AGCACCAGCCTGATCATTGCCGCCATCATCTTTATCGCCAGCGCCAACCACAAAGTGACCCCTACCACAGCCATCAT CCAGGACGCCACAAGCCAGATCAAGAACACCACACCTACCTACCTGACACAGAACCCTCAGCTGGGCATCAGCCCT AGCAATCCTAGCGAGATCACCTCTCAGATCACCACAATCCTGGCCAGCACAACCCCTGGCGTGAAGTCTACACTGC AGAGCACCACCGTGAAAACGAAGAATACCACCACCACACAGACCCAGCCTAGCAAGCCTACCACCAAGCAGAGAC AGAACAAGCCTCCAAGCAAGCCCAACAACGACTTCCACTTCGAGGTGTTCAACTTCGTGCCCTGCAGCATCTGCAG CAACAATCCTACCTGCTGGGCCATCTGCAAGAGAATCCCCAACAAGAAGCCCGGCAAAAAGACCACCACAAAGCC CACAAAGAAGCCCACACTGAAAACCACCAAGAAGGACCCCAAGCCTCAGACCACCAAGTCCAAAGAGGTGCCCAC CACCAAACCTACCGAGGAACCCACCATCAACACCACTAAGACCAACATCATCACCACACTGCTGACCTCCAACACC ACCGGCAATCCTGAACTGACCAGCCAGATGGAAACCTTCCACAGCACCTCCAGCGAGGGCAACCCATCTCCTAGTC AGGTGTCCACCACAAGCGAGTACCCTAGCCAGCCAAGCAGCCCTCCTAACACACCTAGACAGTAG SEQIDNO:11(aminoacidsequenceforRSVGAstrainCX4Caa1-86+155-206codon- optimized) MSKNKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSVAQITLSILAIVISTSLIIAAIIFIASANHKVTPTTAIIQDATSQIKNT PPSKPNNDFHFEVFNFVPCSICSNNPTCWAIACKRIPNKPGKKTTTKPTKKP SEQIDNO:12(nucleotidesequenceforRSVGAstrainCX4Caa1-86+155-206codon- optimized) ATGAGCAAGAACAAGGACCAGCGGACCGCCAAGACACTGGAAAGAACCTGGGACACCCTGAACCATCTGCTGTT CATCAGCAGCTGCCTGTACAAGCTGAACCTGAAGTCTGTGGCCCAGATCACCCTGAGCATCCTGGCCATCGTGATC AGCACCAGCCTGATCATTGCCGCCATCATCTTTATCGCCAGCGCCAACCACAAAGTGACCCCTACCACAGCCATCAT CCAGGACGCCACAAGCCAGATCAAGAACACCCCTCCAAGCAAGCCCAACAACGACTTCCACTTCGAGGTGTTCAAC TTCGTGCCCTGCAGCATCTGCAGCAACAATCCTACCTGCTGGGCCATCGCCTGCAAGAGAATCCCCAACAAGAAGC CCGGCAAAAAGACCACCACAAAGCCCACAAAGAAGCCCTAG SEQIDNO:13(aminoacidsequenceforRSVGproteinfulllengthCX4C(Astrain)) MSKNKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSVAQITLSILAIVISTSLIIAAIIFIASANHKVTPTTAIIQDATSQIKNT TPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVF NFVPCSICSNNPTCWAIACKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTS NTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ SEQIDNO:14(nucleotidesequenceforRSVGproteinfulllengthCX4C(Astrain)) ATGAGCAAGAACAAGGACCAGCGGACCGCCAAGACACTGGAAAGAACCTGGGACACCCTGAACCATCTGCTGTT CATCAGCAGCTGCCTGTACAAGCTGAACCTGAAGTCTGTGGCCCAGATCACCCTGAGCATCCTGGCCATCGTGATC AGCACCAGCCTGATCATTGCCGCCATCATCTTTATCGCCAGCGCCAACCACAAAGTGACCCCTACCACAGCCATCAT CCAGGACGCCACAAGCCAGATCAAGAACACCACACCTACCTACCTGACACAGAACCCTCAGCTGGGCATCAGCCCT AGCAATCCTAGCGAGATCACCTCTCAGATCACCACAATCCTGGCCAGCACAACCCCTGGCGTGAAGTCTACACTGC AGAGCACCACCGTGAAAACGAAGAATACCACCACCACACAGACCCAGCCTAGCAAGCCTACCACCAAGCAGAGAC AGAACAAGCCTCCAAGCAAGCCCAACAACGACTTCCACTTCGAGGTGTTCAACTTCGTGCCCTGCAGCATCTGCAG CAACAATCCTACCTGCTGGGCCATCGCCTGCAAGAGAATCCCCAACAAGAAGCCCGGCAAAAAGACCACCACAAA GCCCACAAAGAAGCCCACACTGAAAACCACCAAGAAGGACCCCAAGCCTCAGACCACCAAGTCCAAAGAGGTGCC CACCACCAAACCTACCGAGGAACCCACCATCAACACCACTAAGACCAACATCATCACCACACTGCTGACCTCCAAC ACCACCGGCAATCCTGAACTGACCAGCCAGATGGAAACCTTCCACAGCACCTCCAGCGAGGGCAACCCATCTCCTA GTCAGGTGTCCACCACAAGCGAGTACCCTAGCCAGCCAAGCAGCCCTCCTAACACACCTAGACAGTAG SEQIDNO:15(aminoacidsequenceforRSVGtruncatedCX3Caa1-86+155-206(Bstrain)) MSKHKNQRTARTLEKTWDTLNHLIVISSCLYRLNLKSIAQIALSVLAMIISTSLIIAAIIFIISANHKVTLTTVTVQTIKNHTEK NPPKKPKDDYHFEVFNFVPCSICGNNQLCKSICKTIPSNKPKKKPTIKPTNKP SEQIDNO:16(nucleotidesequenceforRSVGtruncatedCX3Caa1-86+155-206(Bstrain)) ATGTCCAAACACAAGAATCAACGCACTGCCAGGACTCTAGAAAAGACCTGGGATACTCTCAATCATCTAATTGTAA TATCCTCTTGTTTATACAGATTAAATTTAAAATCTATAGCACAAATAGCACTATCAGTTCTGGCAATGATAATCTCAA CCTCTCTCATAATTGCAGCCATAATATTCATCATCTCTGCCAATCACAAAGTTACACTAACAACGGTCACAGTTCAAA CAATAAAAAACCACACTGAAAAAAACCCACCAAAAAAACCAAAAGATGATTACCATTTTGAAGTGTTCAACTTCGT TCCCTGTAGTATATGTGGCAACAATCAACTTTGCAAATCCATCTGTAAAACAATACCAAGCAACAAACCAAAGAAG AAACCAACCATCAAACCCACAAACAAACCATAG SEQIDNO:17(aminoacidsequenceformutatedRSVGtruncatedCX3Caa1- 86+155-206(Bstrain)) MSKHKNQRTARTLEKTWDTLNHLIVISSCLYRLNLKSIAQIALSVLAIVISTSLIIAAIIFIISANHKVTLT TVTVQTIKNHTEKNPPKKPKDDYHFEVFNFVPCSICGNNQLCKSICKTIPSNKPKKKPTIKPTNKP SEQIDNO:18(nucleotidesequenceformutatedRSVGtruncatedCX3Caa1- 86+155-206(Bstrain)) ATGTCCAAACACAAGAATCAACGCACTGCCAGGACTCTAGAAAAGACCTGGGATACTCTCAAT CATCTAATTGTAATATCCTCTTGTTTATACAGATTAAATTTAAAATCTATAGCACAAATAGCACT ATCAGTTCTGGCAATCGTGATCTCAACCTCTCTCATAATTGCAGCCATAATATTCATCATCTCTG CCAATCACAAAGTTACACTAACAACGGTCACAGTTCAAACAATAAAAAACCACACTGAAAAAA ACCCACCAAAAAAACCAAAAGATGATTACCATTTTGAAGTGTTCAACTTCGTTCCCTGTAGTAT ATGTGGCAACAATCAACTTTGCAAATCCATCTGTAAAACAATACCAAGCAACAAACCAAAGAA GAAACCAACCATCAAACCCACAAACAAACCATAG SEQIDNO:19(aminoacidsequenceforRSVGproteinBstrain,NCBI ReferenceSequence:NC_001781.1) MSKHKNQRTARTLEKTWDTLNHLIVISSCLYRLNLKSIAQIALSVLAMIISTSLIIAAIIFIISANHKVTLT TVTVQTIKNHTEKNITTYLTQVPPERVSSSKQPTTTSPIHTNSATTSPNTKSETHHTTAQTKGRTTTS TQTNKPSTKPRLKNPPKKPKDDYHFEVFNFVPCSICGNNQLCKSICKTIPSNKPKKKPTIKPTNKPTT KTTNKRDPKTPAKTTKKETTTNPTKKPTLTTTERDTSTSQSTVLDTTTLEHTIQQQSLHSTTPENTPN STQTPTASEPSTSNSTQNTQSHA SEQIDNO:20(nucleotidesequenceforRSVGproteinBstrain,NCBI ReferenceSequence:NC_001781.1) ATGTCCAAACACAAGAATCAACGCACTGCCAGGACTCTAGAAAAGACCTGGGATACTCTCAAT CATCTAATTGTAATATCCTCTTGTTTATACAGATTAAATTTAAAATCTATAGCACAAATAGCACT ATCAGTTCTGGCAATGATAATCTCAACCTCTCTCATAATTGCAGCCATAATATTCATCATCTCTG CCAATCACAAAGTTACACTAACAACGGTCACAGTTCAAACAATAAAAAACCACACTGAAAAAA ACATCACCACCTACCTTACTCAAGTCCCACCAGAAAGGGTTAGCTCATCCAAACAACCTACAAC CACATCACCAATCCACACAAATTCAGCCACAACATCACCCAACACAAAGTCAGAAACACACCAC ACAACAGCACAAACCAAAGGCAGAACCACCACCTCAACACAGACCAACAAGCCGAGCACAAAA CCACGCCTAAAAAATCCACCAAAAAAACCAAAAGATGATTACCATTTTGAAGTGTTCAACTTCG TTCCCTGTAGTATATGTGGCAACAATCAACTTTGCAAATCCATCTGTAAAACAATACCAAGCAA CAAACCAAAGAAGAAACCAACCATCAAACCCACAAACAAACCAACCACCAAAACCACAAACAA AAGAGACCCAAAAACACCAGCCAAAACGACGAAAAAAGAAACTACCACCAACCCAACAAAAA AACCAACCCTCACGACCACAGAAAGAGACACCAGCACCTCACAATCCACTGTGCTCGACACAAC CACATTAGAACACACAATCCAACAGCAATCCCTCCACTCAACCACCCCCGAAAACACACCCAAC TCCACACAAACACCCACAGCATCCGAGCCCTCTACATCAAATTCCACCCAAAATACCCAATCACA TGCTTAG SEQIDNO:21(aminoacidsequenceformutatedRSVGproteinfulllength(Bstrain)) MSKHKNQRTARTLEKTWDTLNHLIVISSCLYRLNLKSIAQIALSVLAIVISTSLIIAAIIFIISANHKVTLTT VTVQTIKNHTEKNITTYLTQVPPERVSSSKQPTTTSPIHTNSATTSPNTKSETHHTTAQTKGRTTTST QTNKPSTKPRLKNPPKKPKDDYHFEVFNFVPCSICGNNQLCKSICKTIPSNKPKKKPTIKPTNKPTTKT TNKRDPKTPAKTTKKETTTNPTKKPTLTTTERDTSTSQSTVLDTTTLEHTIQQQSLHSTTPENTPNST QTPTASEPSTSNSTQNTQSHA SEQIDNO:22(nucleotidesequenceformutatedRSVGproteinfulllength(Bstrain)) ATGTCCAAACACAAGAATCAACGCACTGCCAGGACTCTAGAAAAGACCTGGGATACTCTCAATCATCTAATTGTAA TATCCTCTTGTTTATACAGATTAAATTTAAAATCTATAGCACAAATAGCACTATCAGTTCTGGCAATCGTGATCTCAA CCTCTCTCATAATTGCAGCCATAATATTCATCATCTCTGCCAATCACAAAGTTACACTAACAACGGTCACAGTTCAAA CAATAAAAAACCACACTGAAAAAAACATCACCACCTACCTTACTCAAGTCCCACCAGAAAGGGTTAGCTCATCCAA ACAACCTACAACCACATCACCAATCCACACAAATTCAGCCACAACATCACCCAACACAAAGTCAGAAACACACCAC ACAACAGCACAAACCAAAGGCAGAACCACCACCTCAACACAGACCAACAAGCCGAGCACAAAACCACGCCTAAAA AATCCACCAAAAAAACCAAAAGATGATTACCATTTTGAAGTGTTCAACTTCGTTCCCTGTAGTATATGTGGCAACAA TCAACTTTGCAAATCCATCTGTAAAACAATACCAAGCAACAAACCAAAGAAGAAACCAACCATCAAACCCACAAAC AAACCAACCACCAAAACCACAAACAAAAGAGACCCAAAAACACCAGCCAAAACGACGAAAAAAGAAACTACCACC AACCCAACAAAAAAACCAACCCTCACGACCACAGAAAGAGACACCAGCACCTCACAATCCACTGTGCTCGACACAA CCACATTAGAACACACAATCCAACAGCAATCCCTCCACTCAACCACCCCCGAAAACACACCCAACTCCACACAAACA CCCACAGCATCCGAGCCCTCTACATCAAATTCCACCCAAAATACCCAATCACATGCTTAG SEQIDNO:23(aminoacidsequenceforRSVAstrainFprotein,DS-Cav1codon-optimized) MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKKNKCNGTDAKIKLIKQELD KYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVCKVLHLEGE VNKIKSALLSTNKAVVSLSNGVSVLTFKVLDLKNYIDKQLLPILNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPV STYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKE GSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVI TSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEF DASISQVNEKINQSLAFIRKSDELLHNVNAVKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN SEQIDNO:24(nucleotidesequenceforRSVAstrainFprotein,DS-Cav1codon-optimized) cggaaggcccatgaggccagttaattaagaggtaccggatccgccaccATGGAACTGCTGATCCTGAAGGCCAACGCCATCACCAC CATCCTGACCGCTGTGACCTTCTGCTTCGCCAGCGGCCAGAACATCACCGAGGAATTCTACCAGAGCACCTGTAGC GCCGTGTCCAAGGGCTACCTGAGCGCCCTGCGGACCGGCTGGTACACCAGCGTGATCACCATCGAGCTGAGCAAC ATCAAGAAAAACAAGTGCAACGGCACCGACGCCAAGATCAAGCTGATCAAGCAGGAACTGGACAAGTACAAGAA CGCCGTGACCGAGCTGCAGCTGCTGATGCAGAGCACCCCCGCCACCAACAACCGGGCTAGACGCGAGCTGCCTCG GTTCATGAACTACACCCTGAACAACGCCAAAAAGACCAACGTGACCCTGAGCAAGAAGCGGAAGCGGCGGTTCCT GGGCTTCCTGCTGGGCGTGGGCAGCGCCATTGCTAGCGGAGTGGCCGTGTGCAAGGTGCTGCACCTGGAAGGCG AAGTGAACAAGATCAAGTCCGCCCTGCTGAGCACCAACAAGGCCGTGGTGTCCCTGAGCAACGGCGTGTCCGTGC TGACCTTCAAGGTGCTGGATCTGAAGAACTACATCGACAAGCAGCTGCTGCCCATCCTGAACAAGCAGAGCTGCA GCATCAGCAACATCGAGACAGTGATCGAGTTCCAGCAGAAGAACAACCGGCTGCTGGAAATCACCCGCGAGTTCA GCGTGAACGCCGGCGTGACCACCCCCGTGTCCACCTACATGCTGACCAACAGCGAGCTGCTGAGCCTGATCAACG ACATGCCCATCACCAACGACCAGAAAAAGCTGATGAGCAACAACGTGCAGATCGTGCGGCAGCAGAGCTACTCCA TCATGTGCATCATCAAAGAAGAGGTGCTGGCCTACGTGGTGCAGCTGCCCCTGTACGGCGTGATCGACACCCCCT GCTGGAAGCTGCACACCAGCCCCCTGTGCACCACCAACACCAAAGAGGGCAGCAACATCTGCCTGACCCGGACCG ACCGGGGCTGGTACTGCGATAATGCCGGCAGCGTGTCATTCTTTCCACAAGCCGAGACATGCAAGGTGCAGAGCA ACCGGGTGTTCTGCGACACCATGAACAGCCTGACCCTGCCCTCCGAAGTGAACCTGTGCAACGTGGACATCTTCAA CCCTAAGTACGACTGCAAGATCATGACCTCCAAGACCGACGTGTCCAGCTCCGTGATCACCTCCCTGGGCGCCATC GTGTCCTGCTACGGCAAGACCAAGTGCACCGCCAGCAACAAGAACCGGGGCATCATCAAGACCTTCAGCAACGGC TGCGACTACGTGTCCAACAAGGGGGTGGACACCGTGTCCGTGGGCAACACCCTGTACTACGTGAACAAACAGGAA GGCAAGAGCCTGTACGTGAAGGGCGAGCCCATCATCAACTTCTACGACCCCCTGGTGTTCCCCAGCGACGAGTTC GACGCCAGCATCAGCCAGGTCAACGAGAAGATCAACCAGAGCCTGGCCTTCATCAGAAAGAGCGACGAGCTGCT GCACAATGTGAATGCCGTGAAGTCCACCACCAATATCATGATCACCACAATCATCATCGTGATCATCGTCATCCTGC TGTCCCTGATCGCCGTGGGCCTGCTGCTGTACTGCAAGGCCCGGTCCACCCCTGTGACCCTGTCCAAGGACCAGCT GAGCGGCATCAACAATATCGCCTTCTCCAACTGActcgagctcatggcgcgcctaggccttgacggccttccg SEQIDNO:25(codingsequenceforRSVAstrainFprotein,DS-Cav1codon-optimized) ATGGAACTGCTGATCCTGAAGGCCAACGCCATCACCACCATCCTGACCGCTGTGACCTTCTGCTTCGCCAGCGGCC AGAACATCACCGAGGAATTCTACCAGAGCACCTGTAGCGCCGTGTCCAAGGGCTACCTGAGCGCCCTGCGGACCG GCTGGTACACCAGCGTGATCACCATCGAGCTGAGCAACATCAAGAAAAACAAGTGCAACGGCACCGACGCCAAG ATCAAGCTGATCAAGCAGGAACTGGACAAGTACAAGAACGCCGTGACCGAGCTGCAGCTGCTGATGCAGAGCAC CCCCGCCACCAACAACCGGGCTAGACGCGAGCTGCCTCGGTTCATGAACTACACCCTGAACAACGCCAAAAAGAC CAACGTGACCCTGAGCAAGAAGCGGAAGCGGCGGTTCCTGGGCTTCCTGCTGGGCGTGGGCAGCGCCATTGCTA GCGGAGTGGCCGTGTGCAAGGTGCTGCACCTGGAAGGCGAAGTGAACAAGATCAAGTCCGCCCTGCTGAGCACC AACAAGGCCGTGGTGTCCCTGAGCAACGGCGTGTCCGTGCTGACCTTCAAGGTGCTGGATCTGAAGAACTACATC GACAAGCAGCTGCTGCCCATCCTGAACAAGCAGAGCTGCAGCATCAGCAACATCGAGACAGTGATCGAGTTCCAG CAGAAGAACAACCGGCTGCTGGAAATCACCCGCGAGTTCAGCGTGAACGCCGGCGTGACCACCCCCGTGTCCACC TACATGCTGACCAACAGCGAGCTGCTGAGCCTGATCAACGACATGCCCATCACCAACGACCAGAAAAAGCTGATG AGCAACAACGTGCAGATCGTGCGGCAGCAGAGCTACTCCATCATGTGCATCATCAAAGAAGAGGTGCTGGCCTAC GTGGTGCAGCTGCCCCTGTACGGCGTGATCGACACCCCCTGCTGGAAGCTGCACACCAGCCCCCTGTGCACCACCA ACACCAAAGAGGGCAGCAACATCTGCCTGACCCGGACCGACCGGGGCTGGTACTGCGATAATGCCGGCAGCGTG TCATTCTTTCCACAAGCCGAGACATGCAAGGTGCAGAGCAACCGGGTGTTCTGCGACACCATGAACAGCCTGACC CTGCCCTCCGAAGTGAACCTGTGCAACGTGGACATCTTCAACCCTAAGTACGACTGCAAGATCATGACCTCCAAGA CCGACGTGTCCAGCTCCGTGATCACCTCCCTGGGCGCCATCGTGTCCTGCTACGGCAAGACCAAGTGCACCGCCAG CAACAAGAACCGGGGCATCATCAAGACCTTCAGCAACGGCTGCGACTACGTGTCCAACAAGGGGGTGGACACCG TGTCCGTGGGCAACACCCTGTACTACGTGAACAAACAGGAAGGCAAGAGCCTGTACGTGAAGGGCGAGCCCATC ATCAACTTCTACGACCCCCTGGTGTTCCCCAGCGACGAGTTCGACGCCAGCATCAGCCAGGTCAACGAGAAGATCA ACCAGAGCCTGGCCTTCATCAGAAAGAGCGACGAGCTGCTGCACAATGTGAATGCCGTGAAGTCCACCACCAATA TCATGATCACCACAATCATCATCGTGATCATCGTCATCCTGCTGTCCCTGATCGCCGTGGGCCTGCTGCTGTACTGC AAGGCCCGGTCCACCCCTGTGACCCTGTCCAAGGACCAGCTGAGCGGCATCAACAATATCGCCTTCTCCAACTGA SEQIDNO:26(aminoacidsequenceforRSVAstrainFprotein,SC-DMcodon-optimized) MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKKIKCNGTDAKIKLIKQELDK YKNAVTELQLLMQSTPATNNQARGSGSGRSLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVS VLTSKVLDLKNYIDKQLLPIVNKQSCSIPNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITND QKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGS VSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNR GIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDE LLHNVNAVKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN SEQIDNO:27(nucleotidesequenceforRSVAstrainFprotein,SC-DMcodon-optimized) cggaaggcccatgaggccagttaattaagaggtaccggatccgccaccATGGAACTGCTGATCCTGAAGGCCAACGCCATCACCAC CATCCTGACCGCTGTGACCTTCTGCTTCGCCAGCGGCCAGAACATCACCGAGGAATTCTACCAGAGCACCTGTAGC GCCGTGTCCAAGGGCTACCTGAGCGCCCTGCGGACCGGCTGGTACACCAGCGTGATCACCATCGAGCTGAGCAAC ATCAAGAAAATCAAGTGCAACGGCACCGACGCCAAGATCAAGCTGATCAAGCAGGAACTGGACAAGTACAAGAA CGCCGTGACCGAGCTGCAGCTGCTGATGCAGAGCACCCCCGCCACCAACAACCAGGCTAGAGGCAGCGGAAGC GGACGGTCC CTGGGCTTCCTGCTGGGCGTGGGCAGCGCCATTGCTAGCGGAGTGGCCGTGTCAAAGGTGCTGCACCTGGAAGG CGAAGTGAACAAGATCAAGTCCGCCCTGCTGAGCACCAACAAGGCCGTGGTGTCCCTGAGCAACGGCGTGTCCGT GCTGACCAGCAAGGTGCTGGATCTGAAGAACTACATCGACAAGCAGCTGCTGCCCATCGTGAACAAGCAGAGCTG CAGCATCCCCAACATCGAGACAGTGATCGAGTTCCAGCAGAAGAACAACCGGCTGCTGGAAATCACCCGCGAGTT CAGCGTGAACGCCGGCGTGACCACCCCCGTGTCCACCTACATGCTGACCAACAGCGAGCTGCTGAGCCTGATCAA CGACATGCCCATCACCAACGACCAGAAAAAGCTGATGAGCAACAACGTGCAGATCGTGCGGCAGCAGAGCTACTC CATCATGAGCATCATCAAAGAAGAGGTGCTGGCCTACGTGGTGCAGCTGCCCCTGTACGGCGTGATCGACACCCC CTGCTGGAAGCTGCACACCAGCCCCCTGTGCACCACCAACACCAAAGAGGGCAGCAACATCTGCCTGACCCGGAC CGACCGGGGCTGGTACTGCGATAATGCCGGCAGCGTGTCATTCTTTCCACAAGCCGAGACATGCAAGGTGCAGAG CAACCGGGTGTTCTGCGACACCATGAACAGCCTGACCCTGCCCTCCGAAGTGAACCTGTGCAACGTGGACATCTTC AACCCTAAGTACGACTGCAAGATCATGACCTCCAAGACCGACGTGTCCAGCTCCGTGATCACCTCCCTGGGCGCCA TCGTGTCCTGCTACGGCAAGACCAAGTGCACCGCCAGCAACAAGAACCGGGGCATCATCAAGACCTTCAGCAACG GCTGCGACTACGTGTCCAACAAGGGGGTGGACACCGTGTCCGTGGGCAACACCCTGTACTACGTGAACAAACAG GAAGGCAAGAGCCTGTACGTGAAGGGCGAGCCCATCATCAACTTCTACGACCCCCTGGTGTTCCCCAGCGACGAG TTCGACGCCAGCATCAGCCAGGTCAACGAGAAGATCAACCAGAGCCTGGCCTTCATCAGAAAGAGCGACGAGCTG CTGCACAATGTGAATGCCGTGAAGTCCACCACCAATATCATGATCACCACAATCATCATCGTGATCATCGTCATCCT GCTGTCCCTGATCGCCGTGGGCCTGCTGCTGTACTGCAAGGCCCGGTCCACCCCTGTGACCCTGTCCAAGGACCAG CTGAGCGGCATCAACAATATCGCCTTCTCCAACTGActcgagctcatggcgcgcctaggccttgacggccttccg SEQIDNO:28(codingsequenceforRSVAstrainFprotein,SC-DMcodon-optimized) ATGGAACTGCTGATCCTGAAGGCCAACGCCATCACCACCATCCTGACCGCTGTGACCTTCTGCTTCGCCAGCGGCC AGAACATCACCGAGGAATTCTACCAGAGCACCTGTAGCGCCGTGTCCAAGGGCTACCTGAGCGCCCTGCGGACCG GCTGGTACACCAGCGTGATCACCATCGAGCTGAGCAACATCAAGAAAATCAAGTGCAACGGCACCGACGCCAAGA TCAAGCTGATCAAGCAGGAACTGGACAAGTACAAGAACGCCGTGACCGAGCTGCAGCTGCTGATGCAGAGCACC CCCGCCACCAACAACCAGGCTAGAGGCAGCGGAAGCGGACGGTCC CTGGGCTTCCTGCTGGGCGTGGGCAGCGCCATTGCTAGCGGAGTGGCCGTGTCAAAGGTGCTGCACCTGGAAGG CGAAGTGAACAAGATCAAGTCCGCCCTGCTGAGCACCAACAAGGCCGTGGTGTCCCTGAGCAACGGCGTGTCCGT GCTGACCAGCAAGGTGCTGGATCTGAAGAACTACATCGACAAGCAGCTGCTGCCCATCGTGAACAAGCAGAGCTG CAGCATCCCCAACATCGAGACAGTGATCGAGTTCCAGCAGAAGAACAACCGGCTGCTGGAAATCACCCGCGAGTT CAGCGTGAACGCCGGCGTGACCACCCCCGTGTCCACCTACATGCTGACCAACAGCGAGCTGCTGAGCCTGATCAA CGACATGCCCATCACCAACGACCAGAAAAAGCTGATGAGCAACAACGTGCAGATCGTGCGGCAGCAGAGCTACTC CATCATGAGCATCATCAAAGAAGAGGTGCTGGCCTACGTGGTGCAGCTGCCCCTGTACGGCGTGATCGACACCCC CTGCTGGAAGCTGCACACCAGCCCCCTGTGCACCACCAACACCAAAGAGGGCAGCAACATCTGCCTGACCCGGAC CGACCGGGGCTGGTACTGCGATAATGCCGGCAGCGTGTCATTCTTTCCACAAGCCGAGACATGCAAGGTGCAGAG CAACCGGGTGTTCTGCGACACCATGAACAGCCTGACCCTGCCCTCCGAAGTGAACCTGTGCAACGTGGACATCTTC AACCCTAAGTACGACTGCAAGATCATGACCTCCAAGACCGACGTGTCCAGCTCCGTGATCACCTCCCTGGGCGCCA TCGTGTCCTGCTACGGCAAGACCAAGTGCACCGCCAGCAACAAGAACCGGGGCATCATCAAGACCTTCAGCAACG GCTGCGACTACGTGTCCAACAAGGGGGTGGACACCGTGTCCGTGGGCAACACCCTGTACTACGTGAACAAACAG GAAGGCAAGAGCCTGTACGTGAAGGGCGAGCCCATCATCAACTTCTACGACCCCCTGGTGTTCCCCAGCGACGAG TTCGACGCCAGCATCAGCCAGGTCAACGAGAAGATCAACCAGAGCCTGGCCTTCATCAGAAAGAGCGACGAGCTG CTGCACAATGTGAATGCCGTGAAGTCCACCACCAATATCATGATCACCACAATCATCATCGTGATCATCGTCATCCT GCTGTCCCTGATCGCCGTGGGCCTGCTGCTGTACTGCAAGGCCCGGTCCACCCCTGTGACCCTGTCCAAGGACCAG CTGAGCGGCATCAACAATATCGCCTTCTCCAACTGA SEQIDNO:29(aminoacidsequenceforRSVAstrainFprotein,SC-TMcodon-optimized) MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKKIKCNGTDAKIKLIKQELDK YKNAVTELQLLMQSTPATNNQARGSGSGRSLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVS VLTSKVLDLKNYIDKQLLPIVNKQSCSIPNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITND QKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGS VSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNR GIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDQFDASISQVNEKINQSLAFIRKSDE LLHNVNAVKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN SEQIDNO:30(nucleotidesequenceforRSVAstrainFprotein,SC-TMcodon-optimized) cggaaggcccatgaggccagttaattaagaggtaccggatccgccaccATGGAACTGCTGATCCTGAAGGCCA ACGCCATCACCACCATCCTGACCGCTGTGACCTTCTGCTTCGCCAGCGGCCAGAACATCACCGA GGAATTCTACCAGAGCACCTGTAGCGCCGTGTCCAAGGGCTACCTGAGCGCCCTGCGGACCG GCTGGTACACCAGCGTGATCACCATCGAGCTGAGCAACATCAAGAAAATCAAGTGCAACGGC ACCGACGCCAAGATCAAGCTGATCAAGCAGGAACTGGACAAGTACAAGAACGCCGTGACCGA GCTGCAGCTGCTGATGCAGAGCACCCCCGCCACCAACAACCAGGCTAGAGGCAGCGGA AGCGGACGGTCC CTGGGCTTCCTGCTGGGCGTGGGCAGCGCCATTGCTAGCGGAGTGGCCGTGTCAAAGGTGCT GCACCTGGAAGGCGAAGTGAACAAGATCAAGTCCGCCCTGCTGAGCACCAACAAGGCCGTGG TGTCCCTGAGCAACGGCGTGTCCGTGCTGACCAGCAAGGTGCTGGATCTGAAGAACTACATC GACAAGCAGCTGCTGCCCATCGTGAACAAGCAGAGCTGCAGCATCCCCAACATCGAGACAGT GATCGAGTTCCAGCAGAAGAACAACCGGCTGCTGGAAATCACCCGCGAGTTCAGCGTGAACG CCGGCGTGACCACCCCCGTGTCCACCTACATGCTGACCAACAGCGAGCTGCTGAGCCTGATCA ACGACATGCCCATCACCAACGACCAGAAAAAGCTGATGAGCAACAACGTGCAGATCGTGCGG CAGCAGAGCTACTCCATCATGAGCATCATCAAAGAAGAGGTGCTGGCCTACGTGGTGCAGCT GCCCCTGTACGGCGTGATCGACACCCCCTGCTGGAAGCTGCACACCAGCCCCCTGTGCACCAC CAACACCAAAGAGGGCAGCAACATCTGCCTGACCCGGACCGACCGGGGCTGGTACTGCGATA ATGCCGGCAGCGTGTCATTCTTTCCACAAGCCGAGACATGCAAGGTGCAGAGCAACCGGGTG TTCTGCGACACCATGAACAGCCTGACCCTGCCCTCCGAAGTGAACCTGTGCAACGTGGACATC TTCAACCCTAAGTACGACTGCAAGATCATGACCTCCAAGACCGACGTGTCCAGCTCCGTGATC ACCTCCCTGGGCGCCATCGTGTCCTGCTACGGCAAGACCAAGTGCACCGCCAGCAACAAGAAC CGGGGCATCATCAAGACCTTCAGCAACGGCTGCGACTACGTGTCCAACAAGGGGGTGGACAC CGTGTCCGTGGGCAACACCCTGTACTACGTGAACAAACAGGAAGGCAAGAGCCTGTACGTGA AGGGCGAGCCCATCATCAACTTCTACGACCCCCTGGTGTTCCCCAGCGACCAGTTCGACGCCA GCATCAGCCAGGTCAACGAGAAGATCAACCAGAGCCTGGCCTTCATCAGAAAGAGCGACGAG CTGCTGCACAATGTGAATGCCGTGAAGTCCACCACCAATATCATGATCACCACAATCATCATCG TGATCATCGTCATCCTGCTGTCCCTGATCGCCGTGGGCCTGCTGCTGTACTGCAAGGCCCGGTC CACCCCTGTGACCCTGTCCAAGGACCAGCTGAGCGGCATCAACAATATCGCCTTCTCCAACTG Actcgagctcatggcgcgcctaggccttgacggccttccg SEQIDNO:31(codingsequenceforRSVAstrainFprotein,SC-TMcodon-optimized) ATGGAACTGCTGATCCTGAAGGCCAACGCCATCACCACCATCCTGACCGCTGTGACCTTCTGCT TCGCCAGCGGCCAGAACATCACCGAGGAATTCTACCAGAGCACCTGTAGCGCCGTGTCCAAG GGCTACCTGAGCGCCCTGCGGACCGGCTGGTACACCAGCGTGATCACCATCGAGCTGAGCAA CATCAAGAAAATCAAGTGCAACGGCACCGACGCCAAGATCAAGCTGATCAAGCAGGAACTGG ACAAGTACAAGAACGCCGTGACCGAGCTGCAGCTGCTGATGCAGAGCACCCCCGCCACCAAC AACCAGGCTAGAGGCAGCGGAAGCGGACGGTCC CTGGGCTTCCTGCTGGGCGTGGGCAGCGCCATTGCTAGCGGAGTGGCCGTGTCAAAGGTGCT GCACCTGGAAGGCGAAGTGAACAAGATCAAGTCCGCCCTGCTGAGCACCAACAAGGCCGTGG TGTCCCTGAGCAACGGCGTGTCCGTGCTGACCAGCAAGGTGCTGGATCTGAAGAACTACATC GACAAGCAGCTGCTGCCCATCGTGAACAAGCAGAGCTGCAGCATCCCCAACATCGAGACAGT GATCGAGTTCCAGCAGAAGAACAACCGGCTGCTGGAAATCACCCGCGAGTTCAGCGTGAACG CCGGCGTGACCACCCCCGTGTCCACCTACATGCTGACCAACAGCGAGCTGCTGAGCCTGATCA ACGACATGCCCATCACCAACGACCAGAAAAAGCTGATGAGCAACAACGTGCAGATCGTGCGG CAGCAGAGCTACTCCATCATGAGCATCATCAAAGAAGAGGTGCTGGCCTACGTGGTGCAGCT GCCCCTGTACGGCGTGATCGACACCCCCTGCTGGAAGCTGCACACCAGCCCCCTGTGCACCAC CAACACCAAAGAGGGCAGCAACATCTGCCTGACCCGGACCGACCGGGGCTGGTACTGCGATA ATGCCGGCAGCGTGTCATTCTTTCCACAAGCCGAGACATGCAAGGTGCAGAGCAACCGGGTG TTCTGCGACACCATGAACAGCCTGACCCTGCCCTCCGAAGTGAACCTGTGCAACGTGGACATC TTCAACCCTAAGTACGACTGCAAGATCATGACCTCCAAGACCGACGTGTCCAGCTCCGTGATC ACCTCCCTGGGCGCCATCGTGTCCTGCTACGGCAAGACCAAGTGCACCGCCAGCAACAAGAAC CGGGGCATCATCAAGACCTTCAGCAACGGCTGCGACTACGTGTCCAACAAGGGGGTGGACAC CGTGTCCGTGGGCAACACCCTGTACTACGTGAACAAACAGGAAGGCAAGAGCCTGTACGTGA AGGGCGAGCCCATCATCAACTTCTACGACCCCCTGGTGTTCCCCAGCGACCAGTTCGACGCCA GCATCAGCCAGGTCAACGAGAAGATCAACCAGAGCCTGGCCTTCATCAGAAAGAGCGACGAG CTGCTGCACAATGTGAATGCCGTGAAGTCCACCACCAATATCATGATCACCACAATCATCATCG TGATCATCGTCATCCTGCTGTCCCTGATCGCCGTGGGCCTGCTGCTGTACTGCAAGGCCCGGTC CACCCCTGTGACCCTGTCCAAGGACCAGCTGAGCGGCATCAACAATATCGCCTTCTCCAACTG A SEQIDNO:32(aminoacidsequenceforRSVFtruncated,aminoacid496-574codon- optimized(Astrain)) MELLILKANAITTILTAVTFCFASGQNITEEFYQSNEKINQSLAFIRKSDELLHNVNAVKSTTNIMITTIIIVIIVILLSLIAVGLLL YCKARSTPVTLSKDQLSGINNIAFSN SEQIDNO:33(codingnucleotidesequenceforRSVFtruncated,aminoacid496-574codon- optimized(Astrain)) ATGGAACTGCTGATCCTGAAGGCCAACGCCATCACCACCATCCTGACCGCTGTGACCTTCTGCT TCGCCAGCGGCCAGAACATCACCGAGGAATTCTACCAGAGCAACGAGAAGATCAACCAGAGC CTGGCCTTCATCAGAAAGAGCGACGAGCTGCTGCACAATGTGAATGCCGTGAAGTCCACCACC AATATCATGATCACCACAATCATCATCGTGATCATCGTCATCCTGCTGTCCCTGATCGCCGTGG GCCTGCTGCTGTACTGCAAGGCCCGGTCCACCCCTGTGACCCTGTCCAAGGACCAGCTGAGCG GCATCAACAATATCGCCTTCTCCAACTGA SEQIDNO:34(aminoacidsequenceforRSVFprotein,NCBIReferenceSequence: NC_001803.1) MELPILKTNAITAILAAVTLCFASSQNITEEFYQTTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN GTDAKVKLIKQELDKYKSAVTELQLLMQSTPATNNRARRELPRFMNYTLNNTKNTNVTLSKKRKRR FLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPI VNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLM SNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGW YCDNAGSVSFFPLAETCKVQSNRVFCDTMNSLTLPSEVNLCNIDIFNPKYDCKIMTSKTDVSSSVITS LGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIIN FYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTINIMITTIIIVIIVILLSLIAVGLLLY CKARSTPVTLSKDQLSGINNIAFSN SEQIDNO:35(nucleotidesequenceforRSVFprotein,NCBIReferenceSequence: NC_001803.1) ATGGAGTTGCCAATCCTCAAAACAAATGCAATTACCGCAATCCTTGCTGCAGTCACACTCTGTTT TGCTTCCAGTCAAAACATCACTGAAGAATTTTATCAAACAACA TGCAGTGCAGTCAGCAAAGGCTATCTTAGTGCTCTAAGAACTGGTTGGTATACTAGTGTTATAA CTATAGAATTAAGTAATATCAAGGAAAATAAGTGTAATGGAACAGACGCTAAGGTAAAATTGA TAAAACAAGAATTAGATAAATATAAAAGTGCTGTAACAGAATTGCAGTTGCTCATGCAAAGCA CACCGGCAACCAACAATCGAGCCAGAAGAGAACTACCAAGGTTTATGAATTATACACTCAACA ATACCAAAAATACCAATGTAACATTAAGCAAGAAAAGGAAAAGAAGATTTCTTGGCTTTTTGTT AGGTGTTGGATCTGCAATCGCCAGTGGCATTGCTGTATCTAAGGTCCTGCACCTAGAAGGGGA AGTGAACAAAATCAAAAGTGCTCTACTATCCACAAACAAGGCTGTAGTCAGCTTATCAAATGGA GTTAGTGTCTTAACCAGCAAAGTGTTAGACCTCAAAAACTATATAGATAAACAGTTGTTACCTA TTGTGAACAAGCAAAGCTGTAGCATATCAAAC ATTGAAACTGTGATAGAGTTCCAACAAAAGAACAACAGACTACTAGAGATTACCAGGGAATTT AGTGTTAATGCAGGTGTAACTACACCTGTAAGCACTTATATGTTAACAAATAGTGAATTATTAT CATTAATCAATGATATGCCTATAACAAATGATCAGAAAAAGTTAATGTCCAACAATGTTCAAAT AGTTAGACAGCAAAGTTACTCTATCATGTCCATAATAAAGGAGGAAGTCTTAGCATATGTAGTA CAATTACCACTATATGGTGTAATAGATACACCTTGTTGGAAACTGCACACATCCCCTCTATGTAC AACCAACACAAAGGAAGGGTCCAACATCTGTTTAACAAGAACCGACAGAGGATGGTACTGTGA CAATGCAGGATCAGTATCTTTCTTCCCACTAGCTGAAACATGTAAAGTTCAATCGAATCGAGTA TTTTGTGACACAATGAACAGTTTAACATTACCAAGTGAAGTAAATCTCTGCAACATTGACATATT CAACCCCAAATATGATTGCAAAATTATG ACTTCAAAAACAGATGTAAGCAGCTCCGTTATCACATCTCTAGGAGCCATTGTGTCATGCTATG GCAAAACTAAATGTACAGCATCCAATAAAAATCGTGGAATCATAAAGACATTTTCTAACGGGTG CGATTATGTATCAAATAAGGGGGTTGACACTGTGTCTGTAGGTAATACATTATATTATGTAAAT AAGCAAGAAGGCAAAAGTCTCTATGTAAAAGGTGAACCAATAATAAATTTCTATGACCCATTA GTGTTCCCCTCTGATGAATTTGATGCATCAATATCTCAAGTCAATGAGAAGATTAACCAGAGCC TAGCATTTATTCGTAAATCCGATGAATTATTACATAATGTAAATGCTGGTAAATCCACCATAAAT ATCATGATAACTACTATAATTATAGTGATTATAGTAATATTGTTATCATTAATTGCCGTTGGACT GCTCCTATACTGCAAGGCCAGAAGCACACCAGTCACACTAAGCAAGGATCAACTGAGTGGTAT AAATAATATTGCATTTAGTAACTAAAACGGGTGCGATTATGTATCAAATAAGGGGGTTGACACT GTGTCTGTAGGTAATACATTATATTATGTAAATAAGCAAGAAGGCAAAAGTCTCTATGTAAAAG GTGAACCAATAATAAATTTCTATGACCCATTAGTGTTCCCCTCTGATGAATTTGATGCATCAATA TCTCAAGTCAATGAGAAGATTAACCAGAGCCTAGCATTTATTCGTAAATCCGATGAATTATTAC ATAATGTAAATGCTGGTAAATCCACCATAAATATCATGATAACTACTATAATTATAGTGATTAT AGTAATATTGTTATCATTAATTGCCGTTGGACTGCTCCTATACTGCAAGGCCAGAAGCACACCA GTCACACTAAGCAAGGATCAACTGAGTGGTATAAATAATATTGCATTTAGTAACTAA SEQIDNO:36(aminoacidsequenceforfulllengthRSVFprotein(Astrain),NCBIReference Sequence:NC_001803.1) MELPILKTNAITAILAAVTLCFASSQNITEEFYQTTCSAVSKGYLSALRTGWYTSVITIE LSNIKENKCNGTDAKVKLIKQELDKYKSAVTELQLLMQSTPATNNRARRELPRFMNYTLN NTKNTNVTLSKKRKRRFLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKSALLSTNKAVVS LSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVN AGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYV VQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPLAETCKV QSNRVFCDTMNSLTLPSEVNLCNIDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDP LVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTINIMITTIIIVIIVILLS LIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN SEQIDNO:37(aminoacidsequenceforfulllengthRSVFprotein,codon-optimized (Astrain)) MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKKNKCNGTDAKIKLIKQELD KYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGE VNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTP VSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTK EGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSV ITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEF DASISQVNEKINQSLAFIRKSDELLHNVNAVKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN SEQIDNO:38(nucleotidesequenceforfulllengthRSVFprotein,codon- optimized(Astrain)) ATGGAACTGCTGATCCTGAAGGCCAACGCCATCACCACCATCCTGACCGCTGTGACCTTCTGCTTCGCCAGCGGCC AGAACATCACCGAGGAATTCTACCAGAGCACCTGTAGCGCCGTGTCCAAGGGCTACCTGAGCGCCCTGCGGACCG GCTGGTACACCAGCGTGATCACCATCGAGCTGAGCAACATCAAGAAAAACAAGTGCAACGGCACCGACGCCAAG ATCAAGCTGATCAAGCAGGAACTGGACAAGTACAAGAACGCCGTGACCGAGCTGCAGCTGCTGATGCAGAGCAC CCCCGCCACCAACAACCGGGCTAGACGCGAGCTGCCTCGGTTCATGAACTACACCCTGAACAACGCCAAAAAGAC CAACGTGACCCTGAGCAAGAAGCGGAAGCGGCGGTTCCTGGGCTTCCTGCTGGGCGTGGGCAGCGCCATTGCTA GCGGAGTGGCCGTGTCAAAGGTGCTGCACCTGGAAGGCGAAGTGAACAAGATCAAGTCCGCCCTGCTGAGCACC AACAAGGCCGTGGTGTCCCTGAGCAACGGCGTGTCCGTGCTGACCAGCAAGGTGCTGGATCTGAAGAACTACATC GACAAGCAGCTGCTGCCCATCGTGAACAAGCAGAGCTGCAGCATCAGCAACATCGAGACAGTGATCGAGTTCCAG CAGAAGAACAACCGGCTGCTGGAAATCACCCGCGAGTTCAGCGTGAACGCCGGCGTGACCACCCCCGTGTCCACC TACATGCTGACCAACAGCGAGCTGCTGAGCCTGATCAACGACATGCCCATCACCAACGACCAGAAAAAGCTGATG AGCAACAACGTGCAGATCGTGCGGCAGCAGAGCTACTCCATCATGAGCATCATCAAAGAAGAGGTGCTGGCCTAC GTGGTGCAGCTGCCCCTGTACGGCGTGATCGACACCCCCTGCTGGAAGCTGCACACCAGCCCCCTGTGCACCACCA ACACCAAAGAGGGCAGCAACATCTGCCTGACCCGGACCGACCGGGGCTGGTACTGCGATAATGCCGGCAGCGTG TCATTCTTTCCACAAGCCGAGACATGCAAGGTGCAGAGCAACCGGGTGTTCTGCGACACCATGAACAGCCTGACC CTGCCCTCCGAAGTGAACCTGTGCAACGTGGACATCTTCAACCCTAAGTACGACTGCAAGATCATGACCTCCAAGA CCGACGTGTCCAGCTCCGTGATCACCTCCCTGGGCGCCATCGTGTCCTGCTACGGCAAGACCAAGTGCACCGCCAG CAACAAGAACCGGGGCATCATCAAGACCTTCAGCAACGGCTGCGACTACGTGTCCAACAAGGGGGTGGACACCG TGTCCGTGGGCAACACCCTGTACTACGTGAACAAACAGGAAGGCAAGAGCCTGTACGTGAAGGGCGAGCCCATC ATCAACTTCTACGACCCCCTGGTGTTCCCCAGCGACGAGTTCGACGCCAGCATCAGCCAGGTCAACGAGAAGATCA ACCAGAGCCTGGCCTTCATCAGAAAGAGCGACGAGCTGCTGCACAATGTGAATGCCGTGAAGTCCACCACCAATA TCATGATCACCACAATCATCATCGTGATCATCGTCATCCTGCTGTCCCTGATCGCCGTGGGCCTGCTGCTGTACTGC AAGGCCCGGTCCACCCCTGTGACCCTGTCCAAGGACCAGCTGAGCGGCATCAACAATATCGCCTTCTCCAACTGA SEQIDNO:39(aminoacidsequenceforRSVMprotein,NCBIReference Sequence:NC_001803.1) METYVNKLHEGSTYTAAVQYNVLEKDDDPASLTIWVPMFQSSMPADLLIKELANVNILVKQISTPN GPSLRVMINSRSAVLAQMPSKFTICANVSLDERSKLAYDVTTPCEIKACSLTCLKSKNMLTTVKDLT MKTLNPTHDIIALCEFENIVTSKKVIIPTYLRSISVRNKDLNTLENITTTEFKNAITNAKIIPYSGLLLVITV TDNKGAFKYIKPQSQFIVDLGAYLEKESIYYVTTNWKHTATRFAIKPMED SEQIDNO:40(nucleotidesequenceforRSVMprotein,NCBIReference Sequence:NC_001803.1) ATGGAAACATACGTGAACAAACTTCACGAAGGCTCCACATACACAGCTGCTGTTCAATACAATG TCTTAGAAAAAGACGATGACCCTGCATCACTTACAATATGGGTGCCCATGTTCCAATCATCCAT GCCAGCAGATTTACTTATAAAAGAACTAGCTAATGTCAACATACTAGTGAAACAAATATCCACA CCCAATGGACCTTCATTAAGAGTCATGATAAACTCAAGAAGTGCAGTGCTAGCACAAATGCCCA GCAAATTTACCATATGTGCCAATGTGTCCTTGGATGAAAGAAGCAAGCTGGCATATGATGTAA CCACACCCTGTGAAATCAAGGCATGTAGTCTAACATGCCTAAAATCAAAAAATATGTTAACTAC AGTTAAAGATCTCACTATGAAAACACTCAACCCAACACATGACATCATTGCTTTATGTGAATTT GAAAATATAGTAACATCAAAAAAAGTCATAATACCAACATACCTAAGATCCATCAGTGTCAGAA ATAAAGATCTGAACACACTTGAAAATATA ACAACCACTGAATTCAAAAATGCCATCACAAATGCAAAAATCATCCCTTACTCAGGATTACTGTT AGTCATCACAGTGACTGACAACAAAGGAGCATTCAAATACATAAAGCCACAAAGTCAATTTAT AGTAGATCTTGGAGCTTACCTAGAAAAAGAAAGTATATATTATGTTACAACAAATTGGAAGCA CACAGCTACACGATTTGCAATCAAACCCATGGAAGATTAA SEQIDNO:41(aminoacidsequenceforRSVMproteincodon-optimized(A strain)) MFQSSMPADLLIKDSTYTAAVQYNVLEKDDDPASLTIWVPMFQSSMPADLLIKELANVNILVKQIS TPKGPSLRVMINSRSAVLAQMPSKFTICANVSLDERSKLAYDVTTPCEIKACSLTCLKSKNMLTTVK DLTMKTLNPTHDIIALCEFENIVTSKKVIIPTYLRSISVRNKDLNTLENITTTEFKNAITNAKIIPYSGLLL VITVTDNKGAFKYIKPQSQFIVDLGAYLEKESIYYVTTNWKHTATRFAIKPMED SEQIDNO:42(nucleotidesequenceforRSVMproteincodon-optimized(A strain)) ATGTTCCAGAGCAGCATGCCCGCCGACCTGCTGATCAAAGACAGCACCTACACAGCCGCCGTG CAGTACAACGTGCTGGAAAAGGACGACGACCCCGCCAGCCTGACCATCTGGGTGCCCATGTT CCAGAGCAGCATGCCCGCCGACCTGCTGATCAAAGAACTGGCCAACGTGAACATCCTGGTCA AGCAGATCAGCACCCCCAAGGGCCCCAGCCTGAGAGTGATGATCAACAGCCGCAGCGCCGTG CTGGCCCAGATGCCCAGCAAGTTCACCATCTGCGCCAACGTGTCCCTGGACGAGCGGAGCAA GCTGGCCTACGACGTGACCACCCCCTGCGAGATCAAGGCCTGCAGCCTGACCTGCCTGAAGTC CAAGAACATGCTGACCACCGTGAAGGACCTGACCATGAAGACCCTGAACCCCACCCACGACAT CATTGCCCTGTGCGAGTTCGAGAACATCGTGACCAGCAAGAAAGTGATCATCCCCACCTACCT GCGGAGCATCAGCGTGCGGAACAAGGACCTGAACACCCTGGAAAACATCACCACCACCGAGT TCAAGAACGCCATTACCAACGCCAAGATCATCCCCTACAGCGGCCTGCTGCTGGTCATCACCG TGACCGACAACAAGGGCGCCTTCAAGTACATCAAGCCCCAGAGCCAGTTCATCGTGGACCTG GGCGCCTACCTGGAAAAAGAATCCATCTACTACGTCACCACCAACTGGAAGCACACCGCCACC AGATTCGCCATCAAGCCCATGGAAGATTGA SEQIDNO:43(aminoacidsequenceforRSVM2-1protein,NCBIReference Sequence:NC_001803.1) MSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSIDTLSEISGAAEL DRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEEPNSPKIRVYNTVISYI ESNRKNNKQTIHLLKRLPADVLKKTIKTTLDIHKSITINNPKESTVSDINDHAKNNDTT SEQIDNO:44(nucleotidesequenceforRSVM2-1protein,NCBIReference Sequence:NC_001803.1) ATGTCACGAAGGAATCCTTGCAAATTTGAAATTCGAGGTCATTGCTTGAATGGTAAGAGGTGT CATTTTAGTCATAATTATTITGAATGGCCACCCCATGCACTGCTTGTAAGACAAAACTTTATGTT AAACAGAATACTTAAGTCTATGGATAAAAGCATCGATACTTTATCAGAAATAAGTGGAGCTGC AGAGTTGGACAGAACAGAAGAGTATGCCCTCGGTGTAGTTGGAGTGCTAGAGAGTTATATAG GATCTATAAATAATATAACTAAACAATCAGCATGTGTTGCCATGAGCAAACTCCTCACTGAACT CAACAGTGATGACATCAAAAAACTGAGGGACAATGAAGAGCCAAATTCACCCAAGATAAGAG TGTACAATACTGTCATATCATATATTGAAAGCAACAGGAAAAACAATAAACAAACTATCCATCT GTTAAAAAGATTGCCAGCAGACGTATTGAAGAAAACCATAAAAACCACATTGGATATCCACAA GAGCATAACCATCAATAACCCAAAAGAATCAACTGTTAGTGATATAAACGACCATGCCAAAAA TAATGATACTACCTGA SEQIDNO:45(aminoacidsequenceforRSVM2-1proteincodon-optimized (Astrain)) MSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSIDTLSEISGAAEL DRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIE SNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITINNPKESTVSDTNDHAKNNDTT SEQIDNO:46(nucleotidesequenceforRSVM2-1proteincodon-optimized (Astrain)) ATGAGCCGGCGGAACCCCTGCAAGTTCGAGATCCGGGGCCACTGCCTGAACGGCAAGCGGTGCCACTTCAGCCAC AACTACTTCGAGTGGCCCCCTCACGCCCTGCTGGTGCGCCAGAACTTCATGCTGAACCGGATCCTGAAGTCCATGG ACAAGAGCATCGACACCCTGAGCGAGATCAGCGGAGCTGCCGAGCTGGACCGGACCGAGGAATATGCCCTGGGC GTGGTGGGAGTGCTGGAAAGCTACATCGGCAGCATCAACAACATCACCAAGCAGAGCGCCTGCGTGGCCATGAG CAAGCTGCTGACCGAGCTGAACAGCGACGACATCAAGAAGCTGCGGGACAACGAGGAACTGAACAGCCCCAAGA TCCGGGTGTACAACACCGTGATCAGCTACATCGAGAGCAACCGGAAGAACAACAAGCAGACCATCCATCTGCTGA AGCGGCTGCCCGCCGACGTGCTGAAGAAAACCATCAAGAACACCCTGGACATCCACAAGTCCATCACCATCAACA ACCCCAAAGAAAGCACCGTGTCCGACACCAACGACCACGCCAAGAACAACGACACCACCTGA SEQIDNO:47(aminoacidsequenceforRSVPprotein,NCBIReference Sequence:NC_001803.1) MEKFAPEFHGEDANNRATKFLESIKGKFTSPKDPKKKDSIISVNSIDIEVTKESPITSNSTIINPTNETD DTVGNKPNYQRKPLVSFKEDPTPSDNPFSKLYKETIETFDNNEEESSYSYEEINDQTNDNITARLDRI DEKLSEILGMLHTLVVASAGPTSARDGIRDAMVGLREDMIEKIRTEALMTNDRLEAMARLRNEESE KMAKDTSDEVSLNPTSEKLNNLLEGNDSDNDLSLDDF SEQIDNO:48(nucleotidesequenceforRSVPprotein,NCBIReference Sequence:NC_001803.1) ATGGAAAAGTTTGCTCCTGAATTCCATGGAGAAGATGCAAACAACAGAGCTACCAAATTCCTA GAATCAATAAAGGGCAAATTCACATCACCTAAAGATCCCAAGAAAAAAGATAGTATCATATCT GTCAACTCAATAGATATAGAAGTAACCAAAGAAAGCCCTATAACATCAAATTCAACCATTATAA ACCCAACAAATGAGACAGATGATACTGTAGGGAACAAGCCCAATTATCAAAGAAAACCTCTAG TAAGTTTCAAAGAAGACCCTACGCCAAGTGATAATCCCTTTTCAAAACTATACAAAGAAACCAT AGAAACATTTGATAACAATGAAGAAGAATCTAGCTATTCATATGAAGAAATAAATGATCAGAC AAACGATAATATAACAGCAAGATTAGATAGGATTGATGAAAAATTAAGTGAAATACTAGGAAT GCTTCACACATTAGTAGTAGCGAGTGCAGGACCTACATCTGCTCGGGATGGTATAAGAGATGC CATGGTTGGTTTAAGAGAAGACATGATAGAAAAAATCAGAACTGAAGCATTAATGACCAATGA CAGACTAGAAGCTATGGCAAGACTCAGGAATGAGGAAAGTGAAAAGATGGCAAAAGACACAT CAGATGAAGTGTCTCTCAATCCAACATCAGAGAAATTGAACAACCTGTTGGAAGGGAATGATA GTGACAATGATCTATCACTTGATGATTTCTGA SEQIDNO:49(aminoacidsequenceforRSVPproteincodon-optimized(A strain)) MEKFAPEFHGEDANNRATKFLESIKGKFTSPKDPKKKDSIISVNSIDIEVTKESPITSNSTIINPTNETD DTAGNKPNYQRKPLVSFKEDPTPSDNPFSKLYKETIETFDNNEEESSYSYEEINDQTNDNITARLDRI DEKLSEILGMLHTLVVASAGPTSARDGIRDAMIGLREEMIEKIRTEALMTNDRLEAMARLRNEESE KMAKDTSDEVSLNPTSEKLNNLLEGNDSDNDLSLEDF SEQIDNO:50(nucleotidesequenceforRSVPproteincodon-optimized(A strain)) ATGGAAAAGTTCGCCCCCGAGTTCCACGGCGAGGACGCCAACAACCGGGCCACCAAGTTTCTG GAATCCATCAAGGGCAAGTTCACCAGCCCCAAGGACCCCAAGAAGAAGGACAGCATCATCAGC GTGAACAGCATCGACATCGAAGTGACCAAAGAGAGCCCCATCACCAGCAACAGCACCATCATC AACCCCACCAACGAGACAGACGACACCGCCGGCAACAAGCCCAACTACCAGCGGAAGCCCCTG GTGTCCTTCAAAGAGGACCCCACCCCCAGCGACAACCCCTTCAGCAAGCTGTACAAAGAGACA ATCGAGACATTCGACAACAACGAGGAAGAGAGCAGCTACAGCTACGAGGAAATCAACGACCA GACCAACGACAACATCACCGCCAGACTGGACCGGATCGACGAGAAGCTGAGCGAGATCCTGG GCATGCTGCACACCCTGGTGGTGGCCTCTGCCGGCCCTACAAGCGCCAGAGATGGCATCCGGG ACGCCATGATCGGCCTGCGGGAAGAGATGATCGAGAAGATCCGGACCGAGGCCCTGATGACC AACGACCGGCTGGAAGCCATGGCCCGGCTGCGGAACGAGGAATCCGAGAAGATGGCCAAGG ACACCAGCGACGAGGTGTCCCTGAACCCCACCTCTGAGAAGCTGAACAACCTGCTGGAAGGCA ACGACAGCGACAACGACCTGAGCCTGGAAGATTTCTGA