Oncolytic tumor viruses and methods of use

12514887 ยท 2026-01-06

Assignee

Inventors

Cpc classification

International classification

Abstract

Recombinant adenoviruses that selectively replicate in E2F deregulated tumor cells are described. The recombinant adenoviruses have a genome encoding a modified E1A protein, a modified or deleted E4orf1 protein, a modified or deleted E4orf6/7 protein, or any combination thereof, such that the recombinant adenoviruses exhibit replication defects in normal cells compared to tumor cells. In some instances, the recombinant adenovirus genomes encode additional modifications that target the recombinant adenoviruses to specific cell types, detarget the viruses from the liver, inhibit viral replication in the liver, and/or evade pre-existing neutralizing antibodies.

Claims

1. A recombinant adenovirus, comprising: an adenovirus E1A promoter; an adenovirus E4 promoter; and a genome: encoding a modified E1A protein comprising a deletion of the LXCXE motif or a C124G substitution; and encoding a modified E4orf6/7 protein, wherein the function of the modified E4orf6/7 is impaired or abolished, or comprising a complete or partial deletion that results in the absence of E4orf6/7 protein expression; wherein the genome comprises a deletion of the entirety of each of the E3-RID/RID and E3-14.7k coding sequences, wherein the recombinant adenovirus exhibits replication defects in normal cells compared to tumor cells and replicates to wild-type adenovirus levels in tumor cells.

2. The recombinant adenovirus of claim 1, wherein the genome encodes an adenovirus fiber protein fused to the wild-type FKBP-rapamycin binding (FRB) protein or a mutant FRB protein comprising a T2098L substitution.

3. The recombinant adenovirus of claim 2, wherein the genome further encodes a targeting ligand fused to FK506 binding protein (FKBP).

4. The recombinant adenovirus of claim 3, wherein the targeting ligand is a single domain antibody.

5. The recombinant adenovirus of claim 1, wherein the genome comprises a deletion of the entirety of each of the E3-RID/RID and E3-14.7k coding sequences and the coding sequences are not replaced with a sequence coding an adenovirus fiber protein fused to the wild-type FKBP-rapamycin binding (FRB) protein or a mutant FRB protein comprising a T2098L substitution.

6. The recombinant adenovirus of claim 1, wherein the genome further encodes a modified hexon protein.

7. The recombinant adenovirus virus of claim 6, wherein the modified hexon protein comprises an E451Q substitution.

8. The recombinant adenovirus of claim 2, wherein the adenovirus fiber protein is fused to the mutant FRB protein comprising the T2098L substitution.

9. The recombinant adenovirus of claim 1, wherein the genome further comprises one or more binding sites for a liver-specific microRNA.

10. The recombinant adenovirus of claim 9, wherein the liver-specific microRNA is miR-122.

11. The recombinant adenovirus of claim 1, wherein the genome further encodes a modified penton protein.

12. The recombinant adenovirus of claim 11, wherein the modified penton protein comprises a mutation in the integrin-binding RGD motif.

13. A composition comprising the recombinant adenovirus of claim 1, and a pharmaceutically acceptable carrier.

14. The recombinant adenovirus of claim 2, wherein the genome of the recombinant adenovirus virus: encodes a modified E1A protein comprising a deletion of the LXCXE motif; comprises a complete or partial deletion that results in the absence of E4orf6/7 protein expression; and encodes an adenovirus fiber protein fused to the mutant FRB protein comprising the T2098L substitution.

15. The recombinant adenovirus of claim 2, wherein the genome of the recombinant adenovirus virus: encodes a modified E1A protein comprising a deletion of the LXCXE motif; comprises a complete or partial deletion that results in the absence of E4orf6/7 protein expression; and encodes an adenovirus fiber protein fused to the wild-type FRB protein.

16. The recombinant adenovirus of claim 1, wherein the adenovirus is a capsid-swapped chimeric adenovirus, wherein the E1, E3 and E4 modules are derived from a first adenovirus serotype and the E2B, L1, L2, L3, E2A and L4 modules are derived from a second adenovirus serotype.

17. The recombinant adenovirus of claim 16, wherein the first adenovirus serotype is Ad5 and the second adenovirus serotype is selected from Ad3, Ad9, Ad11, Ad12, and Ad34.

18. The recombinant adenovirus of claim 1, wherein the genome of the recombinant adenovirus further: encodes a modified hexon protein comprising the E451Q substitution; encodes a chimeric fiber protein comprising the fiber shaft from a first adenovirus serotype and the fiber knob from a second adenovirus serotype; and does not encode an adenovirus fiber protein fused to the wild-type FKBP-rapamycin binding (FRB) protein or a mutant FRB protein comprising the T2098L substitution.

19. The recombinant adenovirus of claim 18, wherein the first adenovirus serotype is Ad5 and the second adenovirus serotype is Ad3, Ad9, Ad11, Ad12, Ad34 or Ad37.

20. The recombinant adenovirus of claim 18, wherein the first adenovirus serotype is Ad5 and the second adenovirus serotype is Ad34.

21. The recombinant adenovirus of claim 1, wherein the adenovirus is a capsid-swapped chimeric adenovirus.

22. The recombinant adenovirus of claim 21, wherein the adenovirus is a capsid-swapped chimeric adenovirus, wherein the E1, E3 and E4 modules are derived from a first adenovirus serotype and the E2B, L1, L2, L3, E2A and L4 modules are derived from a second adenovirus serotype.

23. The recombinant adenovirus of claim 22, herein the first adenovirus serotype is Ad5 and the second adenovirus serotype is Ad3, Ad9, Ad11, Ad12, Ad34 or Ad37.

24. The recombinant adenovirus of claim 22, wherein: the E1 region of the first adenovirus serotype is modified to encode the pIX protein from the second adenovirus serotype; and/or the E3 region of the first adenovirus serotype is modified to encode the Uexon and fiber proteins from the second adenovirus serotype.

25. The recombinant adenovirus of claim 24, herein the first adenovirus serotype is Ad5 and the second adenovirus serotype is Ad3, Ad9, Ad11, Ad12, Ad34 or Ad37.

26. A composition comprising the recombinant adenovirus of claim 18, and a pharmaceutically acceptable carrier.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIGS. 1A-1B are immunoblots of cell lysates showing expression of adenovirus E1A from recombinant adenovirus infected cells. Cells were mock infected or infected with AdSyn-CO102 (wild-type), AdSyn-CO181 (E1A LXCXE/E4orf6/7), AdSyn-CO189 (E1A LXCXE) or ONYX-838 (E1A CR2). For FIG. 1A, quiescent human primary small airway epithelial cells (SAEC) were infected at MOI 10 and lysates were analyzed for E1A expression. In cells infected with AdSyn-CO102, there was a decrease in E1A levels at later times during infection. Similarly, in cells infected with AdSyn-CO189 or ONYX-838, there was a decrease in E1A levels at later times during infection; however, at the earlier timepoint, expression of E1A is greater than expression of E1A in AdSyn-CO102-infected cells. In contrast, cells infected with AdSyn-CO181 exhibit stronger and continued expression of E1A throughout the infection, which is indicative of a failure to progress through the adenovirus lifecycle. For FIG. 1B, confluent lung adenocarcinoma cells (A549) were infected at MOI 30 and lysates were analyzed for E1A expression. All infections led to a decrease in E1A levels at later times during infection, indicative of a typical adenovirus lifecycle progression.

(2) FIGS. 2A-2B are immunoblots of cell lysates showing expression of cellular cyclins and adenovirus late proteins in infected primary and tumor cells. Cells were mock infected or infected with AdSyn-CO102 (wild-type), AdSyn-CO181 (E1A LXCXE/E4orf6/7), AdSyn-CO189 (E1A LXCXE), AdSyn-CO210 (E4orf6/7), or ONYX-838 (E1A CR2). For FIG. 2A, SAEC were infected at MOI 10. In contrast to wild-type virus and viruses with E1A mutations alone, AdSyn-CO181 failed to activate E2F dependent cell cycle targets, the S phase cyclins, cyclin A and cyclin B. Furthermore, AdSyn-CO181 and AdSyn-CO210, which have E4orf6/7 mutations, were defective for late protein expression and replication. Both of these defects were apparent to a lesser extent with AdSyn-CO210. For FIG. 2B, A549 cells were infected at MOI 30. In contrast to infected primary cells, there were no apparent defects in expression of late structural proteins, and cyclin A and cyclin B remained present in all infected A549 samples.

(3) FIGS. 3A-3B are FACS histograms quantifying cellular DNA in infected SAEC and A549 cells, respectively. Cells were mock infected or infected with AdSyn-CO102 (wild-type), AdSyn-CO181 (E1A LXCXE/E4orf6/7), AdSyn-CO189 (E1A LXCXE) or AdSyn-CO210 (E4orf6/7), and collected 48 hours post-infection. DNA content of uninfected cells is shown in the background profile. The Y-axis is the relative abundance of cells, and the X-axis is the fluorescence from propidium iodide (PI) in the cell, which is proportional to the amount of DNA. For FIG. 3A, quiescent SAEC were infected at MOI 10. AdSyn-CO181 infection exhibited a strong DNA replication defect in SAEC relative to AdSyn-CO102, which is linked to decreased virus replication. A modest defect was also apparent in AdSyn-CO210 infected SAEC at this timepoint. For FIG. 3B, A549 cells were infected at MOI 30. No DNA replication defect was apparent with any mutant virus infection in these cells.

(4) FIGS. 4A-4B are graphs showing adenovirus bursts from infected SAEC and A549 cells, respectively. Cells were mocked infected or infected with AdSyn-CO102 (wild-type), AdSyn-CO181 (E1A LXCXE/E4orf6/7), AdSyn-CO189 (E1A LXCXE), AdSyn-CO210 (E4orf6/7) or ONYX-838 (E1A CR2) and the media was collected 48 and 72 hours post-infection. Infectious virus particles in the media were quantified by ELISA. For FIG. 4A, quiescent SAEC were infected at MOI 10. Both AdSyn-CO181 and AdSyn-CO210 infection revealed strong replication defects in SAEC relative to AdSyn-CO102. For FIG. 4B, A549 cells were infected at MOI 30. With the exception of AdSyn-CO210, no defect in virus replication was observed in these cells.

(5) FIGS. 5A-5B are graphs showing cell viability of infected SAEC and A549 cells, respectively, after 7 days of infection. Cells were mock infected or infected with a serial dilution of AdSyn-CO102 (wild-type), AdSyn-CO181 (E1A LXCXE/E4orf6/7), AdSyn-CO189 (E1A LXCXE), AdSyn-CO210 (E4orf6/7) or ONYX-838 (E1A CR2) and cellular metabolic activity was quantified by WST-1 assay. As shown in FIG. 5A, compared to AdSyn-CO102, AdSyn-CO181 exhibited decreased cell-killing capability in SAEC. As shown in FIG. 5B, of the mutant viruses tested, there was no defect in cell killing relative to wild-type virus.

(6) FIG. 6A is an immunoblots of cell lysates. Normal human astrocytes (NHA) infected at MOI 10 were subjected to immunoblot to detect adenovirus late structural protein expression and cellular cyclin induction. AdSyn-CO181 does not induce cyclin A, and demonstrated delayed and decreased late viral protein expression relative to AdSyn-CO102, which are indicative of replication deficiency.

(7) FIGS. 6B-6C are graphs showing AdSyn-CO181 exhibits attenuated infection in NHA. For FIG. 6B, NHA were infected by the panel of viruses, and the number of infectious particles in the media was quantified 48 and 72 hours post-infection. AdSyn-CO181 and AdSyn-CO189 demonstrated a replication defect in NHA relative to AdSyn-CO102. For FIG. 6C, DNA replication was quantified in MOI 10 infected NHA 48 hours post-infection by PI FACS. DNA content of uninfected cells is shown in the background profile of the histograms. The Y-axis is the relative abundance of cells, and the X-axis is the fluorescence from PI in the cell, which is proportional to the amount of nucleic acid. AdSyn-CO181 exhibited a diminished induction of DNA replication relative to AdSyn-CO102, which is linked to decreased virus replication.

(8) FIG. 7A is an immunoblot of cell lysates from infected glioblastoma U87 cells. MOI 20 infected U87 cells were subjected to immunoblot to detect adenovirus late structural protein expression and cellular cyclin induction.

(9) FIGS. 7B-7C are graphs showing recombinant adenoviruses have no replication defects in glioblastoma U87 cells. For FIG. 7B, U87 cells were infected by the panel of viruses, and the number of infectious particles in the media was quantified 48 and 72 hours post-infection. For FIG. 7C, DNA replication was quantified in MOI 20 infected U87 cells 48 hours post-infection by PI FACS. DNA content of uninfected cells is shown in background profile of the histograms. The Y-axis is the relative abundance of cells, and the X-axis is the fluorescence from PI in the cell, which is proportional to the amount of DNA.

(10) FIG. 8A is an immunoblot of cell lysates from infected glioblastoma U118 cells. MOI 20 infected U118 cells were subjected to immunoblot to detect adenovirus late structural proteins expression and cellular cyclin induction.

(11) FIGS. 8B-8C are graphs showing recombinant adenoviruses have no replication defects in glioblastoma U118 cells. For FIG. 8B, U118 cells were infected by the panel of viruses, and the number of infectious particles in the media was quantified 48 and 72 hours post-infection. For FIG. 8C, DNA replication was quantified in MOI 20 infected U118 cells 48 hours post-infection by PI FACS. DNA content of uninfected cells is shown in the background profile of the histograms. The Y-axis is the relative abundance of cells, and the X-axis is the fluorescence from PI in the cell, which is proportional to the amount of DNA.

(12) FIG. 9A is an immunoblot of cell lysates from infected human fibroblasts (IMR90 cells). MOI 10 infected fibroblasts were subjected to immunoblot to detect late structural protein expression. AdSyn-CO181 exhibited delayed and decreased late viral protein expression relative to AdSyn-CO102, which is indicative of replication deficiency.

(13) FIGS. 9B-9C are graphs showing AdSyn-CO181 has modest replication defects in IMR90 cells. For FIG. 9B, fibroblasts were infected by the panel of viruses, and the number of infectious particles in the media was quantified 48 and 72 hours post-infection. With this assay at these timepoints, there was not a clear difference in replication capacity of the modified adenoviruses. For FIG. 9C, DNA replication was quantified in MOI 20 infected fibroblasts 48 hours post-infection by PI FACS. DNA content of uninfected cells is shown in the background profile of the histograms. The Y-axis is the relative abundance of cells, and the X-axis is the fluorescence from PI in the cell, which is proportional to the amount of DNA. AdSyn-CO181 exhibited a diminished induction of DNA replication relative to AdSyn-CO102, which is linked to decreased virus replication.

(14) FIG. 10 is a graph showing the cell viability of infected primary NHA cells after 10 days of infection. Cells were infected with a serial dilution of wild-type or mutant virus. The metabolic activity was quantified by WST-1 assay. At three and ten infectious particles per cell, two groups of viruses were apparent, labeled in the graph as less killing and more killing. The viruses that induced less cell killing bear both an E1A with an Rb-binding mutation and a deletion of E4orf6/7. The viruses that induced more killing either have a wild-type E1 or a wild-type E4.

(15) FIG. 11 is a graph showing the cell viability of infected quiescent SAEC-hTERT cells after 9 days of infection. Cells were infected with a serial dilution of wild-type or mutant virus. The metabolic activity was quantified by WST-1 assay. At three and ten infectious particles per cell, two groups of viruses were apparent, labeled in the graph as less killing and more killing. The viruses that induced less cell killing bear both an E1A with an Rb-binding mutation and a deletion of E4orf6/7. The viruses that induced more cell killing either have a wild-type E1 or a wild-type E4.

(16) FIG. 12 is a graph showing the cell viability of infected proliferating SAEC-hTERT cells after 9 days of infection. Cells were infected with a serial dilution of wild-type or mutant virus. The metabolic activity was quantified by WST-1 assay. At three and ten infectious particles per cell, two groups of viruses were apparent, labeled in the graph as less killing and more killing. The viruses that induced less cell killing bear both an E1A with an Rb-binding mutation and a deletion of E4orf6/7. The viruses that induced more cell killing either have a wild-type E1 or a wild-type E4.

(17) FIG. 13 is a graph showing the cell viability of infected A549 cells after 7 days of infection. Cells were infected with a serial dilution of wild-type or modified virus. The metabolic activity was quantified by WST-1 assay.

(18) FIG. 14 is a graph showing the cell viability of infected human breast cancer cells (MDA MB 231) after 7 days of infection. Cells were infected with a serial dilution of wild-type or modified virus. The metabolic activity was quantified by WST-1 assay.

(19) FIG. 15 is a graph showing the cell viability of infected glioblastoma cells (U87) after 7 days of infection. Cells were infected with a serial dilution of wild-type or modified virus. The metabolic activity was quantified by WST-1 assay.

(20) FIG. 16 is a table showing the quantitation of cell viability assays for infected primary NHA, SAEC-hTERT (quiescent), SAEC-hTERT (proliferating), A549, MDA MB 231 and U87 cells shown in FIGS. 10-15.

(21) FIG. 17 is a table showing the quantitation cell viability assays for infected U2OS cells (which have functional p53 and Rb) and SaOS2 cells (which have non-functional p53 and Rb). Cells were infected with a serial dilution of wild-type or modified virus. The metabolic activity was quantified by WST-1 assay.

(22) FIG. 18A is a graphic showing the binding interface of the FRB domain with rapamycin and FKBP12. A mutated FRB domain (FRB*; mTOR residue T2098L) is induced to form a FRB/FKBP12 heterodimer with either rapamycin or rapamycin homolog AP21967. FIG. 18B is a graph showing that EGFR-targeted virus with FRB-fiber (AdSyn-CO205; SEQ ID NO: 88) has improved transduction of MDA MB 453 breast cancer cells in the presence of rapamycin, but not AP21967. The EGFR-targeted virus with the FRB*-fiber (AdSyn-CO220; SEQ ID NO: 98) has improved transduction of MDA MB 453 cells in the presence of either rapamycin or AP21967. FIG. 18C is an immunoblot showing the activity of the mTOR inhibitor rapamycin blocking the phosphorylation of its target p70 S6K. The rapamycin homolog AP21967 does not inhibit mTOR at targeting concentrations. FIG. 18D is a graph showing the cell viability of infected HS578T metastatic breast cancer cells after 9 days of infection. Cells were infected with a serial dilution of AdSyn-CO312. At 24, 48, 72 and 96 hours after infection, fresh rapamycin or AP21967 was added to 50 nM. The metabolic activity was quantified by WST-1 assay, and was normalized to uninfected cells with a matching drug treatment. AdSyn-CO312 bears the oncolytic mutations of E1A LXCXE, E4orf6/7, E3-RID/, E3-14.7k, and expresses the rapamycin- or AP21967-dependent EGFR-targeting genes EGFRVHH-FKBP and FRB*-fiber. There is enhanced killing of cells infected with the EGFR-targeted oncolytic virus that receive either rapamycin or AP21967 versus without targeting. FIG. 18E is a graph showing the cell viability of infected HS578T metastatic breast cancer cells after 9 days of infection. Cells were infected with a serial dilution of AdSyn-CO313. At 24, 48, 72 and 96 hours after infection, fresh rapamycin was added to 50 nM. The metabolic activity was quantified by WST-1 assay, and was normalized to uninfected cells with a matching drug treatment. AdSyn-CO313 bears the oncolytic mutations of E1A LXCXE, E4orf6/7, E3-RID/, E3-14.7k, and expresses the rapamycin-dependent EGFR-targeting gene EGFRVHH-FKBP and FRB-fiber. There is enhanced killing of cells infected with the EGFR-targeted oncolytic virus that receive rapamycin without targeting.

(23) FIG. 19 is a graph showing the mean tumor volume of HS578T subcutaneous xenografts in treated mice. Mice with established tumors received intratumoral injection of AdSyn-CO313, then subsequently received periodic intraperitoneal 8 mg/kg rapamycin injection (n=5) or vehicle control (n=4), or they received intratumoral vehicle control, then subsequently received periodic intraperitoneal 8 mg/kg rapamycin injection (n=5) or vehicle control (n=4). Infection was repeated in the same groups three more times every 4 days starting 19 days following the initial infection. AdSyn-CO313 bears the oncolytic mutations of E1A LXCXE, E4orf6/7, E3-RID/, E3-14.7k, and expresses the rapamycin-dependent EGFR-targeting genes EGFRVHH-FKBP and FRB-fiber. The tumors in mice receiving the EGFR-targeted oncolytic virus with rapamycin exhibited the best response.

(24) FIG. 20 is a graph showing the cell viability of infected HS578T metastatic breast cancer cells after 9 days of infection. Cells were infected with a serial dilution of AdSyn-CO335. At 24, 48, 72 and 96 hours after infection, fresh rapamycin or AP21967 was added to 50 nM. The metabolic activity was quantified by WST-1 assay, and was normalized to uninfected cells with a matching drug treatment. AdSyn-CO335 bears the oncolytic mutations of E1A LXCXE, E4orf6/7, E3-RID/, E3-14.7k; the liver detargeting hexon mutation E451Q; and expresses the rapamycin- or AP21967-dependent EGFR-targeting genes EGFRVHH-FKBP and FRB*-fiber. There is enhanced killing of cells infected with the EGFR-targeted oncolytic virus that receive either rapamycin or AP21967 versus without targeting.

(25) FIGS. 21A-21B are graphs showing the mean volumes of HS578T subcutaneous xenografts in treated mice. FIGS. 21C-21D are graphs showing the fold-change in volumes of HS578T subcutaneous xenografts in treated mice. Mice with established tumors received three intratumoral injections every 4 days of AdSyn-CO335, then subsequently received intraperitoneal 2 or 8 mg/kg rapamycin injection (n=8 and n=8, respectively) every other following day or vehicle control (n=6) every other following day; or they received three intratumoral injections every 4 days of AdSyn-CO442, then subsequently received intraperitoneal 2 or 8 mg/kg rapamycin injection (n=6 and n=6, respectively) every other following day; or they received three intratumoral injections every 4 days of vehicle control, then subsequently received intraperitoneal 2 or 8 mg/kg rapamycin injection (n=6 and n=6, respectively) every other following day. The tumors in mice receiving the EGFR-targeted oncolytic virus with 8 mg/kg rapamycin show the best response.

(26) FIGS. 22A-22C show the elimination of adenovirus mediated gene expression in the liver, and detargeting of adenovirus infection to the liver. As shown in FIG. 22A, AdSyn-CO199, an adenovirus vector lacking the E1 region, expresses luciferase at high levels exclusively in the liver following systemic infection. As shown in FIG. 22B, the luciferase signal is lost when mice are systemically infected with AdSyn-CO200, a virus matching AdSyn-CO199, except that the liver-specific microRNA miR122 eliminates luciferase expression. As shown in FIG. 22C, expression of luciferase can be detected in the spleen when mice are systemically infected with AdSyn-CO171, a virus matching AdSyn-CO200, except that the adenovirus hexon protein bears the mutation E451Q, which detargets it from the liver.

(27) FIGS. 23A-23E include an illustration of the fiber protein structure and a series of graphs and images characterizing recombinant adenoviruses generated by combining modules from two adenovirus serotypes to create viruses with chimeric fiber proteins that better transduce a variety of cell types.

(28) FIG. 24A is an illustration depicting module modifications to create capsid swapped chimeric viruses. FIG. 24B is a table listing specific mutant viruses and their E1, core, E3 and E4 module modifications.

(29) FIGS. 25A-25E are a series of immunoblots showing protein content and expression from capsid-swapped viruses.

(30) FIGS. 26A-26C are a series of graphs showing capsid-swapped viruses are not neutralized by human serum containing anti-Ad5 antibodies.

(31) FIG. 27 shows an alignment of E1A sequences from human adenovirus species, including species A (Ad12; SEQ ID NO: 47), species B (Ad7; SEQ ID NO: 48), species C (Ad2 and Ad5; SEQ ID NO: 49 and SEQ ID NO: 50, respectively), species D (Ad9; SEQ ID NO: 51), species E (Ad4; SEQ ID NO: 52), species F (Ad40; SEQ ID NO: 53) and species G (Ad52; SEQ ID NO: 54). Outlined is Y47, a site of mutation found in the oncolytic adenovirus compositions disclosed herein. Highlighted in the gray box is the LXCXE motif containing C124, which is necessary for strong E1A-Rb interaction.

(32) FIG. 28 shows an alignment of E4orf1 sequences from human adenovirus species, including species A (Ad12; SEQ ID NO: 55), species B (Ad7; SEQ ID NO: 56), species C (Ad2 and Ad5; SEQ ID NO: 57 and SEQ ID NO: 58, respectively), species D (Ad9; SEQ ID NO: 59), species E (Ad4; SEQ ID NO: 60), and species G (Ad52; SEQ ID NO: 61). Highlighted in the gray box is the PDZ binding motif through which E4orf1 upregulates PI3K and prevents negative regulation of cellular proliferation.

(33) FIG. 29 shows an immunoblot of protein expression from 293-E4 cells infected with synthetic adenoviruses bearing rapamycin-dependent EGFR-targeting components. 293-E4 cells were infected with a multiplicity of infection (MOI) of 10 by either Assembly wildtype Ad (AdSyn-CO170), the targeting-modified AdSyn-CO205, or control viruses AdSyn-CO206 or AdSyn-CO207. For the rapamycin-controlled EGFR-targeted virus AdSyn-CO205, a GFP reporter was fused to E1A as a marker for infection. The E3B transcript was modified by deleting RID, RID, and 14.7k, and used to express EGFRVHH-FKBP. AdSyn-CO206 contains all the modifications of AdSyn-CO205, but retains a wildtype fiber, and therefore does not have an FRB domain. AdSyn-CO207 has all the modifications of AdSyn-CO206, but retains a wildtype E3 region, and therefore does not have the FKBP-fusion gene. The change in migration for fiber shows the 90 amino acid FRB domain insertion in AdSyn-CO207 and AdSyn-CO205. The expression of the EGFRVHH-FKBP fusion protein was detected by probing for FKBP12. The timecourse of late protein expression shows that there is no pronounced defect in replication of the capsid-mutant, or EGFRVHH-FKBP expressing viruses with GFP-E1A reporters compared to Assembly wildtype Ad.

(34) FIG. 30 is a waterfall plot showing HS578T xenograft tumor response 28 days after three intratumoral injections of vehicle (uninfected), control virus (AdSyn-CO442), or oncolytic adenovirus (AdSyn-CO335), and 3 weeks of intraperitoneal co-administration of rapamycin (0, 2 or 8 mg/kg) every other day. Shown from left to right are (a) uninfected, no rapamycin; (b) uninfected, 2 mg/kg rapamycin; (c) uninfected, 8 mg/kg rapamycin; (d) AdSyn-CO335, no rapamycin; (e) AdSyn-CO335, 2 mg/kg rapamycin; (f) AdSyn-CO335, 8 mg/kg rapamycin; (g) AdSyn-CO442, 2 mg/kg rapamycin; and (h) AdSyn-CO442, 8 mg/kg rapamycin. N=number of tumors in each group. Each column represents one individual tumor, with data expressed relative to its pre-treatment tumor volume.

(35) FIG. 31 shows immunohistochemistry (IHC) staining of HS578T xenograft tissue. Mice with subcutaneous HS578T xenograft tumors were treated by intraperitoneal injection of 100 L vehicle, 2 mg/kg rapamycin or 8 mg/kg rapamycin. One hour following injection, xenograft tissues were collected, fixed in 10% formalin, and sectioned for IHC staining with an antibody that recognizes the phospho-T378 form of P70S6K. Shown are micropictographs of HS578T xenograft tissue sections stained for P70S6K phosphorylated at threonine 389 (P70S6K p-T389). The phosphorylation of P70S6K at T389 is a hallmark of mTOR activity. In the tissues with no treatment or with the low, adenovirus EGFR-targeting effective dose (2 mg/kg), mTOR activity is not inhibited, as evidenced by the staining of P70S6K p-T389. At the higher adenovirus EGFR-targeting effective dose (8 mg/kg) mTOR activity is inhibited, marked by a loss of P70S6K p-T389 staining.

SEQUENCE LISTING

(36) The nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three letter code for amino acids, as defined in 37 C.F.R. 1.822. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood as included by any reference to the displayed strand. The Sequence Listing is submitted as an ASCII text file, created on Mar. 15, 2017, 2.91 MB, which is incorporated by reference herein. In the accompanying sequence listing: SEQ ID NOs: 1-31 and 68-98 are nucleotide sequences of recombinant adenoviruses (see Tables 1-5; Example 6; and Example 7). SEQ ID NO: 32 is the amino acid sequence of Ad5 E1A. SEQ ID NO: 33 is the amino acid sequence of Ad5 E1A LXCXE. SEQ ID NO: 34 is the amino acid sequence of Ad5 E1A C124G. SEQ ID NO: 35 is the amino acid sequence of Ad5 E1A 2-11. SEQ ID NO: 36 is the amino acid sequence of Ad5 E1A Y47H C124G. SEQ ID NO: 37 is the amino acid sequence of Ad5 E1A 2-11 Y47H C124G. SEQ ID NO: 38 is the amino acid sequence of Ad5 E4orf1. SEQ ID NO: 39 is the amino acid sequence of Ad5 E4orf1 PDZb. SEQ ID NO: 40 is the amino acid sequence of Ad5 E4orf6/7. SEQ ID NO: 41 is the amino acid sequence of Ad5 fiber. SEQ ID NO: 42 is the amino acid sequence of Ad5 FRB-fiber. SEQ ID NO: 43 is the amino acid sequence of Ad5 FRB*-fiber. SEQ ID NO: 44 is the amino acid sequence of EGFRVHH-GS-FKBP. SEQ ID NO: 45 is the amino acid sequence of Ad5 hexon. SEQ ID NO: 46 is the amino acid sequence of Ad5 hexon E451Q. SEQ ID NO: 47 is the amino acid sequence of species A (Ad12) E1A. SEQ ID NO: 48 is the amino acid sequence of species B (Ad7) E1A SEQ ID NO: 49 is the amino acid sequence of species C (Ad2) E1A. SEQ ID NO: 50 is the amino acid sequence of species C (Ad5) E1A. SEQ ID NO: 51 is the amino acid sequence of species D (Ad9) E1A. SEQ ID NO: 52 is the amino acid sequence of species E (Ad4) E1A. SEQ ID NO: 53 is the amino acid sequence of species F (Ad40) E1A. SEQ ID NO: 54 is the amino acid sequence of species G (Ad52) E1A. SEQ ID NO: 55 is the amino acid sequence of species A (Ad12) E4orf1. SEQ ID NO: 56 is the amino acid sequence of species B (Ad7) E4orf1. SEQ ID NO: 57 is the amino acid sequence of species C (Ad2) E4orf1. SEQ ID NO: 58 is the amino acid sequence of species C (Ad5) E4orf1. SEQ ID NO: 59 is the amino acid sequence of species D (Ad9) E4orf1. SEQ ID NO: 60 is the amino acid sequence of species E (Ad4) E4orf1. SEQ ID NO: 61 is the amino acid sequence of species G (Ad52) E4orf1. SEQ ID NO: 62 is the nucleotide sequence of Ad2. SEQ ID NO: 63 is the nucleotide sequence of Ad5. SEQ ID NO: 64 is the amino acid sequence of Ad2 E4orf6/7. SEQ ID NO: 65 is the amino acid sequence of Ad5 E3-RID. SEQ ID NO: 66 is the amino acid sequence of Ad5 E3-RID. SEQ ID NO: 67 is the amino acid sequence of Ad5 E3-14.7K.

DETAILED DESCRIPTION

I. Abbreviations

(37) Ad adenovirus CAR coxsackie adenovirus receptor CPE cytopathic effect EGFR epidermal growth factor receptor ELISA enzyme-linked immunosorbent assay FACS fluorescence activated cell sorting FKBP FK 506 binding protein FRB FKBP-rapamycin binding hTERT human telomerase reverse transcriptase HuVEC human vascular endothelial cells MAV-1 mouse adenovirus 1 miR microRNA MOI multiplicity of infection mTOR mammalian target of rapamycin NHA normal human astrocytes PET positron emission topography PI propidium iodide PRP PET reporter probe Rb retinoblastoma SAEC small airway epithelial cells WT wild-type

II. Terms and Methods

(38) Unless otherwise noted, technical terms are used according to conventional usage. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes V, published by Oxford University Press, 1994 (ISBN 0-19-854287-9); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8).

(39) In order to facilitate review of the various embodiments of the disclosure, the following explanations of specific terms are provided:

(40) Adenovirus: A non-enveloped virus with a liner, double-stranded DNA genome and an icosahedral capsid. There are currently 68 known serotypes of human adenovirus, which are divided into seven species (species A, B, C, D, E, F and G). Different serotypes of adenovirus are associated with different types of disease, with some serotypes causing respiratory disease (primarily species B and C), conjunctivitis (species B and D) and/or gastroenteritis (species F and G).

(41) Administration: To provide or give a subject an agent, such as a therapeutic agent (e.g. a recombinant virus), by any effective route. Exemplary routes of administration include, but are not limited to, injection (such as subcutaneous, intramuscular, intradermal, intraperitoneal, and intravenous), oral, intraductal, sublingual, rectal, transdermal, intranasal, vaginal and inhalation routes.

(42) Antibody: A polypeptide ligand comprising at least a light chain and/or heavy chain immunoglobulin variable region which recognizes and binds (such as specifically recognizes and specifically binds) an epitope of an antigen. Immunoglobulin molecules are composed of a heavy and a light chain, each of which has a variable region, termed the variable heavy (V.sub.H) region and the variable light (V.sub.L) region. Together, the V.sub.H region and the V.sub.L region are responsible for binding the antigen recognized by the antibody.

(43) Antibodies include intact immunoglobulins and the variants and portions (fragments) of antibodies well known in the art, such as single-domain antibodies (e.g. VH domain antibodies, or VHH antibodies), Fab fragments, Fab fragments, F(ab).sub.2 fragments, single chain Fv proteins (scFv), and disulfide stabilized Fv proteins (dsFv). A scFv protein is a fusion protein in which a light chain variable region of an immunoglobulin and a heavy chain variable region of an immunoglobulin are bound by a linker, while in dsFvs, the chains have been mutated to introduce a disulfide bond to stabilize the association of the chains. The term antibody also includes genetically engineered forms such as chimeric antibodies (for example, humanized murine antibodies) and heteroconjugate antibodies (such as bispecific antibodies). See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, IL); Kuby, J., Immunology, 3.sup.rd Ed., W. H. Freeman & Co., New York, 1997.

(44) Chemotherapeutic agent: Any chemical agent with therapeutic usefulness in the treatment of diseases characterized by abnormal cell growth. Such diseases include tumors, neoplasms, and cancer as well as diseases characterized by hyperplastic growth, such as psoriasis. In one embodiment, a chemotherapeutic agent is a radioactive compound. One of skill in the art can readily identify a chemotherapeutic agent of use (see for example, Slapak and Kufe, Principles of Cancer Therapy, Chapter 86 in Harrison's Principles of Internal Medicine, 14th edition; Perry et al., Chemotherapy, Ch. 17 in Abeloff, Clinical Oncology 2.sup.nd ed., 2000 Churchill Livingstone, Inc; Baltzer, L., Berkery, R. (eds.): Oncology Pocket Guide to Chemotherapy, 2nd ed. St. Louis, Mosby-Year Book, 1995; Fischer, D. S., Knobf, M. F., Durivage, H. J. (eds): The Cancer Chemotherapy Handbook, 4th ed. St. Louis, Mosby-Year Book, 1993). Combination chemotherapy is the administration of more than one agent to treat cancer.

(45) Chimeric: Composed of at least two parts having different origins. In the context of the present disclosure, a chimeric adenovirus is an adenovirus having genetic material and/or proteins derived from at least two different serotypes (such as from Ad5 and a second serotype of adenovirus). In this context, a capsid-swapped adenovirus refers to a chimeric adenovirus in which the capsid proteins are derived from one serotype of adenovirus and the remaining proteins are derived from another adenovirus serotype. Similarly, a chimeric fiber is a fiber protein having amino acid sequence derived from at least two different serotypes of adenovirus. For example, a chimeric fiber can be composed of a fiber shaft from Ad5 and a fiber knob from a second serotype of adenovirus (see FIG. 23A).

(46) Contacting: Placement in direct physical association; includes both in solid and liquid form.

(47) Degenerate variant: In the context of the present disclosure, a degenerate variant refers to a polynucleotide encoding a peptide that includes a sequence that is degenerate as a result of the genetic code. There are 20 natural amino acids, most of which are specified by more than one codon. Therefore, all degenerate nucleotide sequences encoding a peptide are included as long as the amino acid sequence of the peptide encoded by the nucleotide sequence is unchanged.

(48) Deleted: An adenovirus genome encoding a deleted E4orf1 or E4orf6/7 protein refers to an adenovirus having a complete deletion of the E4orf1 or E4orf6/7 coding sequence, or a partial deletion that results in the absence of E4orf1 or E4orf6/7 protein expression.

(49) Deregulation of E2F: Refers to an increase in activity of the E2F transcription factor and downstream target genes, which occurs in nearly all types of human cancer. Deregulation of the E2F pathway activity and transcription can result from a variety of different mutations in any upstream component of the pathway, such as loss of function mutations and deletions in Rb, p107 and p130 tumor suppressors. Rb was the first tumor suppressor to be identified and is absent or mutated in at least one third of human tumors. In addition, p16 mutations and/or epigenetic silencing can activate E2F in tumor cells. Cyclin D and CDK4 mutations, gene amplifications or over-expression can also result in deregulated E2F activity in human tumors. In addition, E2F is activated by growth factor receptor pathway mutations including EGFR, RTKs, RAS, RAF, PI-3K, PTEN, RAF, MYC. Mutations in the p16.sup.INK4a-Cyclin D:cdk4/6-RB-E2F pathway generally occur in a mutually exclusive fashion, so that one hit (for example, p16) is unaccompanied by others (for example, Rb mutation or cyclin D:cdk over-expression). However, most current chemotherapies are proliferative poisons that inhibit E2F transcriptional targets, but are also toxic to normal cells and have often devastating iatrogenic complications. As disclosed herein, an alternative therapeutic approach is to use a virus that undergoes selective lytic replication in cancer cell lesions that have deregulated the p16-cyclin D:cdk4-RB-E2F pathway.

(50) E1A: The adenovirus early region 1A (E1A) gene and polypeptides expressed from the gene. The E1A protein plays a role in viral genome replication by driving cells into the cell cycle. As used herein, the term E1A protein refers to the proteins expressed from the E1A gene and the term includes E1A proteins produced by any adenovirus serotype. By way of example, the amino acid sequence of wild-type Ad5 E1A protein is set forth herein as SEQ ID NO: 32, and modified Ad5 E1A sequences are provided herein as SEQ ID NOs: 33-37. In addition, wild-type E1A protein sequences from a variety of different adenovirus serotypes are set forth herein as SEQ ID NOs: 47-54. In some embodiments, a modified E1A protein includes a protein having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any one of SEQ ID NOs: 32-37 or SEQ ID NOs: 47-54. The modified E1A proteins contemplated herein are those that contribute to the replication defects of a recombinant adenovirus in normal cells compared to tumor cells. The modified E1A proteins disclosed herein are Ad5 E1A proteins. However, corresponding modifications can be made in any desired serotype, and thus are encompassed by the present disclosure. For example, all species of human adenovirus contain the LXCXE motif, which in Ad5 corresponds to LTCHE (residues 122-126 of SEQ ID NO: 32). Similarly, the deletion of residues 2-11 and the Y47H and C124G substitutions are numbered with reference to Ad5, but can be introduced into any other serotype (see FIG. 27, which provides an alignment of E1A from all human adenovirus species).

(51) E3-RID/RID and E3-14.7k: Early-expressed proteins produced from the E3 gene. The E3-RID, E3-RID, and E3-14.7k proteins make up the receptor internalization and degradation complex (RID), which localizes to the nuclear membrane and causes the endocytosis and degradation of a variety of receptors including CD95 (FasL receptor), and TNFR1 and 2 (TNF/TRAIL receptors) to protect infected cells from host antiviral responses. The E3-RID, E3-RID, and E3-14.7k coding sequences are next to each other, in this order. In some embodiments of the present disclosure, the start codon of E3-RID to the stop codon of E3-14.7k was deleted and replaced with the coding sequence of the FKBP-fusion protein (see, e.g. AdSyn-CO312, AdSyn-CO313, AdSyn-CO335 and AdSyn-CO440). The amino acid sequences of Ad5 E3-RID, E3-RID, and E3-14.7k are set forth herein as SEQ ID NOs: 65-67.

(52) E4orf1: An adenovirus protein produced from the E4 gene. The term E4orf1 protein includes E4orf1 proteins produced by the E4 gene from any adenovirus serotype. By way of example, the amino acid sequence of the wild-type Ad5 E4orf1 protein is set forth herein as SEQ ID NO: 38, and a modified Ad5 E4orf1 protein having a deletion of the PDZ-binding motif is provided herein as SEQ ID NOs: 39. In addition, wild-type E4orf1 protein sequences from a variety of different adenovirus serotypes are set forth herein as SEQ ID NOs: 55-61. In some embodiments, a modified E4orf1 protein includes a protein having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any one of SEQ ID NOs: 38, 39 and 55-61. The modified E4orf1 proteins contemplated herein are those that contribute to the replication defects of a recombinant adenovirus in normal cells compared to tumor cells. The modified E4orf1 proteins disclosed herein are Ad5 E4orf1 proteins. However, corresponding modifications can be made in any desired serotype, and thus are encompassed by the present disclosure. As indicated in the E4orf1 alignment shown in FIG. 28, the C-terminal three residues of E4orf1 constitute the PDZ-binding motif in adenovirus species A, B, C, D, E and G. In some embodiments herein, the recombinant adenovirus encodes a complete deletion E4orf1.

(53) E4orf6/7: A protein encoded by the adenovirus E4 gene. The term E4orf6/7 protein includes E4orf6/7 proteins produced by the E4 gene from any adenovirus serotype. By way of example, the amino acid sequence of the wild-type Ad5 E4orf6/7 protein is set forth herein as SEQ ID NO: 40, and the amino acid sequence of the wild-type Ad2 E4orf6/7 protein is set forth herein as SEQ ID NO: 64. In some embodiments, an E4orf6/7 protein includes a protein having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any one of SEQ ID NO: 40 or SEQ ID NO: 64. The modified E4orf6/7 proteins contemplated herein are those that contribute to the replication defects of a recombinant adenovirus in normal cells compared to tumor cells. In some embodiments, the modified E4orf6/7 protein comprises a mutation (such as a deletion) that abolishes or impairs its E2F binding site and/or impairs E2F interactions. In other embodiments, the modified E4orf6/7 protein comprises a modification that deletes or impairs the nuclear localization signal, which is required for efficient translocation of E2F4. Exemplary modifications of E4orf6/7 are discussed further in the sections below.

(54) Epidermal growth factor receptor (EGFR): The cell-surface receptor for members of the EGF family of extracellular protein ligands. EGFR is also known as ErbB-1 and HER1. Many types of cancer contain mutations that lead to overexpression of EGFR.

(55) Fiber: The adenovirus fiber protein is a trimeric protein that mediates binding to cell surface receptors. The fiber protein is comprised of a long N-terminal shaft and globular C-terminal knob (see FIG. 23A).

(56) FK506 binding protein (FKBP): A family of proteins expressed in eukaryotes that function as protein folding chaperones. FKBP is known for its capacity to bind rapamycin. An exemplary FKBP sequence is set forth herein as residues 132-238 of SEQ ID NO: 44.

(57) FKBP-rapamycin binding (FRB): A domain of mammalian target of rapamycin (mTOR) that binds rapamycin. An exemplary sequence for FRB is set forth herein as residues 547-636 of SEQ ID NO: 42. A mutant form of FRB (referred to herein as FRB*) that is capable of binding both rapamycin and rapalog (also known as AP21967) is set forth herein as residues 547-636 of SEQ ID NO: 43. FRB* contains a threonine to leucine substitution (T2098L) at position 2098 of human mTOR, which corresponds to residue 620 of SEQ ID NO: 43.

(58) Fusion protein: A protein containing amino acid sequence from at least two different (heterologous) proteins or peptides. Fusion proteins can be generated, for example, by expression of a nucleic acid sequence engineered from nucleic acid sequences encoding at least a portion of two different (heterologous) proteins. To create a fusion protein, the nucleic acid sequences must be in the same reading frame and contain no internal stop codons. Fusion proteins, particularly short fusion proteins, can also be generated by chemical synthesis.

(59) Heterologous: A heterologous protein or polypeptide refers to a protein or polypeptide derived from a different source or species.

(60) Hexon: A major adenovirus capsid protein. An exemplary hexon sequence from Ad5 is set forth herein as SEQ ID NO: 45. A mutant hexon sequence comprising an E451Q substitution is set forth herein as SEQ ID NO: 46.

(61) Isolated: An isolated biological component (such as a nucleic acid molecule, protein, virus or cell) has been substantially separated or purified away from other biological components in the cell or tissue of the organism, or the organism itself, in which the component naturally occurs, such as other chromosomal and extra-chromosomal DNA and RNA, proteins and cells. Nucleic acid molecules and proteins that have been isolated include those purified by standard purification methods. The term also embraces nucleic acid molecules and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acid molecules and proteins.

(62) MicroRNA (miRNA or miR): A single-stranded RNA molecule that regulates gene expression in plants, animals and viruses. A gene encoding a microRNA is transcribed to form a primary transcript microRNA (pri-miRNA), which is processed to form a short stem-loop molecule, termed a precursor microRNA (pre-miRNA), followed by endonucleolytic cleavage to form the mature microRNA. Mature microRNAs are approximately 21-23 nucleotides in length and are partially complementary to the 3UTR of one or more target messenger RNAs (mRNAs). MicroRNAs modulate gene expression by promoting cleavage of target mRNAs or by blocking translation of the cellular transcript. In the context of the present disclosure, a liver-specific microRNA is a microRNA that is preferentially expressed in the liver, such as a microRNA that is expressed only in the liver, or a microRNA that is expressed significantly more in the liver as compared to other organs or tissue types.

(63) Modification: A change in the sequence of a nucleic acid or protein sequence. For example, amino acid sequence modifications include, for example, substitutions, insertions and deletions, or combinations thereof. Insertions include amino and/or carboxyl terminal fusions as well as intrasequence insertions of single or multiple amino acid residues. Deletions are characterized by the removal of one or more amino acid residues from the protein sequence. In some embodiments herein, the modification (such as a substitution, insertion or deletion) results in a change in function, such as a reduction or enhancement of a particular activity of a protein. As used herein, or delta refer to a deletion. For example, E1ALXCXE refers to an E1A polypeptide having a deletion of the LXCXE motif. Substitutional modifications are those in which at least one residue has been removed and a different residue inserted in its place. Amino acid substitutions are typically of single residues, but can occur at a number of different locations at once. Substitutions, deletions, insertions or any combination thereof may be combined to arrive at a final mutant sequence. These modifications can be prepared by modification of nucleotides in the DNA encoding the protein, thereby producing DNA encoding the modification. Techniques for making insertion, deletion and substitution mutations at predetermined sites in DNA having a known sequence are well known in the art. A modified protein, nucleic acid or virus is one that has one or more modifications as outlined above.

(64) Neoplasia, malignancy, cancer and tumor: A neoplasm is an abnormal growth of tissue or cells that results from excessive cell division. Neoplastic growth can produce a tumor. The amount of a tumor in an individual is the tumor burden which can be measured as the number, volume, or weight of the tumor. A tumor that does not metastasize is referred to as benign. A tumor that invades the surrounding tissue and/or can metastasize is referred to as malignant. Malignant tumors are also referred to as cancer.

(65) Hematologic cancers are cancers of the blood or bone marrow. Examples of hematological (or hematogenous) cancers include leukemias, including acute leukemias (such as acute lymphocytic leukemia, acute myelocytic leukemia, acute myelogenous leukemia and myeloblastic, promyelocytic, myelomonocytic, monocytic and erythroleukemia), chronic leukemias (such as chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia, and chronic lymphocytic leukemia), polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma (indolent and high grade forms), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia and myelodysplasia. In some cases, lymphomas are considered solid tumors.

(66) Solid tumors are abnormal masses of tissue that usually do not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named for the type of cells that form them (such as sarcomas, carcinomas, and lymphomas). Examples of solid tumors, such as sarcomas and carcinomas, include fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteosarcoma, and other sarcomas, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, lymphoid malignancy, pancreatic cancer, breast cancer, lung cancers, ovarian cancer, prostate cancer, hepatocellular carcinoma, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, medullary thyroid carcinoma, papillary thyroid carcinoma, pheochromocytomas sebaceous gland carcinoma, papillary carcinoma, human papilloma virus (HPV)-infected neoplasias, papillary adenocarcinomas, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, Wilms' tumor, cervical cancer, testicular tumor, seminoma, bladder carcinoma, melanoma, and CNS tumors (such as a glioma (such as brainstem glioma and mixed gliomas), glioblastoma (also known as glioblastoma multiforme) astrocytoma, CNS lymphoma, germinoma, medulloblastoma, Schwannoma craniopharyogioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, neuroblastoma, retinoblastoma and brain metastasis).

(67) Oncolytic virus: A virus that selectively kills cells of a proliferative disorder, e.g., cancer/tumor cells. Killing of the cancer cells can be detected by any method established in the art, such as determining viable cell count, or detecting cytopathic effect, apoptosis, or synthesis of viral proteins in the cancer cells (e.g., by metabolic labeling, immunoblot, or RT-PCR of viral genes necessary for replication), or reduction in size of a tumor.

(68) Operably linked: A first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.

(69) Pharmaceutically acceptable carrier: The pharmaceutically acceptable carriers (vehicles) useful in this disclosure are conventional. Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co., Easton, PA, 15th Edition (1975), describes compositions and formulations suitable for pharmaceutical delivery of one or more therapeutic compounds, molecules or agents (e.g. a recombinant virus disclosed herein).

(70) In general, the nature of the carrier will depend on the particular mode of administration being employed. For instance, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (for example, powder, pill, tablet, or capsule forms), conventional non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch, or magnesium stearate. In addition to biologically-neutral carriers, pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.

(71) Polypeptide, peptide or protein: A polymer in which the monomers are amino acid residues which are joined together through amide bonds. When the amino acids are alpha-amino acids, either the L-optical isomer or the D-optical isomer can be used. The terms polypeptide, peptide and protein are used interchangeably herein. These terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. The term residue or amino acid residue includes reference to an amino acid that is incorporated into a protein, polypeptide, or peptide.

(72) A conservative substitution in a polypeptide is a substitution of one amino acid residue in a protein sequence for a different amino acid residue having similar biochemical properties. Typically, conservative substitutions have little to no impact on the activity of a resulting polypeptide. For example, a protein or peptide including one or more conservative substitutions (for example no more than 1, 2, 3, 4 or 5 substitutions) retains the structure and function of the wild-type protein or peptide. A polypeptide can be produced to contain one or more conservative substitutions by manipulating the nucleotide sequence that encodes that polypeptide using, for example, standard procedures such as site-directed mutagenesis or PCR. In one example, such variants can be readily selected by testing antibody cross-reactivity or its ability to induce an immune response. Examples of conservative substitutions are shown below.

(73) TABLE-US-00001 Original Residue Conservative Substitutions Ala Ser Arg Lys Asn Gln, His Asp Glu Cys Ser Gln Asn Glu Asp His Asn; Gln Ile Leu, Val Leu Ile; Val Lys Arg; Gln; Glu Met Leu; Ile Phe Met; Leu; Tyr Ser Thr Thr Ser Trp Tyr Tyr Trp; Phe Val Ile; Leu

(74) Conservative substitutions generally maintain (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.

(75) The substitutions which in general are expected to produce the greatest changes in protein properties will be non-conservative, for instance changes in which (a) a hydrophilic residue, for example, seryl or threonyl, is substituted for (or by) a hydrophobic residue, for example, leucyl, isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, for example, lysyl, arginyl, or histadyl, is substituted for (or by) an electronegative residue, for example, glutamyl or aspartyl; or (d) a residue having a bulky side chain, for example, phenylalanine, is substituted for (or by) one not having a side chain, for example, glycine.

(76) Preventing, treating or ameliorating a disease: Preventing a disease refers to inhibiting the full development of a disease. Treating refers to a therapeutic intervention that ameliorates a sign or symptom of a disease or pathological condition after it has begun to develop. Ameliorating refers to the reduction in the number or severity of signs or symptoms of a disease.

(77) Promoter: A region of DNA that directs/initiates transcription of a nucleic acid (e.g. a gene). A promoter includes necessary nucleic acid sequences near the start site of transcription. Typically, promoters are located near the genes they transcribe. A promoter also optionally includes distal enhancer or repressor elements which can be located as much as several thousand base pairs from the start site of transcription. A constitutive promoter is a promoter that is continuously active and is not subject to regulation by external signals or molecules. In contrast, the activity of an inducible promoter is regulated by an external signal or molecule (for example, a transcription factor or tetracycline).

(78) Protein IX (pIX): A minor component of the adenovirus capsid that associates with the hexon protein.

(79) Purified: The term purified does not require absolute purity; rather, it is intended as a relative term. Thus, for example, a purified peptide, protein, virus, or other active compound is one that is isolated in whole or in part from naturally associated proteins and other contaminants. In certain embodiments, the term substantially purified refers to a peptide, protein, virus or other active compound that has been isolated from a cell, cell culture medium, or other crude preparation and subjected to fractionation to remove various components of the initial preparation, such as proteins, cellular debris, and other components.

(80) Rapamycin: A small molecule with known immunosuppressive and anti-proliferative properties. Rapamycin, also known as sirolimus, is a macrolide that was first discovered as a product of the bacterium Streptomyces hygroscopicus. Rapamycin binds and inhibits the activity of mTOR.

(81) Rb-deficient cell: A cell (such as a tumor cell) in which the level of the tumor suppressor Rb is reduced compared to the level of Rb in a normal or control cell, or a cell in which the Rb pathway is disrupted or inactive. The terms Rb pathway, or Rb signaling pathway refer to, at least in part, molecules that affect pRb activity including pRb/p107, E2F-1/-2/-3, and G1 cyclin/cdk complexes. It will be appreciated that molecules not presently known may also come within this definition.

(82) Rb/p16/Cyclin D:cdk4/E2F replication impaired or deficient adenovirus: An adenovirus (such as a modified/recombinant adenovirus) that upon infection of a cell, exhibits partially or fully attenuated replication in the presence of normal levels of functional cellular Rb/p107/p130/p16/Cyclin:CDK/E2F pathway proteins, including Rb/p107/p130/p16/E2F/CDK-cyclin checkpoints. For example, if the infected cell is Rb/p16 pathway impaired or deficient (i.e. the infected cell does not express normal levels of fully functional Rb or other proteins in the Rb/p16 pathway), replication of the Rb/p16/E2F pathway replication impaired adenovirus will proceed normally. Conversely, if a cell expresses normal levels of functional Rb (e.g. Rb with normal activity, also referred to herein as an Rb expressing cell), replication of the Rb replication impaired or deficient adenovirus is attenuated or prevented. A cell may be Rb impaired or deficient by failing to express normal levels of Rb (e.g. a mutation to the regulatory region of the Rb gene) or expressing mutated Rb having below normal Rb activity. Normal levels of Rb and normal Rb activity levels are found in healthy, non-diseased cells of the same type. Thus, the Rb impaired cell includes a mutated Rb gene. Optionally, the Rb impaired cell includes a genome wherein the Rb gene is wholly or partially deleted. The Rb impaired cell may be a cancer/tumor cell. Other genomic lesions that can result in the loss of normal Rb function include, but are not limited to, CDK mutations, cyclin mutations and amplifications, p16 mutations and/or epigenetic silencing, p107 mutations, p130 mutations, and growth factor receptor pathway mutations.

(83) Rb/p16 tumor suppressor pathway or Rb/p16 pathway: Refers to the entire signaling pathway that includes the retinoblastoma (Rb) protein, and other protein/protein families in the pathway, including but not limited to Cdk, E2F, atypical protein kinase C, and Skp2. The term Rb/p16 tumor suppressor pathway impaired or deficient means that one or more molecules in the signaling pathway are impaired or deficient, e.g., by failing to express normal levels or a protein or expressing mutated proteins having below normal activity, such that the pathway functions abnormally. Such defects result in high expression levels of free E2F and high activity of the E2F promoter. Thus, a cell may be Rb/p16 pathway impaired or deficient by failing to express normal levels of a protein or expressing mutated proteins having below normal activity in the Rb/p16 tumor suppressor pathway.

(84) Recombinant: A recombinant nucleic acid molecule, protein or virus is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination can be accomplished by chemical synthesis or by the artificial manipulation of isolated segments of nucleic acid molecules, such as by genetic engineering techniques. The term recombinant also includes nucleic acids, proteins and viruses that have been altered solely by addition, substitution, or deletion of a portion of the natural nucleic acid molecule, protein or virus.

(85) Replication defects: An adenovirus that exhibits replication defects in a non-tumor cell (compared to a tumor cell) refers to an adenovirus that exhibits reduced viral replication in normal cells compared to tumor cells. Replication defects are evidenced by, for example, a lack of viral late protein expression, a reduction in viral DNA synthesis, a reduced ability to induce E2F target genes (e.g. cyclin A and B), a reduced ability to elicit S phase entry and/or a reduced ability to induce cell killing in normal cells compared to tumor cells.

(86) Replication deficient virus: A virus that preferentially inhibits cell proliferation, causes cell lysis, or induces apoptosis (collectively considered killing) in a predetermined cell population with a given phenotype (e.g., tumor cells with a deregulated E2F pathway). Such viruses are unable to or are limited in the ability to reduce or inhibit cell proliferation, cause cell lysis, induce apoptosis, or otherwise replicate in cells that do not have the predetermined cell phenotype (such as normal, non-tumor cells).

(87) Sequence identity: The identity or similarity between two or more nucleic acid sequences, or two or more amino acid sequences, is expressed in terms of the identity or similarity between the sequences. Sequence identity can be measured in terms of percentage identity; the higher the percentage, the more identical the sequences are. Sequence similarity can be measured in terms of percentage similarity (which takes into account conservative amino acid substitutions); the higher the percentage, the more similar the sequences are. Homologs or orthologs of nucleic acid or amino acid sequences possess a relatively high degree of sequence identity/similarity when aligned using standard methods. This homology is more significant when the orthologous proteins or cDNAs are derived from species which are more closely related (such as human and mouse sequences), compared to species more distantly related (such as human and C. elegans sequences).

(88) Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith & Waterman, Adv. Appl. Math. 2:482, 1981; Needleman & Wunsch, J. Mol. Biol. 48:443, 1970; Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444, 1988; Higgins & Sharp, Gene, 73:237-44, 1988; Higgins & Sharp, CABIOS 5:151-3, 1989; Corpet et al., Nuc. Acids Res. 16:10881-90, 1988; Huang et al. Computer Appls. in the Biosciences 8, 155-65, 1992; and Pearson et al., Meth. Mol. Bio. 24:307-31, 1994. Altschul et al., J. Mol. Biol. 215:403-10, 1990, presents a detailed consideration of sequence alignment methods and homology calculations.

(89) The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403-10, 1990) is available from several sources, including the National Center for Biological Information (NCBI) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. Additional information can be found at the NCBI web site.

(90) Serotype: A group of closely related microorganisms (such as viruses) distinguished by a characteristic set of antigens.

(91) Subject: Living multi-cellular vertebrate organisms, a category that includes human and non-human mammals.

(92) Synthetic: Produced by artificial means in a laboratory, for example a synthetic nucleic acid or protein can be chemically synthesized in a laboratory.

(93) Targeting ligand: In the context of the present disclosure, a targeting ligand is a protein that directs a recombinant adenovirus to a specific cell type that expresses a receptor or binding protein specific for the targeting ligand. In some embodiments, the targeting ligand is an antibody specific for a cell surface protein overexpressed in tumors (e.g. EGFR).

(94) Therapeutic agent: A chemical compound, small molecule, recombinant virus or other composition, such as an antisense compound, antibody, peptide or nucleic acid molecule capable of inducing a desired therapeutic or prophylactic effect when properly administered to a subject. For example, therapeutic agents for cancer include agents that prevent or inhibit development or metastasis of the cancer.

(95) Therapeutically effective amount: A quantity of a specified pharmaceutical or therapeutic agent (e.g. a recombinant virus) sufficient to achieve a desired effect in a subject, or in a cell, being treated with the agent. The effective amount of the agent can be dependent on several factors, including, but not limited to the subject or cells being treated, and the manner of administration of the therapeutic composition.

(96) Uexon: An open reading frame located on the l strand (leftward transcription) between the early E3 region and the fiber gene (Tollefson et al., J Virol 81(23):12918-12926).

(97) Vector: A vector is a nucleic acid molecule allowing insertion of foreign nucleic acid without disrupting the ability of the vector to replicate and/or integrate in a host cell. A vector can include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication. A vector can also include one or more selectable marker genes and other genetic elements. An expression vector is a vector that contains the necessary regulatory sequences to allow transcription and translation of inserted gene or genes.

(98) Unless otherwise explained, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. The singular terms a, an, and the include plural referents unless context clearly indicates otherwise. Comprising A or B means including A, or B, or A and B. It is further to be understood that all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for description. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including explanations of terms, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.

III. Recombinant Adenoviruses

(99) Recombinant adenoviruses capable of selectively replicating in E2F deregulated tumor cells are provided by the present disclosure. The recombinant adenoviruses disclosed herein have a genome that encodes a modified E1A protein, a modified or deleted E4orf1 protein, a modified or deleted E4orf6/7 protein, or any combination thereof. As a result of the E1A, E4orf1 and/or E4orf6/7 mutations, the recombinant adenoviruses exhibit replication defects in normal (i.e., non-tumor) cells, while retaining the capacity to replicate in and lyse tumor cells. In one example, the recombinant adenoviruses have decreased replication in a normal (i.e., non-tumor) cell, relative to a tumor cell of the same cell type (e.g., breast cancer cell vs. normal breast cell), such as a decrease of at least 20%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, or at least 99%, for example as determined by comparing the number of infectious particles in infected normal cells and infected tumor cells.

(100) The recombinant adenoviruses provided herein optionally include additional modifications, such as for targeting to specific cell types, to inhibit targeting to and replication in the liver, and to evade pre-existing neutralizing antibodies to common adenovirus serotypes. Recombinant nucleic acid molecules encoding the oncolytic adenoviruses are also provided.

(101) Further provided herein are recombinant reporter adenovirus gene expression vectors expressing GFP-luciferase under the control of the EF1 promoter. In some instances, the disclosed reporter adenoviruses include one or more modifications to inhibit targeting to and replication in the liver. Recombinant nucleic acid molecules encoding the recombinant reporter adenoviruses are also provided.

A. Oncolytic Modifications

(102) The specific oncolytic modifications disclosed herein are described with reference to the adenovirus 5 (Ad5) genome sequence. However, the same modifications and deletions could be made in any human adenovirus serotype. In one exemplary embodiment, the recombinant adenovirus is Ad34. In other specific embodiments, the recombinant adenovirus is Ad11 or Ad37. FIGS. 27 and 28 illustrate the sequence similarity in the E1A and E4orf1 regions amongst human adenovirus species.

(103) The CR1 region of E1A has sequence and structural homology to cellular E2F, and competes with E2F-Rb interactions. The conserved E1A hydrophobic residues L43, L46 and Y47 serve as hydrophobic anchors for interaction with Rb. The mutation of L43, L46 and/or Y47 to a polar amino acid such as D, E, H, K or R would eliminate this E1A-Rb interaction. In some embodiments of the present disclosure, the recombinant adenovirus includes a Y74H mutation in E1A to disrupt the E1A-Rb interaction.

(104) E1A interacts strongly with Rb via its LXCXE motif. Since the side chains of the first leucine and central cysteine bind in a small hydrophobic pocket of the B box motif of Rb, deletions or mutations of this residues to small (such as G) or polar amino acids (such as D, E, H, K or R) would eliminate this E1A-Rb interaction. Thus, in some embodiments herein, the recombinant adenovirus includes a deletion of the LXCXE motif (LXCXE) or a C124G substitution in E1A.

(105) Both E1A residues C124 and Y47 are critical for binding to and inactivating Rb. Thus, in some embodiments, the recombinant adenovirus encodes the double mutant Y/F47H and C124G, but it is believed that any mutations made to these residues or regions (as described above) will result in weakening E1A-Rb interactions. Accordingly, mutations or deletions of any residues that disrupt the Rb-E1A interaction are contemplated herein.

(106) The deletion of residues 2-11 of E1A eliminates a p300/CBP interaction, and disrupts DP-1 interaction, further reducing the ability of E1A to upregulate E2F targets. Also contemplated herein are point mutations in E1A residues 2-11, such as glycine or alanine mutations of the conserved R2 or H3 residues, or polar residue mutations (e.g. D, E, H, K, or R) of the hydrophobic I/L/V4 from different adenovirus serotypes (see E1A alignment shown in FIG. 27) to eliminate this interaction.

(107) E4orf1 interacts with cellular proteins containing PDZ motifs via the PDZ-binding motif at its C-terminus. In some embodiments disclosed herein, the last three amino acids of E4orf1 are deleted to eliminate its PDZ-binding motif. Also contemplated herein are point mutations of the highly conserved S126 of Ad5 E4orf1 to large hydrophobic residues such as V, L, or I; or the point-mutation of V128 of Ad5 E4orf1 to polar residues such as D, E, H, K, or R. These substitutions are believed to eliminate the PDZ-binding activity of E4orf1, and eliminate this transforming function of E4orf1. The same deletions and/or mutations in E4orf1 can be made in other adenovirus serotypes, such as Ad34. Complete deletions of E4orf1 can also be introduced.

(108) Provided herein is a recombinant adenovirus, wherein the genome of the recombinant adenovirus encodes a modified E1A protein, a modified or deleted E4orf1 protein, a modified or deleted E4orf6/7 protein, or any combination thereof, and wherein the recombinant adenovirus exhibits replication defects in normal cells compared to tumor cells.

(109) In some embodiments, the genome encodes a modified E1A protein and a modified or deleted E4orf1 protein. In other embodiments, the genome encodes a modified E1A protein and a deleted E4orf6/7 protein. In yet other embodiments, the genome encodes a modified E1A protein, a modified or deleted E4orf1 protein, and a deleted E4orf6/7 protein.

(110) In some examples, the modified E1A protein of the recombinant adenovirus comprises a deletion of the LXCXE motif; a deletion of residues 2-11; a C124G substitution; a Y47H substitution; a Y47H substitution and a C124G substitution; or a Y47H substitution, a C124G substitution and a deletion of residues 2-11. These mutations are described with reference to Ad5 E1A having the amino acid sequence of SEQ ID NO: 32; however, corresponding mutations can be made in any other human adenovirus as E1A sequences are highly conserved (see FIG. 27).

(111) In some examples, the modified E4orf1 protein comprises a deletion of the PDZ-binding motif. In other examples, the E4orf1 protein comprises a deletion of the C-terminal 10 amino acids or 20 amino acids, or a mutation of D68 to A, K, R, P, F, G or L.

(112) In some examples, the modified E4orf6/7 protein comprises a mutation (such as a deletion) that abolishes or impairs its E2F binding site and/or impairs E2F interactions. In other embodiments, the modified E4orf6/7 protein comprises a modification that deletes or impairs the nuclear localization signal, which is required for efficient translocation of E2F4.

(113) In particular non-limiting examples, the genome of the recombinant adenovirus encodes a modified E1A protein comprising a deletion of the LXCXE motif and a deleted E4orf6/7 protein (see e.g., AdSyn-CO181, AdSyn-CO312, AdSyn-CO313, AdSyn-CO335, AdSyn-CO442); a modified E1A protein comprising a deletion of the LXCXE motif, a modified E4orf1 protein comprising a deletion of the PDZ-binding motif, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO285); a modified E1A protein comprising a deletion of the LXCXE motif, a deleted E4orf1 protein, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO286); a modified E1A protein comprising a C124G substitution and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO287); a modified E1A protein comprising a C124G substitution, a modified E4orf1 protein comprising a deletion of the PDZ-binding motif, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO288); a modified E1A protein comprising a C124G substitution, a deleted E4orf1 protein, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO289); a modified E1A protein comprising a deletion of residues 2-11 and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO290); a modified E1A protein comprising a deletion of residues 2-11, a modified E4orf1 protein comprising a deletion of the PDZ-binding motif, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO291); a modified E1A protein comprising a deletion of residues 2-11, a deleted E4orf1 protein, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO292); a modified E1A protein comprising a Y47H substitution and a C124G substitution, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO293); a modified E1A protein comprising a Y47H substitution and a C124G substitution, a modified E4orf1 protein comprising a deletion of the PDZ-binding motif, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO294); a modified E1A protein comprising a Y47H substitution and a C124G substitution, a deleted E4orf1 protein, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO295); a modified E1A protein comprising a Y47H substitution, a C124G substitution and a deletion of residues 2-11, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO296); a modified E1A protein comprising a Y47H substitution, a C124G substitution and a deletion of residues 2-11, a modified E4orf1 protein comprising a deletion of the PDZ-binding motif, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO297); or a modified E1A protein comprising a Y47H substitution, a C124G substitution and a deletion of residues 2-11, a deleted E4orf1 protein, and a deleted E4orf6/7 protein (see, e.g., AdSyn-CO298).

(114) In specific examples, the genome of the recombinant adenovirus is at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to any one of SEQ ID NOs: 6-8, 10-12, 14, 15, 18-20, 22-26, 30, 31 and 82-87, or the genome of the recombinant adenovirus comprises or consists of any one of SEQ ID NOs: 6-8, 10-12, 14, 15, 18-20, 22-26, 30, 31, 82-87, and 92-97 and has decreased replication in a normal (i.e., non-tumor) cell, relative to a tumor cell of the same cell type (e.g., breast cancer cell vs. normal breast cell), such as a decrease of at least 20%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98%, or at least 99%, for example as determined by comparing the number of infectious particles in normal and tumor cells.

(115) In some embodiments, the genome of the recombinant adenovirus comprises a deletion of the E3-RID/RID and E3-14.7k coding sequences.

B. Liver Detargeting Modifications

(116) The recombinant adenoviruses disclosed herein may further include modifications that detarget the virus from the liver. Ad5 hexon can bind to Factor X in the blood, which can lead to its absorption by Kuppfer cells in the liver that prevent systemic dissemination and limit inflammation. To overcome this, recombinant adenoviruses were engineered to include additional genomic modifications in the E1 and core modules that prevent uptake and expression in the liver.

(117) To test genomic modules that include these additional modifications, and to create Ad5 expression vectors for in vivo use and gene delivery, the E1A/E1 genes were deleted and replaced with an EF1 driven luciferase-GFP fusion. When injected intravenously, AdSyn-CO199 primarily accumulated in the liver as evidenced by luciferase bioluminescence (see FIG. 22).

(118) To prevent off-target expression in the liver, viruses were engineered to include binding sites in the 3UTR of E1A for micro-RNAs that are specifically expressed in the liver. In particular embodiments, miR122 was selected as the liver-specific microRNA as its expression and binding sites are conserved in both human and mouse liver cells. In some examples, two micro-RNA binding sites for liver-specific miR122 were inserted in the 3UTR of E1A to prevent any residual virus uptake in the liver inducing viral gene expression and cellular inflammatory responses. In contrast to Adsyn-CO199, AdSyn-CO200 (see FIG. 22 and Example 2 below) does not drive luciferase expression in the liver.

(119) To prevent virus uptake and sequestration in the liver through Ad5 hexon binding to Factor X, viruses were engineered with an additional mutation in hexon (E451Q) that prevents liver uptake. In contrast to AdSyn-CO199 and AdSyn-CO200, AdSyn-CO171 does not accumulate in the liver and instead is able to target other organs, in this case the spleen and lymph nodes as these were non-tumor bearing animals (FIG. 22).

(120) To enable systemic delivery of E2F selective viruses with one or more mutations in E1A, E4orf1 and/or E4orf6/7, recombinant adenoviruses were engineered to further include the liver detargeting E451Q modification in hexon (see, e.g., AdSyn-CO335 and AdSyn-CO442; see FIGS. 20 and 21 and Example 2).

(121) Other mutations to the adenovirus hexon gene are contemplated herein to prevent adenovirus accumulation in the liver. For example, a recombinant adenovirus could be detargeted from the liver by replacing the nine hypervariable regions of hexon with those from different serotypes.

(122) Provided herein are recombinant adenoviruses, wherein the genome of the recombinant adenovirus encodes a modified E1A protein, a modified or deleted E4orf1 protein, a modified or deleted E4orf6/7 protein, or any combination thereof, and further encodes a modified hexon protein, wherein the recombinant adenovirus exhibits replication defects in normal cells compared to tumor cells (see, e.g., AdSyn-CO335).

(123) In some embodiments, the modified hexon protein comprises an E451Q substitution. In specific examples, the genome of the recombinant adenovirus is at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 30, SEQ ID NO: 92 or SEQ ID NO; 97, or the genome comprises or consists of the nucleotide sequence of SEQ ID NO: 30, SEQ ID NO: 92 or SEQ ID NO; 97.

(124) Further provided herein are recombinant adenoviruses, wherein the genome of the recombinant adenovirus encodes a modified E1A protein, a modified or deleted E4orf1 protein, a modified or deleted E4orf6/7 protein, or any combination thereof, and further comprises one or more binding sites for a liver-specific microRNA, wherein the recombinant adenovirus exhibits replication defects in normal cells compared to tumor cells.

(125) In some embodiments, the one or more binding sites for the liver-specific microRNA are located in the 3-UTR of E1A. In some examples, the liver-specific microRNA is miR-122, miR-30 or miR-192.

C. Modifications for Inducible Retargeting

(126) The recombinant adenoviruses disclosed herein may be further modified for inducible re-targeting in vivo to tumor cell receptors. The ubiquitously used Ad2/5 vectors depend on coxsackie adenovirus receptor (CAR) for infection, which is present on epithelial cells, but absent on most metastatic cancers. RapAD enables rapamycin/rapalog inducible targeting of adenoviral infection to any tumor cell receptor (or any cell type) through fusion proteins (see PCT Publication No. WO 2013/138505, which is herein incorporated by reference in its entirety). The use of a flexible adapter system does not interfere with the assembly of viral capsids. An ideal re-targeting fusion protein is an antibody that has strong affinity for a specific cancer cell surface molecule. Camelids and sharks encode single-domain antibodies (sdAbs) that recognize their epitopes through a single 10 kDa variable VHH domain. Using synthetic biology, VHHs can be created that recognize specific molecules, such as EGFR and CEACAM5, which are highly upregulated on lung cancer. It has been demonstrated that rapamycin retargets synthetic adenovirus infection to EGFR on metastatic tumor cells in which CAR is downregulated.

(127) Engineered adenoviruses can also be targeted with biologically orthogonal rapalog AP21967. Although rapamycin is a rational combination with oncolytic adenoviral therapy, there may be instances in which it would be desirable to avoid the cellular and organismal effects of rapamycin. Thus, as another option for retargeting adenovirus, the rapamycin structural homolog AP21967 can be used. AP21967 can form stable heterodimers with FKBP and a mutant FRB* domain (mTOR mutation T2098L), but not with the wild-type FRB domain. In contrast to rapamycin, AP21967 does not inactivate mTOR signaling as evidenced by p70S6kinase phosphorylation, a canonical downstream substrate. However, AP21967 is still able to induce the retargeting of FRB*-fiber (but not FRB-fiber) expressing viruses to tumor cells through the FKBP-VHH fusions (FIG. 18).

(128) When the EGFR-targeted adenovirus is modified with the mutant FRB domain (FRB*), it can be induced to infect cells via EGFR with both rapamycin and AP21967 (see FIGS. 18-21 and Example 2 below).

(129) Provided herein are recombinant adenoviruses, wherein the genome of the recombinant adenovirus encodes a modified E1A protein, a modified or deleted E4orf1 protein, a modified or deleted E4orf6/7 protein, or any combination thereof, and further encodes a targeting ligand fused to an FKBP protein, and an adenovirus fiber protein fused to a wild-type FRB protein or a mutant FRB protein comprising a T2098L substitution.

(130) In some embodiments, the targeting ligand is a single domain antibody, such as a camelid VHH antibody. In particular examples, the single domain antibody is specific for EGFR, or another molecule that is upregulated on tumor cells. In non-limiting examples, the genome of the recombinant adenovirus is at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 25, SEQ ID NO: 26 or SEQ ID NO: 88, or comprises or consists of the nucleotide sequence of SEQ ID NO: 25, SEQ ID NO: 26 or SEQ ID NO: 88 (see, e.g., AdSyn-CO312, AdSyn-CO313 and AdSyn-CO205).

(131) In some embodiments, the FKBP-targeting ligand fusion proteins are accommodated in the adenovirus genome by deleting the E3-RID/RID and E3-14.7k coding sequences. However, alternative locations in the adenovirus genome are contemplated. For examples, the targeting ligand-FKBP fusion protein could also be inserted as an N-terminal fusion to E3-ADP, with a self-cleaving P2A linker sequence (see, e.g., AdSyn-CO440; SEQ ID NO: 68) or a C-terminal fusion to E1B-55k, with a self-cleaving P2A sequence.

(132) Further provided are recombinant adenoviruses, wherein the genome of the recombinant adenovirus encodes a modified E1A protein, a modified or deleted E4orf1 protein, a modified or deleted E4orf6/7 protein, or any combination thereof, and further encodes an adenovirus fiber protein fused to a mutant FRB protein comprising a T2098L substitution. In some examples, the genome further encodes a modified hexon protein comprising an E451Q substitution. In specific examples, the genome of the recombinant adenovirus is at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 31, or comprises or consists of the nucleotide sequence of SEQ ID NO: 31 (see, e.g. AdSyn-CO336).

(133) The inducibly retargeted recombinant adenoviruses described above can further include liver retargeting modifications, such as a mutant hexon protein (e.g. an E451Q substitution). Alternatively or in addition, the genome of the recombinant adenovirus can include one or more binding sites for a liver-specific microRNA (as described above).

D. Chimeric Fiber Proteins for Retargeting

(134) While the fiber proteins of Ad5 and many other serotypes have been shown to bind to the coxsackie adenovirus receptor (CAR) for cellular attachment, other serotypes have been shown to use CD46, desmoglein 2, sialic acid, or others. Thus, provided herein are recombinant adenoviruses having a genome that encodes a chimeric fiber protein, thereby targeting the recombinant virus to different cellular receptors (see FIGS. 23A-23E and Example 3 below).

(135) Provided herein are recombinant adenoviruses, wherein the genome of the recombinant adenovirus encodes a modified E1A protein, a modified or deleted E4orf1 protein, a modified or deleted E4orf6/7 protein, or any combination thereof, and further encodes a chimeric fiber protein.

(136) In some embodiments, the chimeric fiber protein comprises a fiber shaft from a first adenovirus serotype and a fiber knob from a second adenovirus serotype. In some examples, the first adenovirus serotype is Ad5 and the second adenovirus serotype is Ad3, Ad9, Ad11, Ad12, Ad34 or Ad37. In one non-limiting example, the first adenovirus serotype is Ad5 and the second adenovirus serotype is Ad34.

(137) In particular examples, the genome of the recombinant adenovirus comprises the nucleotide sequence of SEQ ID NO: 82, SEQ ID NO: 83 or SEQ ID NO: 84.

(138) The recombinant oncolytic adenoviruses expressing a chimeric fiber can further include inducible targeting and/or liver retargeting modifications as discussed above.

E. Capsid Swaps for Evading Neutralizing Antibodies

(139) The present disclosure further contemplates exploiting natural adenovirus modularity to create chimeric viruses capable of evading existing neutralizing antibodies. In particular, disclosed herein are Ad5-based viruses that have complete capsid module swaps (almost 60% of genome), which render them invisible to pre-existing antibodies and enables repeated inoculations. Capsid swapped recombinant adenoviruses are further described in Example 4 (see also FIGS. 24-26).

(140) Provided herein are recombinant adenoviruses, wherein the genome of the recombinant adenovirus encodes a modified E1A protein, a modified or deleted E4orf1 protein, a modified or deleted E4orf6/7 protein, or any combination thereof, and wherein the genome of the recombinant adenovirus encodes a capsid-swapped chimeric adenovirus. In some embodiments, the E1, E3 and E4 regions of the genome are derived from a first adenovirus serotype and the E2B, L1, L2, L3, E2A and L4 regions of the genome are derived from a second adenovirus serotype. In some examples, the E1 region of the first adenovirus serotype is modified to encode a pIX protein from the second adenovirus serotype; and/or the E3 region of the first adenovirus serotype is modified to encode Uexon and fiber proteins from the second adenovirus serotype. In particular examples, the first adenovirus serotype is Ad5 and the second adenovirus serotype is Ad3, Ad9, Ad11, Ad34 or Ad37.

(141) In particular examples, the genome of the recombinant adenovirus comprises the nucleotide sequence of SEQ ID NO: 85, or any one of SEQ ID NOs: 92-97.

(142) The recombinant oncolytic, capsid-swapped adenoviruses can further include the chimeric fiber, inducible targeting and/or liver retargeting modifications as discussed above.

F. Other Modifications

(143) The recombinant adenoviruses disclosed herein can also include additional modifications, such as to enhance tumor selectively, direct infection to specific cell types and to evade existing neutralizing antibodies.

(144) In one embodiment, the recombinant adenovirus is an EGFR-targeted oncolytic adenovirus with E1, E3, and E4 mutations together with the capsid protein penton bearing a mutation in the integrin-binding RGD motif to RGE (e.g., AdSyn-CO511; SEQ ID NO: 86). This penton mutation has been shown to reduce uptake up the virus in the spleen and attenuates the antiviral inflammatory response.

(145) In another embodiment, the recombinant oncolytic adenovirus comprises E1 and E4 mutations together with an insertion of an RGD peptide in the fiber protein (e.g., AdSyn-CO512; SEQ ID NO: 87). The RGD insertion in the fiber protein has been shown to dramatically increase infection to a wider variety of cell types, including vascular endothelial cells.

G. Recombinant Reporter Adenoviruses

(146) Further provided herein are recombinant reporter adenoviruses. In some embodiments, the genome of the recombinant adenovirus comprises a deletion of E1A and encodes EF1-luciferase (see, e.g., AdSyn-CO199, AdSyn-CO200 and AdSyn-CO171).

(147) In some embodiments, the genome of the recombinant adenovirus further comprises one or more binding sites for a liver-specific microRNA and/or encodes a modified hexon protein. In some examples, the one or more binding sites for the liver-specific microRNA are located in the 3-UTR of E1A. In specific non-limiting examples, the liver-specific microRNA is miR-122. In some examples, the modified hexon protein comprises an E451Q substitution.

(148) In specific non-limiting examples, the genome of the recombinant adenovirus at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to, or comprises or consists of, the nucleotide sequence of SEQ ID NO: 27 (AdSyn-CO199), SEQ ID NO: 28 (AdSyn-CO200), or SEQ ID NO: 29 (AdSyn-CO171).

IV. Wild-Type and Mutant Virus Sequences

(149) Further provided by the present disclosure are recombinant adenovirus genomes of the recombinant adenoviruses disclosed herein. In particular, provided are recombinant nucleic acid molecules comprising a nucleotide sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to any one of SEQ ID NOs: 1-31 and 68-98. In specific examples, the recombinant nucleic acid comprises or consists of the nucleotide sequence of any one of SEQ ID NOs: 1-31 and 68-98.

(150) Also provided are vectors comprising the recombinant adenovirus genomes. In some embodiments, provided is a vector comprising a nucleic acid molecule at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to any one of SEQ ID NOs: 1-31 and 68-98. In some examples, provided is a vector comprising a nucleic acid molecule comprising or consisting of the nucleotide sequence of any one of SEQ ID NOs: 1-31 and 68-98.

(151) Provided below are wild-type and mutant adenovirus protein sequences expressed by the recombinant adenoviruses disclosed herein.

(152) E1A Mutants

(153) In the E1A sequences below, the LXCXE motif is indicated by underline. This motif is present at amino acids 122-126 of Ad5 E1A (SEQ ID NO: 32). The Y47H and C124G substitutions are shown in bold.

(154) TABLE-US-00002 Ad5E1A (SEQIDNO:32) MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLD VTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPE QPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGEEFVLDYVEHP GHGCRSCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEP ARPTRRPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLC PIKPVAVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP Ad5E1ALXCXE (SEQIDNO:33) MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLD VTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPE QPEQRALGPVSMPNLVPEVIDAGFPPSDDEDEEGEEFVLDYVEHPGHGCR SCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPTR RPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPV AVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP Ad5E1AC124G (SEQIDNO:34) MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLD VTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPE QPEQRALGPVSMPNLVPEVIDLTGHEAGFPPSDDEDEEGEEFVLDYVEHP GHGCRSCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEP ARPTRRPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLC PIKPVAVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP Ad5E1A2-11 (SEQIDNO:35) MEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEA VSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVS MPNLVPEVIDLTCHEAGFPPSDDEDEEGEEFVLDYVEHPGHGCRSCHYHR RNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPTRRPKMAP AILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGG RRQAVECIEDLLNEPGQPLDLSCKRPRP Ad5E1AY47HC124G (SEQIDNO:36) MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELHDLD VTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPE QPEQRALGPVSMPNLVPEVIDLTGHEAGFPPSDDEDEEGEEFVLDYVEHP GHGCRSCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEP ARPTRRPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLC PIKPVAVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP Ad5E1A2-11Y47HC124G (SEQIDNO:37) MEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELHDLDVTAPEDPNEEA VSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVS MPNLVPEVIDLTGHEAGFPPSDDEDEEGEEFVLDYVEHPGHGCRSCHYHR RNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPTRRPKMAP AILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGG RRQAVECIEDLLNEPGQPLDLSCKRPRP
Ad5 E4orf1 and E4orf6/7

(155) The PDZ-binding motif at the C-terminus of Ad5 E4orf1 (residues 126-128 of SEQ ID NO: 38) is underlined.

(156) TABLE-US-00003 Ad5E4orf1 (SEQIDNO:38) MAAAVEALYVVLEREGAILPRQEGFSGVYVFFSPINFVIPPMGAVMLSLR LRVCIPPGYFGRFLALTDVNQPDVFTESYIMTPDMTEELSVVLFNHGDQF FYGHAGMAVVRLMLIRVVFPVVRQASNV Ad5E4orf1PDZb (SEQIDNO:39) MAAAVEALYVVLEREGAILPRQEGFSGVYVFFSPINFVIPPMGAVMLSLR LRVCIPPGYFGRFLALTDVNQPDVFTESYIMTPDMTEELSVVLFNHGDQF FYGHAGMAVVRLMLIRVVFPVVRQA Ad5E4orf6/7 (SEQIDNO:40) MTTSGVPFGMTLRPTRSRLSRRTPYSRDRLPPFETETRATILEDHPLLPE CNTLTMHNAWTSPSPPVKQPQVGQQPVAQQLDSDMNLSELPGEFINITDE RLARQETVWNITPKNMSVTHDMMLFKASRGERTVYSVCWEGGGRLNTRVL

(157) Recombinant adenoviruses having a genome encoding a modified E4orf6/7 protein that eliminates or impairs binding to E2F, or deletes or impairs the nuclear localization signal are contemplated herein. In some examples, the modified E4orf6/7 protein comprises a deletion of about 60, about 50, about 40, about 30, about 20 or about 10 amino acids at the C-terminus to delete/impair the E2F binding site. In other examples, the E4orf6/7 protein comprises a deletion, a frameshift or an insertion in the C-terminal 10 amino acids, or a deletion of 33 amino acids from the C-terminal third of the protein that abolish or impair E2F binding. In some embodiments, the mutations comprise amino acids 81-91 that impair the E2F interactions.

(158) In other examples, the modified E4orf6/7 protein comprises an N-terminal deletion of 58 amino acids to abolish the nuclear localization sequence, which is required for efficient translocation of E2F4. There are eight arginine residues located between amino acids 13 and 38 of Ad2 and Ad5 E4orf6/7, which equates with greater than 25% arginine content for this region. The overall clustering of arginine residues in the N-terminus of E4orf6 is maintained in other adenovirus serotypes. Mutations that substitute arginine residues 16, 18, 21, 22, 27 and/or 29 for alanine (or other appropriate residues to abolish nuclear localization through this region) are contemplated.

(159) In other examples, the modified E4orf6/7 protein comprises one or more modifications to eliminate or inhibit the ability of E4orf6/7 to induce E2F double site occupancy. Specific, non-limiting examples include a mutation of F125 to proline, alanine, lysine, aspartic acid or glutamic acid; or a mutation of D121 to P, A, K, R, G, F.

(160) Other E4orf6/7 mutations include: T133A, R101A, Q105P or any mutations that prevent E2F single site occupancy; M84N or P, G, K, L, H and/or E93A, or K, P, G, R, L, M that disrupt an alpha helix and prevent E2F binding. Other contemplated mutations include T133Q or A, K, G, P, L, H; G141L, P, K H, F, A; or V149N, K, P, H, G, E, D.

(161) Fiber Sequences

(162) In the recombinant fiber sequences below, the FRB sequence is underlined. The mutation present in FRB* is shown in bold.

(163) TABLE-US-00004 Ad5fiber (SEQIDNO:41) MKRARPSEDTFNPVYPYDTETGPPTVPFLTPPFVSPNGFQESPPGVLSLR LSEPLVTSNGMLALKMGNGLSLDEAGNLTSQNVTTVSPPLKKTKSNINLE ISAPLTVTSEALTVAAAAPLMVAGNTLTMQSQAPLTVHDSKLSIATQGPL TVSEGKLALQTSGPLTTTDSSTLTITASPPLTTATGSLGIDLKEPIYTQN GKLGLKYGAPLHVTDDLNTLTVATGPGVTINNTSLQTKVTGALGFDSQGN MQLNVAGGLRIDSQNRRLILDVSYPFDAQNQLNLRLGQGPLFINSAHNLD INYNKGLYLFTASNNSKKLEVNLSTAKGLMFDATAIAINAGDGLEFGSPN APNTNPLKTKIGHGLEFDSNKAMVPKLGTGLSFDSTGAITVGNKNNDKLT LWTTPAPSPNCRLNAEKDAKLTLVLTKCGSQILATVSVLAVKGSLAPISG TVQSAHLIIRFDENGVLLNNSFLDPEYWNFRNGDLTEGTAYTNAVGFMPN LSAYPKSHGKTAKSNIVSQVYLNGDKTKPVTLTITLNGTQETGDTTPSAY SMSFSWDWSGHNYINEIFATSSYTFSYIAQE Ad5FRB-fiber (SEQIDNO:42) MKRARPSEDTFNPVYPYDTETGPPTVPFLTPPFVSPNGFQESPPGVLSLR LSEPLVTSNGMLALKMGNGLSLDEAGNLTSQNVTTVSPPLKKTKSNINLE ISAPLTVTSEALTVAAAAPLMVAGNTLTMQSQAPLTVHDSKLSIATQGPL TVSEGKLALQTSGPLTTTDSSTLTITASPPLTTATGSLGIDLKEPIYTQN GKLGLKYGAPLHVTDDLNTLTVATGPGVTINNTSLQTKVTGALGFDSQGN MQLNVAGGLRIDSQNRRLILDVSYPFDAQNQLNLRLGQGPLFINSAHNLD INYNKGLYLFTASNNSKKLEVNLSTAKGLMFDATAIAINAGDGLEFGSPN APNTNPLKTKIGHGLEFDSNKAMVPKLGTGLSFDSTGAITVGNKNNDKLT LWTTPAPSPNCRLNAEKDAKLTLVLTKCGSQILATVSVLAVKGSLAPISG TVQSAHLIIRFDENGVLLNNSFLDPEYWNFRNGDLTEGTAYTNAVGFMPN LSAYPKSHGKTAKSNIVSQVYLNGDKTKPVTLTITLNGTQETGDTTEMWH EGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDL MEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQPSAYSMSFSWDWSG HNYINEIFATSSYTFSYIAQE Ad5FRB*-fiber (SEQIDNO:43) MKRARPSEDTFNPVYPYDTETGPPTVPFLTPPFVSPNGFQESPPGVLSLR LSEPLVTSNGMLALKMGNGLSLDEAGNLTSQNVTTVSPPLKKTKSNINLE ISAPLTVTSEALTVAAAAPLMVAGNTLTMQSQAPLTVHDSKLSIATQGPL TVSEGKLALQTSGPLTTTDSSTLTITASPPLTTATGSLGIDLKEPIYTQN GKLGLKYGAPLHVTDDLNTLTVATGPGVTINNTSLQTKVTGALGFDSQGN MQLNVAGGLRIDSQNRRLILDVSYPFDAQNQLNLRLGQGPLFINSAHNLD INYNKGLYLFTASNNSKKLEVNLSTAKGLMFDATAIAINAGDGLEFGSPN APNTNPLKTKIGHGLEFDSNKAMVPKLGTGLSFDSTGAITVGNKNNDKLT LWTTPAPSPNCRLNAEKDAKLTLVLTKCGSQILATVSVLAVKGSLAPISG TVQSAHLIIRFDENGVLLNNSFLDPEYWNFRNGDLTEGTAYTNAVGFMPN LSAYPKSHGKTAKSNIVSQVYLNGDKTKPVTLTITLNGTQETGDTTEMWH EGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDL MEAQEWCRKYMKSGNVKDLLQAWDLYYHVFRRISKQPSAYSMSFSWDWSG HNYINEIFATSSYTFSYIAQE
Targeting Ligand Sequences

(164) TABLE-US-00005 EGFRVHH-GS-FKBP MAVQLVESGGGSVQAGGSLRLTCAASGRTSRSYGMGWFRQAPGKEREFVS GISWRGDSTGYADSVKGRFTISRDNAKNTVDLQMNSLRPEDTAIYYCAAA AGSTWYGTLYEYDYWGQGTQVTVSSGSGSGSTGVQVETISPGDGRTFPKR GQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSV GQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL(SEQIDNO: 44;FKBP12sequenceisunderlined)
Hexon Sequences

(165) TABLE-US-00006 Ad5hexon MATPSMMPQWSYMHISGQDASEYLSPGLVQFARATETYFSLNNKFRNPTV APTHDVTTDRSQRLTLRFIPVDREDTAYSYKARFTLAVGDNRVLDMASTY FDIRGVLDRGPTFKPYSGTAYNALAPKGAPNPCEWDEAATALEINLEEED DDNEDEVDEQAEQQKTHVFGQAPYSGINITKEGIQIGVEGQTPKYADKTF QPEPQIGESQWYETEINHAAGRVLKKTTPMKPCYGSYAKPTNENGGQGIL VKQQNGKLESQVEMQFFSTTEATAGNGDNLTPKVVLYSEDVDIETPDTHI SYMPTIKEGNSRELMGQQSMPNRPNYIAFRDNFIGLMYYNSTGNMGVLAG QASQLNAVVDLQDRNTELSYQLLLDSIGDRTRYFSMWNQAVDSYDPDVRI IENHGTEDELPNYCFPLGGVINTETLTKVKPKTGQENGWEKDATEFSDKN EIRVGNNFAMEINLNANLWRNFLYSNIALYLPDKLKYSPSNVKISDNPNT YDYMNKRVVAPGLVDCYINLGARWSLDYMDNVNPFNHHRNAGLRYRSMLL GNGRYVPFHIQVPQKFFAIKNLLLLPGSYTYEWNFRKDVNMVLQSSLGND LRVDGASIKFDSICLYATFFPMAHNTASTLEAMLRNDTNDQSFNDYLSAA NMLYPIPANATNVPISIPSRNWAAFRGWAFTRLKTKETPSLGSGYDPYYT YSGSIPYLDGTFYLNHTFKKVAITFDSSVSWPGNDRLLTPNEFEIKRSVD GEGYNVAQCNMTKDWFLVQMLANYNIGYQGFYIPESYKDRMYSFFRNFQP MSRQVVDDTKYKDYQQVGILHQHNNSGFVGYLAPTMREGQAYPANFPYPL IGKTAVDSITQKKFLCDRTLWRIPFSSNFMSMGALTDLGQNLLYANSAHA LDMTFEVDPMDEPTLLYVLFEVFDVVRVHRPHRGVIETVYLRTPFSAGNA TT(SEQIDNO:45) Ad5hexonE451Q MATPSMMPQWSYMHISGQDASEYLSPGLVQFARATETYFSLNNKFRNPTV APTHDVTTDRSQRLTLRFIPVDREDTAYSYKARFTLAVGDNRVLDMASTY FDIRGVLDRGPTFKPYSGTAYNALAPKGAPNPCEWDEAATALEINLEEED DDNEDEVDEQAEQQKTHVFGQAPYSGINITKEGIQIGVEGQTPKYADKTF QPEPQIGESQWYETEINHAAGRVLKKTTPMKPCYGSYAKPTNENGGQGIL VKQQNGKLESQVEMQFFSTTEATAGNGDNLTPKVVLYSEDVDIETPDTHI SYMPTIKEGNSRELMGQQSMPNRPNYIAFRDNFIGLMYYNSTGNMGVLAG QASQLNAVVDLQDRNTELSYQLLLDSIGDRTRYFSMWNQAVDSYDPDVRI IENHGTEDELPNYCFPLGGVINTETLTKVKPKTGQENGWEKDATEFSDKN QIRVGNNFAMEINLNANLWRNFLYSNIALYLPDKLKYSPSNVKISDNPNT YDYMNKRVVAPGLVDCYINLGARWSLDYMDNVNPFNHHRNAGLRYRSMLL GNGRYVPFHIQVPQKFFAIKNLLLLPGSYTYEWNFRKDVNMVLQSSLGND LRVDGASIKFDSICLYATFFPMAHNTASTLEAMLRNDTNDQSFNDYLSAA NMLYPIPANATNVPISIPSRNWAAFRGWAFTRLKTKETPSLGSGYDPYYT YSGSIPYLDGTFYLNHTFKKVAITFDSSVSWPGNDRLLTPNEFEIKRSVD GEGYNVAQCNMTKDWFLVQMLANYNIGYQGFYIPESYKDRMYSFFRNFQP MSRQVVDDTKYKDYQQVGILHQHNNSGFVGYLAPTMREGQAYPANFPYPL IGKTAVDSITQKKFLCDRTLWRIPFSSNFMSMGALTDLGQNLLYANSAHA LDMTFEVDPMDEPTLLYVLFEVFDVVRVHRPHRGVIETVYLRTPFSAGNA TT(SEQIDNO:46;theE451Qsubstitutionisshown inboldunderline)
E3 Sequences

(166) TABLE-US-00007 Ad5E3-RID (SEQIDNO:65) MIPRVFILLTLVALFCACSTLAAVSHIEVDCIPAFTVYLLYGFVTLTLIC SLITVVIAFIQCIDWVCVRFAYLRHHPQYRDRTIAELLRIL Ad5E3-RID (SEQIDNO:66) MKFTVTFLLIICTLSAFCSPTSKPQRHISCRFTRIWNIPSCYNEKSDLSE AWLYAIISVMVFCSTILALAIYPYLDIGWNAIDAMNHPTFPAPAMLPLQQ VVAGGFVPANQPRPPSPTPTEISYFNLTGGDD Ad5E3-14.7K (SEQIDNO:67) MTDTLDLEMDGIITEQRLLERRRAAAEQQRMNQELQDMVNLHQCKRGIFC LVKQAKVTYDSNTTGHRLSYKLPTKRQKLVVMVGEKPITITQHSVETEGC IHSPCQGPEDLCTLIKTLCGLKDLIPFN

V. Pharmaceutical Compositions

(167) Provided herein are compositions comprising a recombinant adenovirus (or one or more nucleic acids or vectors encoding the recombinant adenovirus). The compositions are, optionally, suitable for formulation and administration in vitro or in vivo. Optionally, the compositions comprise one or more of the provided agents and a pharmaceutically acceptable carrier. Suitable carriers and their formulations are described in Remington: The Science and Practice of Pharmacy, 22.sup.nd Edition, Loyd V. Allen et al., editors, Pharmaceutical Press (2012). Pharmaceutically acceptable carriers include materials that are not biologically or otherwise undesirable, i.e., the material is administered to a subject without causing undesirable biological effects or interacting in a deleterious manner with the other components of the pharmaceutical composition in which it is contained. If administered to a subject, the carrier is optionally selected to minimize degradation of the active ingredient and to minimize adverse side effects in the subject.

(168) The recombinant viruses (or one or more nucleic acids or vectors encoding the recombinant adenovirus) are administered in accord with known methods, such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, intratumoral or inhalation routes. The administration may be local or systemic. The compositions can be administered via any of several routes of administration, including topically, orally, parenterally, intravenously, intra-articularly, intraperitoneally, intramuscularly, subcutaneously, intracavity, transdermally, intrahepatically, intracranially, nebulization/inhalation, or by installation via bronchoscopy. Thus, the compositions are administered in a number of ways depending on whether local or systemic treatment is desired, and on the area to be treated.

(169) In some embodiments, the compositions for administration will include a recombinant adenovirus (or recombinant genome) as described herein dissolved in a pharmaceutically acceptable carrier, preferably an aqueous carrier. A variety of aqueous carriers can be used, e.g., buffered saline and the like. These solutions are sterile and generally free of undesirable matter. These compositions may be sterilized by conventional, well known sterilization techniques. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like. The concentration of active agent in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the subject's needs.

(170) Pharmaceutical formulations, particularly, of the recombinant viruses can be prepared by mixing the recombinant adenovirus (or one or more nucleic acids encoding the recombinant adenovirus) having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers. Such formulations can be lyophilized formulations or aqueous solutions.

(171) Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations used. Acceptable carriers, excipients or stabilizers can be acetate, phosphate, citrate, and other organic acids; antioxidants (e.g., ascorbic acid) preservatives, low molecular weight polypeptides; proteins, such as serum albumin or gelatin, or hydrophilic polymers such as polyvinylpyllolidone; and amino acids, monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents; and ionic and non-ionic surfactants (e.g., polysorbate); salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants. The recombinant adenovirus (or one or more nucleic acids encoding the recombinant adenovirus) can be formulated at any appropriate concentration of infectious units.

(172) Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the recombinant adenovirus suspended in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin; (c) suspensions in an appropriate liquid; and (d) suitable emulsions. Tablet forms can include one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, microcrystalline cellulose, gelatin, colloidal silicon dioxide, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes, disintegrating agents, and pharmaceutically compatible carriers. Lozenge forms can comprise the active ingredient in a flavor, e.g., sucrose, as well as pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.

(173) The recombinant adenovirus (or one or more nucleic acids encoding the recombinant adenovirus), alone or in combination with other suitable components, can be made into aerosol formulations (i.e., they can be nebulized) to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.

(174) Formulations suitable for parenteral administration, such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intratumoral, intradermal, intraperitoneal, and subcutaneous routes, include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. In the provided methods, compositions can be administered, for example, by intravenous infusion, orally, topically, intraperitoneally, intravesically intratumorally, or intrathecally. Parenteral administration, intratumoral administration, and intravenous administration are the preferred methods of administration. The formulations of compounds can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials.

(175) Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. Cells transduced or infected by adenovirus or transfected with nucleic acids for ex vivo therapy can also be administered intravenously or parenterally as described above.

(176) The pharmaceutical preparation is preferably in unit dosage form. In such form the preparation is subdivided into unit doses containing appropriate quantities of the active component. Thus, the pharmaceutical compositions can be administered in a variety of unit dosage forms depending upon the method of administration. For example, unit dosage forms suitable for oral administration include, but are not limited to, powder, tablets, pills, capsules and lozenges.

(177) In some embodiments, the compositions include at least two different recombinant adenoviruses, such as recombinant adenoviruses that bind different cellular receptors. For example, at least one of the recombinant adenoviruses in the composition could express a chimeric fiber protein. Alternatively, the recombinant adenoviruses could target different cellular receptors by encoding targeting ligand-FKBP fusion proteins in which the targeting ligand different between the viruses in the composition. In some examples, the composition includes two, three, four, five or six different recombinant adenoviruses.

VI. Methods of Treatment

(178) The recombinant adenoviruses compositions disclosed herein can be administered for therapeutic or prophylactic treatment. In particular, provided are methods of inhibiting tumor cell viability in a subject, inhibiting tumor progression in a subject, reducing tumor volume in a subject and/or treating cancer in a subject. The methods include administering a therapeutically effective amount of a recombinant adenovirus (or composition thereof) to the subject. As described throughout, the adenovirus or pharmaceutical composition is administered in any number of ways including, but not limited to, intravenously, intravascularly, intrathecally, intramuscularly, subcutaneously, intraperitoneally, or orally. Optionally, the method further comprising administering to the subject one or more additional therapeutic agents. In some embodiments, the therapeutic agent is a chemotherapeutic agent. In other embodiments, the therapeutic agent is an immune modulator. In yet other embodiments, the therapeutic agent is a CDK inhibitor, such as a CDK 4 inhibitor.

(179) In some embodiments, the cancer or tumor is a lung, prostate, colorectal, breast, thyroid, renal, or liver cancer or tumor, or is a type of leukemia. In some cases, the cancer is metastatic. In some examples, the tumor is a tumor of the mammary, pituitary, thyroid, or prostate gland; a tumor of the brain, liver, meninges, bone, ovary, uterus, or cervix; monocytic or myelogenous leukemia; adenocarcinoma, adenoma, astrocytoma, bladder tumor, brain tumor, Burkitt's lymphoma, breast carcinoma, cervical carcinoma, colon carcinoma, kidney carcinoma, liver carcinoma, lung carcinoma, ovarian carcinoma, pancreatic carcinoma, prostate carcinoma, rectal carcinoma, skin carcinoma, stomach carcinoma, testis carcinoma, thyroid carcinoma, chondrosarcoma, choriocarcinoma, fibroma, fibrosarcoma, glioblastoma, glioma, hepatoma, histiocytoma, leiomyoblastoma, leiomyosarcoma, lymphoma, liposarcoma cell, mammary tumor, medulloblastoma, myeloma, plasmacytoma, neuroblastoma, neuroglioma, osteogenic sarcoma, pancreatic tumor, pituitary tumor, retinoblastoma, rhabdomyosarcoma, sarcoma, testicular tumor, thymoma, or Wilms tumor. Tumors include both primary and metastatic solid tumors, including carcinomas of breast, colon, rectum, lung, oropharynx, hypopharynx, esophagus, stomach, pancreas, liver, gallbladder and bile ducts, small intestine, urinary tract (including kidney, bladder and urothelium), female genital tract, (including cervix, uterus, and ovaries as well as choriocarcinoma and gestational trophoblastic disease), male genital tract (including prostate, seminal vesicles, testes and germ cell tumors), endocrine glands (including the thyroid, adrenal, and pituitary glands), and skin, as well as hemangiomas, melanomas, sarcomas (including those arising from bone and soft tissues as well as Kaposi's sarcoma) and tumors of the brain, nerves, eyes, and meninges (including astrocytomas, gliomas, glioblastomas, retinoblastomas, neuromas, neuroblastomas, Schwannomas, and meningiomas). In some aspects, solid tumors may be treated that arise from hematopoietic malignancies such as leukemias (i.e. chloromas, plasmacytomas and the plaques and tumors of mycosis fungoides and cutaneous T-cell lymphoma/leukemia) as well as in the treatment of lymphomas (both Hodgkin's and non-Hodgkin's lymphomas). In addition, treatments may be useful in the prevention of metastases from the tumors described herein.

(180) In therapeutic applications, recombinant adenoviruses or compositions thereof are administered to a subject in a therapeutically effective amount or dose. Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health. Single or multiple administrations of the compositions may be administered depending on the dosage and frequency as required and tolerated by the patient. A patient or subject includes both humans and other animals, particularly mammals. Thus, the methods are applicable to both human therapy and veterinary applications.

(181) An effective amount of an adenovirus having a modified sequence is determined on an individual basis and is based, at least in part, on the particular recombinant adenovirus used; the individual's size, age, gender; and the size and other characteristics of the proliferating cells. For example, for treatment of a human, at least 10.sup.3 plaque forming units (PFU) of a recombinant virus is used, such as at least 10.sup.4, at least 10.sup.5, at least 10.sup.6, at least 10.sup.7, at least 10.sup.8, at least 10.sup.9, at least 10.sup.10, at least 10.sup.11, or at least 10.sup.12 PFU, for example approximately 10.sup.3 to 10.sup.12 PFU of a recombinant virus is used, depending on the type, size and number of proliferating cells or neoplasms present. The effective amount can be from about 1.0 pfu/kg body weight to about 10.sup.15 pfu/kg body weight (e.g., from about 10.sup.2 pfu/kg body weight to about 10.sup.13 pfu/kg body weight). A recombinant adenovirus is administered in a single dose or in multiple doses (e.g., two, three, four, six, or more doses). Multiple doses can be administered concurrently or consecutively (e.g., over a period of days or weeks).

(182) In some embodiments, the provided methods include administering to the subject one or more additional therapeutic agents, such as an anti-cancer agent or other therapeutic treatment (such as surgical resection of the tumor). Exemplary anti-cancer agents include, but are not limited to, chemotherapeutic agents, such as, for example, mitotic inhibitors, alkylating agents, antimetabolites, intercalating antibiotics, growth factor inhibitors, cell cycle inhibitors, enzymes, topoisomerase inhibitors, anti-survival agents, biological response modifiers, anti-hormones (e.g. anti-androgens), anti-angiogenesis agents and CDK inhibitors. Other anti-cancer treatments include radiation therapy and other antibodies that specifically target cancer cells.

(183) Non-limiting examples of alkylating agents include nitrogen mustards (such as mechlorethamine, cyclophosphamide, melphalan, uracil mustard or chlorambucil), alkyl sulfonates (such as busulfan), nitrosoureas (such as carmustine, lomustine, semustine, streptozocin, or dacarbazine).

(184) Non-limiting examples of antimetabolites include folic acid analogs (such as methotrexate), pyrimidine analogs (such as 5-FU or cytarabine), and purine analogs, such as mercaptopurine or thioguanine.

(185) Non-limiting examples of natural products include vinca alkaloids (such as vinblastine, vincristine, or vindesine), epipodophyllotoxins (such as etoposide or teniposide), antibiotics (such as dactinomycin, daunorubicin, doxorubicin, bleomycin, plicamycin, or mitomycin C), and enzymes (such as L-asparaginase).

(186) Non-limiting examples of miscellaneous agents include platinum coordination complexes (such as cis-diamine-dichloroplatinum II also known as cisplatin), substituted ureas (such as hydroxyurea), methyl hydrazine derivatives (such as procarbazine), and adrenocrotical suppressants (such as mitotane and aminoglutethimide).

(187) Non-limiting examples of hormones and antagonists include adrenocorticosteroids (such as prednisone), progestins (such as hydroxyprogesterone caproate, medroxyprogesterone acetate, and magestrol acetate), estrogens (such as diethylstilbestrol and ethinyl estradiol), antiestrogens (such as tamoxifen), and androgens (such as testerone proprionate and fluoxymesterone).

(188) Examples of the most commonly used chemotherapy drugs include Adriamycin, Alkeran, Ara-C, BiCNU, Busulfan, CCNU, Carboplatinum, Cisplatinum, Cytoxan, Daunorubicin, DTIC, 5-FU, Fludarabine, Hydrea, Idarubicin, Ifosfamide, Methotrexate, Mithramycin, Mitomycin, Mitoxantrone, Nitrogen Mustard, Taxol (or other taxanes, such as docetaxel), Velban, Vincristine, VP-16, while some more newer drugs include Gemcitabine (Gemzar), Herceptin, Irinotecan (Camptosar, CPT-11), Leustatin, Navelbine, Rituxan STI-571, Taxotere, Topotecan (Hycamtin), Xeloda (Capecitabine), Zevelin and calcitriol.

(189) Non-limiting examples of immunomodulators that can be used include AS-101 (Wyeth-Ayerst Labs.), bropirimine (Upjohn), gamma interferon (Genentech), GM-CSF (granulocyte macrophage colony stimulating factor; Genetics Institute), IL-2 (Cetus or Hoffman-LaRoche), human immune globulin (Cutter Biological), IMREG (from Imreg of New Orleans, La.), SK&F 106528, and TNF (tumor necrosis factor; Genentech).

(190) Another common treatment for some types of cancer is surgical treatment, for example surgical resection of the cancer or a portion of it. Another example of a treatment is radiotherapy, for example administration of radioactive material or energy (such as external beam therapy) to the tumor site to help eradicate the tumor or shrink it prior to surgical resection.

(191) CDK (Cyclin-dependent kinase) inhibitors are agents that inhibit the function of CDKs. Non-limiting examples of CDK inhibitors for use in the provided methods include AG-024322, AT7519, AZD5438, flavopiridol, indisulam, P1446A-05, PD-0332991, and P276-00 (see e.g., Lapenna et al., Nature Reviews, 8:547-566, 2009). Other CDK inhibitors include LY2835219, Palbociclib, LEE011 (Novartis), pan-CDK inhibitor AT7519, seliciclib, CYC065, butyrolactone I, hymenialdisine, SU9516, CINK4, PD0183812 or fascaplysin.

(192) In some examples, the CDK inhibitor is a broad-range inhibitor (such as flavopiridol, olomoucine, roscovitine, kenpaullone, SNS-032, AT7519, AG-024322, (S)-Roscovitine or R547). In other examples, the CDK inhibitor is a specific inhibitor (such as fascaplysin, ryuvidine, purvalanol A, NU2058, BML-259, SU 9516, PD0332991 or P-276-00).

(193) The choice of agent and dosage can be determined readily by one of skill in the art based on the given disease being treated. Combinations of agents or compositions can be administered either concomitantly (e.g., as a mixture), separately but simultaneously (e.g., via separate intravenous lines) or sequentially (e.g., one agent is administered first followed by administration of the second agent). Thus, the term combination is used to refer to concomitant, simultaneous or sequential administration of two or more agents or compositions.

(194) According to the methods disclosed herein, the subject is administered an effective amount of one or more of the agents provided herein. The effective amount is defined as any amount necessary to produce a desired physiologic response (e.g., killing of a cancer cell). Therapeutic agents are typically administered at the initial dosage of about 0.001 mg/kg to about 1000 mg/kg daily. A dose range of about 0.01 mg/kg to about 500 mg/kg, or about 0.1 mg/kg to about 200 mg/kg, or about 1 mg/kg to about 100 mg/kg, or about 10 mg/kg to about 50 mg/kg, can be used. The dosages, however, may be varied depending upon the requirements of the subject, the severity of the condition being treated, and the compound being employed. For example, dosages can be empirically determined considering the type and stage of cancer diagnosed in a particular subject. The dose administered to a subject, in the context of the provided methods should be sufficient to affect a beneficial therapeutic response in the patient over time. Determination of the proper dosage for a particular situation is within the skill of the practitioner. Thus, effective amounts and schedules for administering the agent may be determined empirically by one skilled in the art. The dosage should not be so large as to cause substantial adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like. The dosage can be adjusted by the individual physician in the event of any contraindications. Guidance can be found in the literature for appropriate dosages for given classes of pharmaceutical products.

(195) Provided herein is a method of inhibiting tumor cell viability by contacting the tumor cell with a recombinant adenovirus, or composition thereof, as disclosed herein. In some embodiments, the method is an in vitro method. In other embodiments, the method is an in vivo method and contacting the tumor cell comprises administering the recombinant adenovirus or composition to a subject with a tumor.

(196) Further provided is a method of inhibiting tumor progression or reducing tumor volume in a subject, by administering to the subject a therapeutically effective amount of a recombinant adenovirus (or composition thereof) disclosed herein.

(197) Also provided is a method of treating cancer in a subject, by administering to the subject a therapeutically effective amount of a recombinant adenovirus (or composition thereof) disclosed herein.

(198) Further provided is a method of reducing tumor volume in a subject by administering to the subject (i) a therapeutically effective amount of a rapamycin/rapalog inducible retargeted recombinant adenovirus; and (ii) rapamycin or an analog thereof. Also provided is a method of treating cancer in a subject by administering to the subject (i) a therapeutically effective amount of a rapamycin/rapalog inducible retargeted recombinant adenovirus; and (ii) rapamycin or an analog thereof.

(199) In some embodiments, the rapamycin or rapamycin analog is administered at a dose of about 0.1 mg/kg to about 2.0 mg/kg. In other embodiments, the rapamycin is administered at a dose of about 0.1 mg/kg to about 0.5 mg/kg. In some examples, the rapamycin is administered at a dose of about 0.1 mg/kg, 0.5 mg/kg, 1.0 mg/kg, 1.5 mg/kg or 2.0 mg/kg.

(200) In some embodiments, the rapamycin or rapamycin analog is administered at a dose of about 1 to 15 mg/m.sup.2, such as about 3 to 12 mg/m.sup.2, or about 5 to 10 mg/m.sup.2. In some examples, the rapamycin or rapamycin analog is administered at a dose of about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14 or about 15 mg/m.sup.2.

(201) In some embodiments, the rapamycin or rapamycin analog is administered at a dose that does not cause substantial immunosuppression in the subject. Administration of rapamycin or an analog thereof at a dose that does not cause substantial immunosuppression refers to the dose that is less than or equivalent to the effective concentration 25 (EC.sub.25) for a particular subject. One of skill in the art is capable of determining a dose of rapamycin or an analog thereof that does not cause substantial immunosuppression in a subject (see, e.g., Schubert et al., Am J Transplant 4:767-773, 2004). In some examples, the EC.sub.25 is about 1 ng/mL to about 15 ng/mL, such as about 3 ng/mL to about 10 ng/mL. In non-limiting examples, the EC.sub.25 is about 1 ng/mL, about 2 ng/mL, about 3 ng/mL, about 4 ng/mL, about 5 ng/mL, about 6 ng/mL, about 7 ng/mL, about 8 ng/mL, about 9 ng/mL, about 10 ng/mL, about 11 ng/mL, about 12 ng/mL, about 13 ng/mL, about 14 ng/mL or about 15 ng/mL.

(202) In some embodiments, the genome of the retargeted adenovirus encodes a targeting ligand fused to an FKBP, and an adenovirus fiber protein fused to a wild-type FKBP-rapamycin binding (FRB) protein or a mutant FRB protein comprising a T2098L substitution. In some examples, the targeting ligand is a single domain antibody, such as a single domain antibody specific for EGFR. In particular non-limiting examples, the genome of the recombinant adenovirus comprises the nucleotide sequence of AdSyn-CO335 (SEQ ID NO: 30), AdSyn-CO335B-K (SEQ ID NO: 92) or AdSyn-CO335B-TK (SEQ ID NO: 97).

(203) In some embodiments of the methods, the tumor or cancer is characterized by deregulation of the E2F pathway. In some embodiments, the tumor or cancer is a lung, prostate, colorectal, breast, thyroid, renal or liver tumor or cancer, or a leukemia.

(204) In some embodiments, the methods further include treating the subject with an additional therapeutic agent, such as a chemotherapeutic agent, an immune modulator or a CDK inhibitor, for example a CDK4 inhibitor.

(205) The following examples are provided to illustrate certain particular features and/or embodiments. These examples should not be construed to limit the disclosure to the particular features or embodiments described.

EXAMPLES

Example 1: Oncolytic Adenoviruses that Selectively Replicate in Tumor Cells with Deregulated E2F Activity

(206) Modified adenoviruses were made with the below referenced components, according to the methods described in PCT Publication No. WO 2012/024351, which is incorporated herein by reference. Gateway pDONR vectors were employed. From human Ad5 DNA, the E1 module was obtained by PCR and inserted into the vector pDONR P1P4 using SLIC. The pDONR P1P4 vector backbone including attL1 and attL4 recombination sites was amplified using PCR and combined with the Ad5 E1 module by SLIC. The E3 module was obtained by PCR to generate a product flanked by attB5 and attB3r recombination sites. The product was inserted into the pDONR P5P3r vector by gateway BP reaction. The E4 module was obtained by PCR to generate a product flanked by attB3 and attB2 recombination sites. The product was inserted into the pDONR P3P2 vector by gateway BP reaction. The attR5-ccdB-Cm(r)-attR2 fragment from the pDONR P5P2 vector was amplified by PCR and inserted into the Adsembly DEST vector (see MultiSite Gateway Pro Plus, Cat #12537-100; and Sone et al., J Biotechnol 136(3-4):113-121, 2008). The Adsembly method is described in PCT Publication No. WO 2012/024351, herein incorporated by reference in its entirety.

(207) The vector backbone for the Adsembly DEST vector is composed of parts from three different sources. The Amp(r) cassette and lacZ gene were amplified from plasmid pUC19. This was combined with the p15A origin of replication, obtained from plasmid pSB3K5-I52002, part of the BioBricksiGEM 2007 parts distribution. The p15A ori, which maintains plasmids at a lower (10-12) copy number is necessary to reduce E1 toxicity. Lastly, in order to create a self-excising virus, the mammalian expression cassette for the enzyme ISceI was PCR amplified from plasmid pAdZ5-CV5-E3+. This cassette was cloned into the vector backbone to create the vector called p15A-SceI. This is the vector used to start genome assembly. The gene modules were all obtained from either DNA purified from wild type Ad5 virus or the plasmid pAd/CMV/V5/DEST (Invitrogen).

(208) Regarding the DEST vector for human Ad5, the E2 and L3 modules were inserted into plasmid p15A-SceI by 3-fragment SLIC. The counterselection marker expressing ccdB and Chlor(r) flanked by attR5 and attR2 sites was obtained by PCR from plasmid pDONR P5P2. The second counterselection marker was obtained by PCR from the vector pDONR P1P4. The two counterselection markers were inserted on the right and left sides of p15A-SceI E2-L4 by SLIC after cutting with unique restriction enzymes engineered to the ends of the E2 and L4 modules to create the DEST vector.

(209) Regarding Amp(r) cassette: plasmid pUC19, the p15A ori: plasmid pSB3K5-I52002 was part of the BioBricksiGEM 2007 parts distribution. Regarding the adenoviral gene modules, the DNA was purified from Ad5 particles or plasmid pAd/CMV/V5/DEST (Invitrogen). The DONR vectors pDONR P1P4, P5P2, P5P3R, P3P2 were obtained from Invitrogen.

(210) All PCR assays were performed using the Phusion enzyme (NEB). PCR assays to obtain the ADENOVIRAL GENE modules from Ad5 were performed with 1HF buffer, 200 M each dNTP, 0.5 M each primer, and 10 ng of template. For the E2-L2 module, 3% DMSO was also added. Template was either plasmid pAd/PL-DEST (Invitrogen; for E2-L2, L3-L4, and E4 modules) or Ad5 genomic DNA (for E1 and E3 modules). PCR conditions were as follows:

(211) E2-L2 and L3-L4: 98 C. 30 sec-10 cycles of 98 C. 10 sec, 65 C. 30 sec (decrease temp 1 C. every 2 cycles), 72 C. 7 min-29 cycles of 98 C. 10 sec, 60 C. 30 sec, 72 C. 8 min-72 C. 10 min-4 C. hold.

(212) E3: 98 C. 30 sec-10 cycles of 98 C. 10 sec, 70 C. 30 sec (decrease temp 0.5 C. every cycle), 72 C. 2 min 30 sec-25 cycles of 98 C. 10 sec, 68 C. 30 sec, 72 C. 2 min 30 sec-72 C. 10 min-4 C. hold.

(213) E4: 98 C. 30 sec-6 cycles of 98 C. 10 sec, 63 C. 30 sec (decrease temp 0.5 C. every cycle), 72 C. 2 min-29 cycles of 98 C. 10 sec, 60 C. 30 sec, 72 C. 2 min-72 C. 5 min-4 C. hold.

(214) To obtain viral genomic DNA from purified virus, up to 100 L of purified virus was added to 300 l of lysis buffer containing 10 mM Tris pH8, 5 mM EDTA, 200 mM NaCl, and 0.2% SDS. The mix was incubated at 60 C. for 5 min, followed by the addition of 5 l of proteinase K stock (20 mg/mL) and further incubated at 60 C. for 1 hour. Samples were then placed on ice for 5 min, followed by spinning at 15Kg for 15 min. Supernatant was removed and added to an equal volume of isopropanol, mixed well, and spun at 15Kg for 15 min at 4 C. The pellet was washed with 70% ethanol and re-spun for 15 min at 4 C. The pellet was dried and resuspended for use.

(215) Regarding SLIC, linear fragments were exonuclease treated for 20 min at room temperature in the following 20 l reaction: 50 mM Tris pH8, 10 mM MgCl2, 50 g/mL BSA, 200 mM Urea, 5 mM DTT, and 0.5 l T4 DNA polymerase. The reaction was stopped by addition of 1 l 0.5M EDTA, followed by incubation at 75 C. for 20 min. An equal amount of T4-treated DNAs were then mixed to around 20 l in volume in a new tube. For SLIC combining 2 fragments, 10 l of each reaction was used. For SLIC combining 3 fragments, 7 l of each reaction was used. Fragments were annealed by heating to 65 C. for 10 min, followed by a slow cool down decreasing the temperature 0.5 C. every 5 seconds down to 25 C. After annealing, 5 l of the reaction was transformed and clones were screened.

(216) Regarding AdSlicR, a 3-fragment SLIC reaction was performed using 100 ng of T4-treated p15A-SceI (linearized by PCR), and 300 ng of each of the E2 and L3 modules (obtained by PCR from their respective entry vectors). This created vector p15A-SceI E2-L4. Five g of p15A-SceI E2-L4 was cut with SwaI and gel purified using Qiagen QiaexII. The E3 and E4 modules were obtained by PCR from their respective entry vectors. Each of the linearized vectors (450 ng) and PCR products (200 ng) were treated with T4 DNA polymerase and SLIC was performed as usual, using 150-200 ng of vector and 100 ng of each module PCR. After isolation of positive clones, 5 g of the new vector was cut with PacI and gel purified, then combined with an E1 PCR product (100 ng of T4-treated) in a new SLIC reaction. This completed the genome assembly, and the plasmid was ready for transfection to reconstitute virus.

(217) To construct the E1 and E4 mutant regions, manipulation was carried out on the individual module entry vectors. The E1 module with vector backbone was PCR amplified with primers to generate a product lacking the LTCHE sequence (residues 122-126 of SEQ ID NO: 32), then circularized using SLIC to generate pENTR-E1-E1A-LXCXE.

(218) Alternatively, the E1 module with vector backbone was PCR amplified with primers to generate products with E1A codon changes to mutate Y47 to H, C124 to G, or to delete residues 2-11 to generate pENTR-E1-E1A-Y47H, pENTR-E1-E1A-C124G, or pENTR-E1-E1A-2-11, respectively. These products were used as the template for further PCR mutation to generate combinations of these mutations: pENTR-E1-E1A-Y47H-C124G and pENTR-E1-E1A-Y47H-C124G-2-11. The E4 module with vector backbone was PCR amplified with primers to generate a product lacking the E4orf6/7-specific exon sequence (297 bp) downstream of the E4orf6 stop codon to generate pENTR-E4-E4orf6/7. This product was also used as the template for PCR with primers to generate products either lacking the PDZ-binding motif of E4orf1, or the entire E4orf1 sequence (pENTR-E4-E4orf6/7-E4orf1PDZb and pENTR-E4-E4orf6/7-E4orf1, respectively).

(219) To generate complete virus genomes bearing the mutations, AdSlicR was performed using p15A-SceI E2-L4 in combination with the wild-type E3 module and the wild-type E4 or a mutant E4 module, then with either the wild-type E1 or mutant E1. The wild-type AdSlicR adenoviruses are designated in Table 1 shown below.

(220) TABLE-US-00008 TABLE 1 Adenoviruses with Modifications in E1 and E4 Virus Name E1 E4 SEQ ID NO: AdSyn-CO102 wt wt 1 AdSyn-CO210 wt E4orf6/7 2 AdSyn-CO283 wt E4orf1 PDZb, E4orf6/7 3 AdSyn-CO284 wt E4orf1, E4orf6/7 4 AdSyn-CO189 E1A LXCXE wt 5 AdSyn-CO181 E1A LXCXE E4orf6/7 6 AdSyn-CO285 E1A LXCXE E4orf1 PDZb, E4orf6/7 7 AdSyn-CO286 E1A LXCXE E4orf1, E4orf6/7 8 AdSyn-CO235 E1A C124G wt 9 AdSyn-CO287 E1A C124G E4orf6/7 10 AdSyn-CO288 E1A C124G E4orf1 PDZb, E4orf6/7 11 AdSyn-CO289 E1A C124G E4orf1, E4orf6/7 12 AdSyn-CO236 E1A d2-11 wt 13 AdSyn-CO290 E1A d2-11 E4orf6/7 14 AdSyn-CO291 E1A d2-11 E4orf1 PDZb, E4orf6/7 15 AdSyn-CO292 E1A d2-11 E4orf1, E4orf6/7 16 AdSyn-CO238 E1A Y47H, C124G wt 17 AdSyn-CO293 E1A Y47H, C124G E4orf6/7 18 AdSyn-CO294 E1A Y47H, C124G E4orf1 PDZb, E4orf6/7 19 AdSyn-CO295 E1A Y47H, C124G E4orf1, E4orf6/7 20 AdSyn-CO244 E1A Y47H, C124G, d2-11 wt 21 AdSyn-CO296 E1A Y47H, C124G, d2-11 E4orf6/7 22 AdSyn-CO297 E1A Y47H, C124G, d2-11 E4orf1 PDZb, E4orf6/7 23 AdSyn-CO298 E1A Y47H, C124G, d2-11 E4orf1, E4orf6/7 24

(221) Regarding virus production, concentration and purification, 293 E4 cells were infected with infectious particles, and approximately 48 hours post-infection when CPE was apparent, the cells were collected and isolated by centrifugation at 500g for 5 minutes. The cells are lysed in TMN buffer (10 mM TrisCl pH 7.5, 1 mM MgCl2, 150 mM NaCl) via 3 freeze/thaws, and the cell debris was removed by two rounds of centrifugation at 3,000g and 3,500g for 15 minutes. A cesium chloride gradient (0.5 g/mL) was used to band virus particles via ultracentrifugation at 37,000g for 18-24 hours. The band was collected and dialyzed in a 10,000 MWCO Slide-A-Lyzer dialysis cassette (Thermo Scientific) in TMN with 10% glycerol overnight (12-18 h) at 4 C., then stored at 80 C. The titer of the purified virus was determined versus a titered wild-type standard by a cell-based serial dilution infection ELISA with anti-adenovirus type 5 primary antibody (ab6982, Abcam), and ImmunoPure anti-rabbit alkaline phosphatase secondary antibody (Thermo Scientific).

(222) To evaluate adenovirus protein expression during infection of primary human small airway epithelial cells (SAEC), quiescent SAEC in 12-well plates were infected with MOI 30 adenovirus, and the media was replaced on the cells 4 hours after infection. At 24, 36, and 48 hours after infection, cells were washed with cold PBS, harvested in 500 L cold PBS, pelleted at 5,000 rpm for 5 min at 4 C., snap frozen and stored at 80 C. Cell pellets were lysed in RIPA buffer (100 mM Tris pH7.4, 300 mM NaCl, 2 mM EDTA, 2% Triton X, 2% deoxycholate, 2 mM NaF, 0.2 mM NaVO.sub.4, 2 mM DTT) for 1 hour at 4 C., including sonication in a cup sonicator (260 s pulses at 60 amplitude at 4 C.). Cell debris was pelleted by centrifuging at 13,000 rpm for 20 min at 4 C. Protein concentration was determined using Bio-Rad's DC Protein Assay, and the protein concentrations of the samples were normalized. Gel electrophoresis was performed using Life Technologies Novex NuPAGE SDS-PAGE gels, as per the manufacturer's protocol. Proteins were detected by Western blot. The primary antibodies used to detect proteins were as follows: E1A (ab28305, Abcam), -actin (A5441, Sigma), Ad5 late proteins (ab6982, Abcam), cyclin A (Ab-6 6E6, NeoMarkers), cyclin B (Ab-3 GNS1, NeoMarkers). Alexa Fluor antibodies (Life Technologies) were used as secondary antibodies, and the signal was detected using a LI-COR ODYSSEY instrument. To evaluate adenovirus protein expression during infection of lung adenocarcinoma A549 cells and normal human astrocyte cells (NHA), confluent cells in 12-well plates were infected with MOI 10 adenovirus, and similarly processed as described for SAEC. To evaluate adenovirus protein expression during infection of glioblastoma U87 cells, glioblastoma U118 cells, human vascular endothelial cells (HuVEC), or human fibroblasts, confluent cells in 12-well plates were infected with MOI 20 adenovirus, and similarly processed as described for SAEC.

(223) To perform cell cycle analysis, cells were infected with the same MOI as for protein expression. Forty-eight hours post-infection, cells were trypsinized off the plate and washed with cold PBS. Cells were resuspended in 500 L cold PBS, and fixed with 3 mL cold 70% EtOH/15 mM glycine, pH 2.8. Samples were kept at 4 C., and prior to FACS, the cells were pelleted, washed in cold PBS, and resuspended in propidium iodide (PI)/RNase A solution, then incubated at 37 C. for 1 h. At least 10,000 events were collected by FACS for each sample.

(224) To evaluate adenovirus bursts from infection, quiescent cells in 12-well plates were infected with MOI 1 or MOI 10 adenovirus, and the media was replaced on the cells four hours after infection. Media from the wells was collected 48 and 72 hours post-infection, flash frozen and thawed once, and centrifuged at 7,000 rpm at 4 C. for 5 min to pellet cellular debris. The volume of the media was measured, and was flash frozen and stored at 80 C. The titer of the virus in the media was determined versus a titered wild-type standard by a cell-based serial dilution infection ELISA with anti-adenovirus type 5 primary antibody (ab6982, Abcam) and ImmunoPure anti-rabbit alkaline phosphatase secondary antibody (Thermo Scientific).

(225) Regarding cell viability assays, cells were seeded in 96-well plates, and in infected in triplicate at serial dilutions at MOI 30. Following infection at 7-10 days when there was complete CPE in the MOI 10 infected wells, metabolic activity was measured using cell proliferation reagent WST-1 (Roche) as per manufacturer's specifications.

(226) As discussed above, cancer continues to be a problematic disease in need of additional therapeutic treatments. One such treatment includes oncolytic viruses. Adenoviruses are one of the viruses being explored for use as an oncolytic virus. The retinoblastoma (Rb) tumor suppressor pathway function is lost in almost every human cancer either by direct mutation of Rb, by loss of CDK-inhibitor p16 function (e.g. due to mutation/methylation), or by amplification of CDK/cyclins. In normal, non-dividing cells, Rb remains hypophosphorylated and binds to transcription factor E2F at its target promoters, suppressing transcription by masking the E2F transactivation domain as well as recruiting chromatin-remodeling complexes and histone-modifying activities. During the G1-S transition of the cell cycle, CDKs phosphorylate Rb which relieves E2F suppression. Adenoviruses express early viral oncoproteins that inactivate the Rb tumor suppressor pathway to force cells to replicate and concomitantly reproduce the viral genome. Adenovirus E1A binds Rb, in part, via an LXCXE motif, deregulating its tumor suppressor activities. It was thus proposed that deleting the LXCXE motif in E1A would eliminate Rb inactivation, and make a selectively replicating virus (ONYX-838). However, Johnson et al. (Cancer Cell, 1(4):325-337, 2002) provided evidence that the Ad E1A LXCXE mutation was not sufficient to prevent S-phase entry, viral DNA replication, and late protein expression, consistent with results from experiments described herein. Even though the Rb-selectivity of the E1A mutant is controversial, this mutation has been carried forward as the basis for an oncolytic virus (DNX-2401) that is moving into phase II clinical trials for malignant brain tumors. In an attempt to achieve higher Rb-selectivity, an adenovirus was generated that replaced the promoters for the adenovirus E1 and E4 regions with E2F promoters and combined it with the E1A LXCXE motif to generate ONYX-411 (Johnson et al., Cancer Cell, 1(4):325-337, 2002; and Dubensky et al., Cancer Cell, 1(4):307-309, 2002). To test these viruses, tumor and primary human cells were infected with either wild type virus, ONYX-838 (E1A LXCXE) or ONYX-411 and harvested at various time points post infection. ONYX-838 indiscriminately replicated in tumor and primary lung epithelial cells. ONYX-411, which combines the E1A LXCXE with cellular E2F control of adenovirus E1A, E1B and E4 regions demonstrated selective-replication in tumor cells vs. normal cells (Johnson et al., Cancer Cell 1(4):325-337, 2002). However, the E2F promoters result in recombination and also limited replication to wild type virus levels in tumor cells.

(227) As described herein, independently of E2F release from Rb suppression by E1A, there is another Ad protein, E4orf6/7, that further stabilizes E2F proteins at cellular and Ad promoters. Together, E1A and E4orf6/7 drive E2F-mediated transcription, causing S-phase initiation, concomitantly propagating the viral DNA genome. Therefore, provided herein are recombinant adenoviruses bearing E1A modifications, E4orf1 modifications and/or E4orf6/7 modifications that are a selective oncolytic viral therapy for tumor cells lacking functional Rb. Specifically, compound mutations in E1A/E4orf1/E4orf6/7 were engineered to determine if they selectively replicate in tumor cells, but not primary cells. It is proposed that the combination of these mutations result in an effective, self-amplifying therapy for cancer.

(228) To test these viruses in normal (non-tumor) cells and tumor cells, cells were mock infected or infected with AdSyn-CO102 (wild-type), AdSyn-CO181 (E1A LXCXE/E4orf6/7), AdSyn-CO189 (E1A LXCXE), or ONYX-838 (E1A CR2). ONYX-838 also lacks LXCXE which is in the CR2 domain of E1A. Quiescent human primary small airway epithelial cells (SAEC) (non-tumor cells) were infected at MOI 10. AdSyn-CO102 exhibited the expected decrease of E1A levels at later times during infection (FIG. 1A). Similarly, in cells infected with AdSyn-CO189 or ONYX-838, there is a decrease in E1A levels at later times during infection; however, at the earlier timepoint, expression of E1A is greater than expression of E1A in AdSyn-CO102-infected cells. In contrast, AdSyn-CO181 exhibited stronger and continued expression of E1A throughout the infection, which is indicative of a failure to progress through the adenovirus lifecycle. Confluent lung adenocarcinoma (A549) cells (tumor cells) were infected at MOI 30. All infections resulted in the expected decrease of E1A levels at later times during infection, indicative of typical adenovirus lifecycle progression (FIG. 1B).

(229) Late adenoviral protein and cellular cyclin protein expression following infection of SAEC or A549 cells with mutant adenoviruses is shown in FIG. 2A (SAEC) and FIG. 2B (A549 cells). In contrast to wild-type virus and viruses with E1A mutations alone, AdSyn-CO181 failed to activate E2F-dependent cell cycle targets, the S phase, cyclin A and cyclin B in SAEC. Furthermore, AdSyn-CO181 and AdSyn-CO210, which have E4orf6/7 mutations, were defective for late protein expression and replication in SAEC. Both of these defects were apparent to a lesser extent with AdSyn-CO210. In contrast to infected primary cells, there were no apparent defects in expression of late structural proteins in A549 cells, and cyclin A and cyclin B remain present in all infected A549 samples.

(230) DNA replication of infected SAEC and A549 cells is shown in FIGS. 3A and 3B. AdSyn-CO181 infection exhibited a strong DNA replication defect in SAEC relative to AdSyn-CO102, which is linked to decreased virus replication. A modest defect was also apparent in AdSyn-CO210 infected SAEC at this timepoint. In A549 cells, no DNA replication defect was apparent with any mutant virus infection.

(231) FIGS. 4A-4B show adenovirus bursts from infected SAEC and A549 cells. Both AdSyn-CO181 and AdSyn-CO210 infection revealed strong replication defects in SAEC relative to AdSyn-CO102 (FIG. 4A). With the exception of AdSyn-CO210, there was no defect in virus replication in A549 cells (FIG. 4B).

(232) FIGS. 5A-5B show the cell viability of infected SAEC and A549 after 7 days of infection. Compared to AdSyn-CO102, AdSyn-CO181 exhibited decreased cell-killing capability in SAEC. As shown in FIG. 5B, of the mutant viruses tested, there was no defect in cell killing relative to wild-type virus in A549 cells.

(233) Recombinant viruses were also tested in normal human astrocytes (NHA) (FIGS. 6A-6C), glioblastoma U87 cells (FIGS. 7A-7C), glioblastoma U87 cells (FIGS. 8A-8C) and IMR90 cells (FIGS. 9A-9C). In NHA, AdSyn-CO181 did not induce cyclin A, and demonstrated delayed and decreased late viral protein expression relative to AdSyn-CO102, which are indicative of replication deficiency (FIG. 6A). In addition, as measured by the number of infectious particles (FIG. 6B) and DNA content (FIG. 6C), AdSyn-CO181 exhibited attenuated infection in NHA, compared to wild-type AdSyn-CO102. In contrast to NHA cells, the mutant adenoviruses did not demonstrate a replication defect in glioblastoma U87 cells (FIGS. 7A-7C) or in glioblastoma U118 cells (FIGS. 8A-8C). AdSyn-CO181 exhibited modest replication defects in IMR90 cells (FIGS. 9A-9C).

(234) Thus, the data described above indicates that in contrast to wild-type and E1ACR2 viruses, E1ACR2/E4orf6/7 and also E4orf6/7 viruses replicate poorly in primary cells, as evidenced by lack of capsid protein expression, failure to induce E2F target genes (cyclin A and B), failure to elicit S phase entry and viral replication. In contrast, these viruses replicate to wild-type virus levels in A549 cells and a panel of tumor cell-lines. Therefore, the recombinant adenoviruses disclosed herein are selective cancer therapeutic agents.

(235) Results of the replication specificity of a larger set of mutant adenoviruses, including mutations in E4orf1 (see Table 1) are shown in FIGS. 10-15 and summarized in FIG. 16. FIG. 10 is a graph showing the cell viability of infected primary normal human astrocytes (NHA) after 10 days of infection. FIG. 11 is a graph showing the cell viability of infected quiescent normal small airway epithelial cells (SAEC-hTERT) after 9 days of infection. FIG. 12 is a graph showing the cell viability of infected proliferating SAEC-hTERT cells after 10 days of infection. FIG. 13 is a graph showing the cell viability of infected human lung adenocarcinoma cells (A549) after 7 days of infection. FIG. 14 is a graph showing the cell viability of infected human breast cancer cells (MDA MB 231) after 7 days of infection. FIG. 15 is a graph showing the cell viability of infected glioblastoma cells (U87) after 7 days of infection. FIG. 16 is a heatmap table showing the quantitation of cell viability assays for infected primary NHA, SAEC-hTERT (quiescent), SAEC-hTERT (proliferating), A549, MDA MB 231, and U87 cells after 7 days of infection. In addition, FIG. 17 provides a table showing quantitation of cell viability assays for infected U2OS and SaOS2 cells. Both U2OS and SaOS2 cells are osteocarcinoma cells; however, p53 and Rb are functional in U2OS cells and mutated in SaOS2 cells. The results demonstrate that the mutant viruses selectively replicate in the Rb-defective tumor cells.

(236) These data show that the combination of various modifications of E1A, E4orf1 and/or E4orf6/7 results in selective oncolytic adenovirus that specifically replicate in cancer cells with a defective Rb tumor suppressor pathway.

Example 2: Oncolytic Adenoviruses with Modifications in E1, L3, E3 and/or E4

(237) This example describes additional recombinant adenoviruses with tumor selectivity. Exemplary recombinant viruses are listed in Table 2 and the genome sequences of these viruses are set forth as SEQ ID NOs: 25-31.

(238) TABLE-US-00009 TABLE 2 Adenoviruses with Modifications in E1, L3, E3 and/or E4 Virus Name (SEQ ID NO) E1 L3 E3 E4 AdSyn-CO312 E1A LXCXE wt E3-RID/, E3-14.7k + E4orf6/7 (25) EGFRVHH-FKBP FRB*-fiber AdSyn-CO313 E1A LXCXE wt E3-RID/, E3-14.7k + E4orf6/7 (26) EGFRVHH-FKBP FRB-fiber AdSyn-CO199 E1 + EF1- wt wt wt (27) luciferase AdSyn-CO200 E1 + EF1- wt wt wt (28) luciferase-miR122 AdSyn-CO171 E1 + EF1- hexon E451Q wt wt (29) luciferase-miR122 AdSyn-CO335 E1A LXCXE hexon E451Q E3-RID/, E3-14.7k + E4orf6/7 (30) EGFRVHH-FKBP FRB*-fiber AdSyn-CO442 E1A LXCXE hexon E451Q FRB*-fiber E4orf6/7 (31) AdSyn-CO440 E1B-55k-P2A- wt E3-RID/, E3-14.7k + wt (68) Ypet EGFRVHH-GS-FKBP- P2A-ADP FRB-fiber

(239) AdSyn-CO312, AdSyn-CO313 and AdSyn-CO335 are rapamycin- and/or rapalog (AP21967)-dependent EFGR-targeted viruses (see PCT Publication No. WO 2013/138505, which is herein incorporated by reference in its entirety, for a description of this targeting method). Each of these recombinant viruses include a deletion of the E3-RID/ and E3-14.7k coding sequences, and an insertion of an EGFRVHH-FKBP fusion protein and either FRB*-fiber (Ad5 fiber fused to mutant FRB, which can bind rapamycin or rapalog) or FRB-fiber (Ad5 fiber fused to wild-type FRB, which can bind only rapamycin). AdSyn-CO442 can be used as an experimental control virus as it expresses FRB*-fiber, but not an FKBP fusion protein, which would be required for rapamycin/rapalog-dependent retargeting. AdSyn-CO335 and AdSyn-CO442 also include an E451Q mutation in the hexon protein. This mutation detargets the recombinant virus from the liver.

(240) FIG. 18A shows the binding interface of the FRB domain with rapamycin and FKBP12. FIG. 18B is a graph showing that EGFR-targeted virus with FRB-fiber (AdSyn-CO205; SEQ ID NO: 88) has improved transduction of MDA MB 453 breast cancer cells in the presence of rapamycin, but not AP21967, while the EGFR-targeted virus with the FRB*-fiber (AdSyn-CO220; SEQ ID NO: 98) has improved transduction of MDA MB 453 cells in the presence of either rapamycin or AP21967. FIG. 18C is an immunoblot showing the activity of the mTOR inhibitor rapamycin blocking the phosphorylation of its target p70 S6K. The rapamycin homolog AP21967 does not inhibit mTOR at targeting concentrations.

(241) AdSyn-CO312 was tested in HS578T metastatic breast cancer cells. At 24, 48, 72 and 96 hours after infection, fresh rapamycin or AP21967 was added to 50 nM. The metabolic activity was quantified by WST-1 assay, and was normalized to uninfected cells with a matching drug treatment. As shown in FIG. 18D, infection with AdSyn-CO312 resulted in enhanced cell killing of cells infected with the EGFR-targeted oncolytic virus that receive either rapamycin or AP21967 compared to the absence of targeting. Cell viability of AdSyn-CO313-infected HS578T metastatic breast cancer cells after 9 days of infection is shown in FIG. 18E. Cells were infected with a serial dilution of AdSyn-CO313. At 24, 48, 72 and 96 hours after infection, fresh rapamycin was added to 50 nM. The metabolic activity was quantified by WST-1 assay, and was normalized to uninfected cells with a matching drug treatment. AdSyn-CO313 bears the oncolytic mutations of E1A LXCXE, E4orf6/7, E3-RID/, E3-14.7k, and expresses the rapamycin-dependent EGFR-targeting gene EGFRVHH-FKBP and FRB-fiber. There is enhanced killing of cells infected with the EGFR-targeted oncolytic virus that receive rapamycin without targeting.

(242) AdSyn-CO313 was evaluated in mice with HS578T subcutaneous xenografts. Mice with established tumors received intratumoral injection of AdSyn-CO313, then subsequently received periodic intraperitoneal 8 mg/kg rapamycin injection (n=5) or vehicle control (n=4), or they received intratumoral vehicle control, then subsequently received periodic intraperitoneal 8 mg/kg rapamycin injection (n=5) or vehicle control (n=4). Infection was repeated in the same groups three more times every 4 days starting 19 days following the initial infection. As shown in FIG. 19, the tumors in mice receiving the EGFR-targeted oncolytic virus with rapamycin exhibited the best response.

(243) AdSyn-CO335 is an oncolytic virus that features a capsid that avoids liver uptake by the hexon E451Q mutation, and can be targeted to infect cells via EGFR in the presence of rapamycin or rapalog AP21967. Oncolytic activity of AdSyn-CO335 was tested in vitro and in vivo. HS578T cells were infected with a serial dilution of AdSyn-CO335. At 24, 48, 72 and 96 hours after infection, fresh rapamycin or AP21967 was added to 50 nM. The metabolic activity was quantified by WST-1 assay, and was normalized to uninfected cells with a matching drug treatment. As shown in FIG. 20, there is enhanced killing of cells infected with the EGFR-targeted oncolytic virus that receive either rapamycin or AP21967, compared to infected cells without targeting. To evaluate AdSyn-CO335 in vivo, HS578T subcutaneous xenografts were established in mice. Mice with established tumors received three intratumoral injections every 4 days of AdSyn-CO335, then subsequently received intraperitoneal 2 or 8 mg/kg rapamycin injection (n=8 and n=8, respectively) every other following day or vehicle control (n=6) every other following day; or they received three intratumoral injections every 4 days of AdSyn-CO442, then subsequently received intraperitoneal 2 or 8 mg/kg rapamycin injection (n=6 and n=6, respectively) every other following day; or they received three intratumoral injections every 4 days of vehicle control, then subsequently received intraperitoneal 2 or 8 mg/kg rapamycin injection (n=6 and n=6, respectively) every other following day. As indicated in FIGS. 21A-21D, the tumors in mice receiving the EGFR-targeted oncolytic virus with 8 mg/kg rapamycin show the most significant response.

(244) AdSyn-CO199, AdSyn-CO200 and AdSyn-CO171 are recombinant reporter viruses having a deletion of E1A and encoding luciferase drive by the EF1 promoter (EF1-luciferase). AdSyn-CO200 and AdSyn-CO171 also include two binding sites for miR-122 (a liver specific microRNA) in the 3-UTR of E1A, to inhibit viral gene expression in the liver. AdSyn-CO171 further encodes the liver detargeting E451Q mutation in the hexon protein.

(245) FIGS. 22A-22C show the elimination of adenovirus mediated gene expression in the liver, and detargeting of adenovirus infection to the liver. AdSyn-CO199 expressed luciferase at high levels exclusively in the liver following systemic infection (FIG. 22A). As shown in FIG. 22B, the luciferase signal is lost when mice are systemically infected with AdSyn-CO200, a virus matching AdSyn-CO199, except that the liver-specific microRNA miR122 eliminates luciferase expression. As shown in FIG. 22C, expression of luciferase can be detected in the spleen when mice are systemically infected with AdSyn-CO171, a virus matching AdSyn-CO200, except that the adenovirus hexon protein bears the mutation E451Q, which detargets it from the liver. These data validate the use of this genomic module modification to prevent liver expression of Ad E1 genes and by definition replication in liver cells.

Example 3: Recombinant Adenoviruses Expressing Chimeric Fiber Proteins

(246) This example describes recombinant adenoviruses expressing chimeric fiber proteins to direct infection to specific cell types.

(247) While the fiber proteins of Ad5 and many other serotypes have been shown to bind to the coxsackie adenovirus receptor (CAR) for cellular attachment, other serotypes have been shown to use CD46, desmoglein 2, sialic acid, or others. Since Adsembly/AdSLIC (see PCT Publication No. WO 2012/024351, incorporated herein by reference) allows for the rapid creation of chimeric viruses, an initial panel of six fiber chimeric viruses was generated in order to examine the alternate cellular targeting capabilities of various serotypes. Since the globular knob at the C-terminus of the fiber protein is typically responsible for receptor binding, chimeras were created by replacing the Ad5 fiber knob with fiber knob from Ad3, Ad9, Ad11, Ad12, or Ad34 (FIGS. 23A23C; Table 3). Each virus was created with the same E1 module containing an E1A/E1B deletion and a luciferase-GFP fusion driven by an EF1 promoter. The panel was used to transduce 17 different tumor cell lines, primary airway cells and the H9 stem cell line, and luciferase expression measured in each cell type (FIG. 23D). Compared to Ad5 fibers, significantly higher luciferase-GFP expression was observed in almost all cells when using chimeras with Ad3, Ad11 or Ad34 (FIGS. 23D and 23E). Conversely, luciferase-GFP expression was almost universally lower in cells transduced with the Ad9 or Ad12 fiber chimeras. These data demonstrate a powerful use of being able to combine modified parts from other serotypes in order to improve Ad5-based vectors and optimize recombinant viruses for entry into specific cell types.

(248) TABLE-US-00010 TABLE 3 Recombinant Adenoviruses with Chimeric Fiber Proteins Virus Name (SEQ ID NO) E1 L3 E3 E4 AdSyn-CO172 E1 + EF1- hexon Ad3 knob fiber wt (69) luciferase-miR122 E451Q chimera AdSyn-CO173 E1 + EF1- hexon Ad9 knob fiber wt (70) luciferase-miR122 E451Q chimera AdSyn-CO174 E1 + EF1- hexon Ad11 knob fiber wt (71) luciferase-miR122 E451Q chimera AdSyn-CO175 E1 + EF1- hexon Ad12 knob fiber wt (72) luciferase-miR122 E451Q chimera AdSyn-CO176 E1 + EF1- hexon Ad34 knob fiber wt (73) luciferase-miR122 E451Q chimera

Example 4: Capsid-Swapped Recombinant Adenoviruses

(249) This example describes module modifications to create capsid-swapped chimeric adenoviruses. The recombinant adenoviruses described in this example are designed to evade existing neutralizing antibodies.

(250) Ad5-based viruses that have complete capsid module swaps (almost 60% of genome), which render them invisible to pre-existing antibodies in human populations and enables repeated inoculations Adsembly/AdSLIC, were designed to take advantage of the modularity that exists in adenovirus genomes. The most robust test of this modularity would be in combining whole modules of one serotype with whole modules of another serotype. This possibility was examined by combining the E1, E3, and E4 modules of Ad5 with the core modules (i.e. E2B, L1, L2, L3, E2A and L4; see FIG. 24A) of other serotypes. This produces viruses that can evade neutralizing Ad5 antibodies, yet maintain the well characterized non-structural genes of Ad5 that are frequently mutated in creating oncolytic viruses. AdSLIC was used to generate viruses that contained a core module of either Ad3, Ad9, Ad11, Ad12, Ad34 or mouse adenovirus 1 (MAV-1) with the E1, E3, and E4 modules of Ad5 (FIG. 24B and Table 4). In addition, the Ad5 E1 module was altered to replace the pIX coding region of Ad5 with that from the matching core serotype; and the Ad5 E3 module was altered to replace the Uexon and fiber coding region with that from the matching core serotype. Thus, all of the capsid components were from one serotype while the E1, E3, and E4 regions of the genome were from Ad5. Four of the six chimeras that were created were able to produce viable virus in 293-E4 cells. Chimeras between Ad5 and Ad3, Ad9, Ad11, or Ad34 all replicated, while Ad5/Ad12 or Ad5/MAV-1 chimeras did not replicate even after being further modified to include the ITRs and packaging sequence (T) of the core serotype (FIG. 24B). Thus, the ability to generate these capsid-swapped adenovirus chimeras varies depending on the serotype.

(251) TABLE-US-00011 TABLE 4 Recombinant Adenoviruses with Capsid Swaps Virus Name (SEQ ID NO) E1 Core E3 E4 AdSyn-CO159 Ad11 pIX All Ad11 Ad11 Uexon and fiber wt (74) AdSyn-CO159X Ad11 pIX All Ad11 Ad11 Uexon and fiber E4orf6/7 (93) E1A LXCXE AdSyn-CO167 Ad9 pIX All Ad9 Ad9 Uexon and fiber wt (75) AdSyn-CO167X Ad9 pIX All Ad9 Ad9 Uexon and fiber E4orf6/7 (94) E1A LXCXE AdSyn-CO168 Ad12 pIX All Ad12 Ad12 Uexon and fiber wt (76) AdSyn-CO201 Ad3 pIX All Ad3 Ad3 Uexon and fiber wt (77) AdSyn-CO201X Ad3 pIX All Ad3 Ad3 Uexon and fiber E4orf6/7 (95) E1A LXCXE AdSyn-CO202 Ad34 pIX All Ad34 Ad34 Uexon and fiber wt (78) AdSyn-CO202X Ad34 pIX All Ad34 Ad34 Uexon and fiber E4orf6/7 (96) E1A LXCXE AdSyn-CO185 MAV-1 pIX All MAV-1 MAV-1 Uexon and fiber wt (79) E1 + CMV-GFP AdSyn-CO254 Ad12 ITR/, All Ad12 Ad12 Uexon and fiber Ad12 ITR (80) Ad12 pIX AdSyn-CO255 MAV-1 ITR/, All MAV-1 MAV-1 Uexon and fiber MAV-1 ITR (81) MAV-1 pIX E1 + CMV-GFP

(252) The replication and gene expression of viable capsid swapped chimeric viruses was subsequently analyzed. Purified capsid swapped particles showed the same total protein content as the wild-type adenovirus serotype with matching core module (FIG. 25A). The hexon protein, the target of the majority of neutralizing antibodies, was not recognized in other serotypes or in the capsid swapped viruses by a polyclonal rabbit antisera generated against Ad5 particles (FIG. 25A). Other structural proteins found on the interior of the capsid such as V and VI did show some cross reactivity (FIG. 25A). Western blot analysis of infected cells showed that for the Ad5/Ad3, Ad5/Ad11, and Ad5/Ad34 chimeras, the expression of cross-reacting late proteins and 100K was equivalent to wild-type Ad3, Ad11, and Ad34 in A549 cells, while slightly higher in U2OS cells (FIGS. 25B, 25D and 25E). Expression of E1A, which is derived from Ad5 in all viruses, was significantly higher than wild-type Ad5 in these three chimeras, possibly due to improved cell entry over Ad5 (FIGS. 25B, 25D and 25E and FIG. 23D). Conversely, the Ad5/Ad9 capsid swapped chimera showed poor gene expression at this MOI, slightly worse than wild-type Ad9 (for late proteins) and worse than wild-type Ad5 (for E1A) (FIG. 25C).

(253) It was next tested whether capsid swapped chimeric viruses could avoid antibody neutralization in human serum samples that contain Ad5 neutralizing antibodies. Human serum samples were identified that were capable of neutralizing Ad5 killing of A549 cells, as measured using WST-1 cell viability assays. Upon incubation of these serum samples with either Ad5 or a capsid swapped chimera, cell killing by Ad5 was inhibited, while killing by capsid swapped viruses was not affected (FIGS. 26A-26C). These data demonstrate that capsid swapped chimeric viruses are capable of evading commonly found pre-existing Ad5 antibodies in human samples, and are able to replicate with expression of Ad5 non-structural components and non-Ad5 structural components. Thus, the natural modularity observed within adenovirus genomes can be exploited using Adsembly/AdSLIC to create novel viruses with useful properties.

(254) As discussed above, a significant percentage of the human population has pre-existing antibodies against Ad5 and some other common adenovirus serotypes. An analysis of 16 human serum samples demonstrated that 9 of 16 samples contained neutralizing antibodies against Ad5. Therefore, oncolytic viruses with capsid swaps to enable evasion of pre-existing neutralization antibodies were developed. Four recombinant, capsid-swapped adenoviruses were generated that include oncolytic mutations in E1A (LXCXE) and E4 (E4orf6/7). These mutations are the same oncolytic mutations present in AdSyn-CO181. AdSyn-CO 159X (SEQ ID NO: 93), AdSyn-CO-167X (SEQ ID NO: 94), AdSyn-CO201X (SEQ ID NO: 95) and AdSyn-CO202X (SEQ ID NO: 96) contain the structural proteins from Ad11, Ad9, Ad3 and Ad34, respectively.

Example 5: Recombinant Oncolytic Adenoviruses Combining Modified or Chimeric Fiber Proteins, or Capsid Mutations or Serotype Swaps

(255) This example describes additional recombinant adenoviruses with tumor selectivity, and/or expressing mutant or chimeric fiber proteins to direct infection to specific cell types, and/or capsid-modified or swapped chimeric adenoviruses designed to evade existing neutralizing antibodies. Exemplary recombinant viruses are listed in Table 5 and the genome sequences of these viruses are set forth as SEQ ID NOs: 82-87.

(256) TABLE-US-00012 TABLE 5 Recombinant oncolytic adenoviruses combining modified or chimeric fiber proteins, or capsid mutations or serotype swaps Virus Name (SEQ ID NO) E1 Core E3 E4 AdSyn-CO507 E1A LXCXE hexon E451Q Ad34 knob fiber chimera E4orf6/7 (82) AdSyn-CO508 E1A LXCXE hexon E451Q Ad11 knob fiber chimera E4orf6/7 (83) AdSyn-CO509 E1A LXCXE hexon E451Q Ad37 knob fiber chimera E4orf6/7 (84) AdSyn-CO510 E1A all Ad34 Ad34 Uexon and fiber E4orf6/7 (85) LXCXE/Ad34 pIX AdSyn-CO511 E1A LXCXE hexon E3-RID/, E3-14.7k + E4orf6/7 (86) E451Q/Penton EGFRVHH-FKBP RGE FRB*-fiber AdSyn-CO512 E1A LXCXE hexon RGD-4C in fiber HI loop E4orf6/7 (87) E451Q/Penton RGE

(257) The recombinant adenoviruses disclosed herein (see Tables 1-4) each bear modifications that can be advantageous for directing infection to specific cell types and to evade existing neutralizing antibodies. The E1 and E4 mutations described in Example 1 can be combined with other modules to enhance the efficacy of the oncolytic virus therapy.

(258) Examples of recombinant oncolytic adenoviruses with E1, core, and E4 mutations together with chimeric fibers are AdSyn-CO507, AdSyn-CO508, and AdSyn-CO509, which use the knob domain of Ad34, Ad11, and Ad37 fiber proteins, respectively.

(259) One example of a recombinant oncolytic adenovirus with E1 and E4 mutations together with an Ad34 capsid swap is AdSyn-CO510.

(260) One example of a rapamycin/rapalog induced EGFR-targeted oncolytic adenovirus with E1, E3, and E4 mutations together with the capsid protein penton bearing a mutation in the integrin-binding RGD motif to RGE is AdSyn-CO511. This penton mutation has been shown to reduce uptake of the virus in the spleen and attenuates the antiviral inflammatory response.

(261) One example of a recombinant oncolytic adenovirus with E1 and E4 mutations together with an insertion of an RGD peptide in the fiber protein is AdSyn-CO512. The RGD insertion in the fiber protein has been shown to dramatically increase infection to a wider variety of cell types, including vascular endothelial cells.

Example 6: Oncolytic Adenoviruses Derived from Ad5 and Other Adenovirus Serotypes

(262) The oncolytic adenoviruses disclosed herein (see Tables 1-5) were developed using Ad5 vectors. However, a number of genomic regions (and the protein encoded by these regions) that are important for adenoviral replication are highly conserved among adenovirus serotypes. Thus, the recombinant adenoviruses disclosed herein can be generated using genomic sequence from any desired adenovirus serotype. In particular, the E1A and E4orf6/7 proteins are conserved amongst all human species of adenovirus. FIG. 27 shows an alignment of E1A proteins from species A (Ad12, species B (Ad7), species C (Ad2 and Ad5), species D (Ad9), species E (Ad4), species F (Ad40) and species G (Ad52) adenovirus. Similarly, FIG. 28 shows an alignment of E4orf6/7 proteins from species A (Ad12, species B (Ad7), species C (Ad2 and Ad5), species D (Ad9), species E (Ad4) and species G (Ad52) adenovirus. Using the sequences shown in FIGS. 27 and 28, or any other adenovirus sequences available in public databases, one could readily use E1A and/or E4orf6/7 sequences from any adenovirus serotype in the generation of an oncolytic adenovirus.

Example 7: Characterization of Recombinant Adenovirus Bearing EGFR-Targeting Components

(263) This example describes a synthetic adenovirus targeted to cells expressing EGFR and confirms that the recombinant virus is not replication impaired in 293-E4 cells as a result of the modifications. The following synthetic adenoviruses were generated and used in this study:

(264) AdSyn-CO170 (SEQ ID NO: 91)

(265) A wildtype adenovirus constructed using Adsembly, a multisite Gateway LR recombination reaction from adenovirus genome modules. Three recombination sites remain in the genome between the adenovirus modulesan attB4 recombination site between the E1B-55K and pIX genes; an attB5 site between the L4-33K and pVIII genes; and an attB3 site between the Fiber and E4 gene. This recombinant adenovirus served as a control virus.

(266) AdSyn-CO205 (SEQ ID NO: 88)

(267) A recombinant adenovirus created by Adsembly that corresponds to AdSyn-CO170, but with additional features that enable rapamycin-dependent targeting to infect cells that express EGFR. A sequence encoding the FRB domain from mTOR is inserted into the HI loop in the knob domain of adenovirus fiber. The E3-RID, E3-RID, and E3-14.7K genes were deleted, and replaced with a gene encoding an EGFR-binding single-domain antibody (EGFRVHH) fused to FKBP12. In the presence of rapamycin, the soluble EGFRVHH-FKBP fusion protein forms a heterodimer with the FRB domain in the fiber, and allows mature adenovirus particles to bind to EGFR on new cells and infect via this new receptor.

(268) AdSyn-CO206 (SEQ ID NO: 89)

(269) This recombinant adenovirus is identical to AdSyn-CO205, except it has a wildtype fiber, and therefore lacks the FRB domain. This virus features the deletion of the E3-RID, E3-RID, and E3-14.7K genes, and replacement with a gene encoding an EGFR-binding single-domain antibody (EGFRVHH) fused to FKBP12, as described for AdSyn-CO205.

(270) AdSyn-CO207 (SEQ ID NO: 90)

(271) This recombinant adenovirus is identical to AdSyn-CO205, except it has a wildtype E3 region, and therefore lacks the EGFRVHH-FKBP fusion. It features the FRB insertion in the fiber, as described for AdSyn-CO205.

(272) AdSyn-CO220 (SEQ ID NO: 98)

(273) This recombinant adenovirus is identical to AdSyn-CO205, except it bears the T2098L mutation in the FRB domain (FRB*), which enables EGFR-targeting with rapamycin or AP21967.

(274) The rapamycin-controlled EGFR-targeted virus AdSyn-CO205, contains a GFP reporter fused to E1A as a marker for infection. The E3B transcript was modified by deleting RID, RID, and 14.7k, and used to express EGFRVHH-FKBP. AdSyn-CO206 has all the modifications of AdSyn-CO205, but retains a wildtype fiber, and therefore does not have an FRB domain. AdSyn-CO207 has all the modifications of AdSyn-CO206, but retains a wildtype E3 region, and therefore does not have the FKBP-fusion gene.

(275) To evaluate Ad5 late protein expression by the recombinant viruses, 293-E4 cells were infected with wildtype control virus AdSyn-CO170, the rapamycin-dependent EGFR-targeting modified virus AdSyn-CO205, or control viruses AdSyn-CO206 or AdSyn-CO207 at an MOI of 10. FIG. 29 shows an immunoblot of protein expression from lysates of the infected 293-E4 cells. The change in migration for fiber shows the 90 amino acid FRB domain insertion in AdSyn-CO207 and AdSyn-CO205. The expression of the EGFRVHH-FKBP fusion protein was detected by probing for FKBP12. The timecourse of late protein expression shows that there is no pronounced defect in replication of the capsid-mutant, or EGFRVHH-FKBP expressing viruses with GFP-E1A reporters compared to Adsembly wildtype AdSyn-CO170.

Example 8: Rapamycin-Induced EGFR-Targeting of AdSyn-CO335 Increases Efficacy of Oncolytic Therapy of HS578T Xenografts in Mice

(276) This example describes the finding that rapamycin-dependent EGFR retargeting of recombinant adenovirus significantly reduces tumor volume of EGFR-expressing tumor xenografts.

(277) Mice and Tumors

(278) HS578T (ATCC-HTB-126; American Type Culture Collection, Manassas, CA) breast cancer cells were cultured as recommended by the supplier. Female 5-week-old athymic mice (J:NU #007850; The Jackson Laboratory, Bar Harbor, ME) were housed under approved protocols. Xenografts were initiated by subcutaneously injecting HS578T cells (5E6 cells suspended in 0.2 ml of BD Matrigel Matrix; BD Biosciences, Bedford, MA) into the left and right flank under anesthesia (Isoflurane).

(279) Two perpendicular tumor diameters (l and w) were measured weekly to follow tumor progression. Tumor volumes were calculated by use of the modified ellipsoid formula where vol= (l*w.sup.2) (Euhus et al., J Surg Oncol 31(4):229-2341986; Tomayko et al., Cancer Chemother Pharmacol 24(3):148-154, 1989).

(280) Two months after implantation, 48 mice with 86 tumors with a volume of 27017 mm.sup.3 (meanSEM) were included in the study and randomized into treatment groups with similar mean-sized tumors (n=6 to 8). Not all injections of HS578T successfully established tumors. On days 0, 3, and 6, mice were injected intratumorally with 210.sup.8 PFU of adenovirus diluted in 50 l PBS. AdSyn-CO335 is an oncolytic adenovirus that expresses a fiber protein with an inserted FRB sequence and expresses FKBP fused to a nanobody which recognizes EGFR (EGFRVHH). AdSyn-CO442 has all the features of AdSyn-CO335, but does not express EGFRVHH. Rapamycin (Lot ASC-127; LC Laboratories, Woburn, MA) diluted in 100 L 5% Tween 80/5% PEG400 was administered by intraperitoneal injection on days 1, 4, 7, and every other day thereafter at either 2 or 8 mg/kg dosages. Body weight was monitored for toxicity, and tumor sizes were measured while blinded to treatment groups. Mice were sacrificed if tumors were greater than 20 mm in any dimension or showing other signs of significant tumor burden.

(281) Statistical Analysis

(282) Statistical analyses were performed using R Statistical Software 3.2.0 (The R Foundation, Vienna, Austria) with guidance from the NIST/SEMATECH e-Handbook of Statistical Methods. Outliers were identified using the extreme studentized deviate procedure with 95% confidence interval, assuming normal distribution verified visually by a Q-Q plot. Analysis of variance (ANOVA) was used to test for significant differences between mean tumor volumes of treatment groups at each time point data was collected.

(283) Results

(284) To test the efficacy of the targeted delivery of adenovirus progeny via EGFR to treat tumors in vivo, subcutaneous HS578T xenografts were established on both flanks of nu/nu mice. When tumors reached 26416 mm.sup.3 (meanSEM), mice were randomized into treatment groups with similar mean-sized tumors. Mice received intratumoral injections of mock (vehicle only), AdSyn-CO335, or AdSyn-CO442. AdSyn-CO442 is a control virus which bears the features of AdSyn-CO335, but does not express EGFRVHH-FKBP. Rapamycin (rap) was co-administered every other day during the course of therapy to enable EGFR-targeting of virus progeny. The results are shown in FIG. 30.

(285) With mock treatment (n=8 tumors) and no rapamycin, tumors grew unchecked, with a mean tumor volume of 1300448 mm.sup.3 at 28 days after the start of mock treatment, after which mice were sacrificed due to large tumor dimensions. For comparison, data described below are from this time point in the therapy.

(286) A dose of 8 mg/kg rapamycin every other day in combination with adenovirus administration was tested first, but the high rapamycin concentration masked the effect of the virus infection. The 8 mg/kg rapamycin administration alone (no virus infection) was sufficient to slow the tumor growth compared to no treatment (P=4.5010.sup.2), resulting in a mean tumor volume of 22949 mm.sup.3. Administration of 2 mg/kg rapamycin alone (n=8) was not sufficient to block the growth of the tumors (P=0.144).

(287) Oncolytic AdSyn-CO335 alone (n=11) did not significantly affect the rate of tumor growth compared to no treatment, resulting in a mean tumor volume of 948207 mm.sup.3. This is likely due to the limitation of HS578T infection by untargeted AdSyn-CO335 progeny. When both AdSyn-CO335 and 2 mg/kg rapamycin were co-administered (n=11), there was a dramatic and significant reduction in tumor volume when compared to virus alone (P=8.5410.sup.4) or 2 mg/kg rapamycin (P=1.4910.sup.2) treatment alone, resulting in a reduced mean tumor volume of 13322 mm.sup.3. These data suggest this reduction in tumor volume is dependent on the rapamycin-induced EGFR-targeting of virus progeny, since treatment with 2 mg/kg rapamycin and the control virus AdSyn-CO442 (n=9) resulted in a mean tumor volume of 40189 mm.sup.3, which did not bear significant (P=0.449) difference in mean tumor volume compared to 2 mg/kg rapamycin treatment alone, and resulted in significantly (P=4.9210.sup.3) larger tumors than the co-administration of 2 mg/kg rapamycin and AdSyn-CO335.

(288) Significant differences between the 2 mg/kg rapamycin treatment and co-administration of 2 mg/kg rapamycin and AdSyn-CO335 were measured as early as 14 days after the start of treatment (P=2.2510.sup.2). At this time point, the rapamycin-treated tumors infected with AdSyn-CO442 were measurably outgrowing the AdSyn-CO335-infected tumors (P=1.5410.sup.2).

(289) A study was conducted to evaluate whether the doses of rapamycin that are sufficient for adenovirus retargeting are also immunosuppressive. Mice with subcutaneous HS578T xenograft tumors were treated by intraperitoneal injection of 100 L vehicle, 2 mg/kg rapamycin or 8 mg/kg rapamycin. One hour following injection, xenograft tissues were collected, fixed in 10% formalin, and sectioned for IHC staining with an antibody that recognizes the phospho-T378 form of P70S6K. Shown in FIG. 31 are micropictographs of HS578T xenograft tissue sections stained for P70S6K phosphorylated at threonine 389 (P70S6K p-T389). The phosphorylation of P70S6K at T389 is a hallmark of mTOR activity. In the tissues with no treatment or with the low, adenovirus EGFR-targeting effective dose (2 mg/kg), mTOR activity is not inhibited, as evidenced by the staining of P70S6K p-T389. At the higher adenovirus EGFR-targeting effective dose (8 mg/kg) mTOR activity is inhibited, marked by a loss of P70S6K p-T389 staining. These results demonstrate that the dose of rapamycin that is sufficient for EGFR-targeting of recombinant adenovirus in vivo does not inhibit mTOR (and therefore is not substantially immunosuppressive).

Example 9: Recombinant Oncolytic Adenoviruses with an Ad34 Capsid

(290) AdSyn-CO335B-K (SEQ ID NO: 92), an adenovirus constructed by AdSLIC, is identical to AdSyn-CO335 (SEQ ID NO: 30), except all structural proteins of Ad5 are replaced with Ad34 structural proteins. This virus has the same capsid swap as AdSyn-CO202. This allows the virus to retain oncolytic selectivity of AdSyn-CO335, but avoid Ad5 neutralizing antibodies. The Ad34 fiber knob domain has been replaced with the Ad5 fiber knob, and bears a sequence encoding the FRB domain from mTOR inserted into the HI loop in the knob domain. The E3-RID, E3-RID, and E3-14.7K genes were deleted, and replaced with a gene encoding an EGFR-binding single-domain antibody (EGFRVHH) fused to FKBP12. In the presence of rapamycin, the soluble EGFRVHH-FKBP fusion protein forms a heterodimer with the FRB domain in the fiber, and allows mature adenovirus particles to bind to EGFR on new cells and infect via this new receptor. AdSyn-CO335B-TK (SEQ ID NO: 97) is a recombinant adenovirus identical to AdSyn-CO335B-K, except that the shaft domains of the Ad34 fiber is replaced by the Ad5 shaft.

(291) In view of the many possible embodiments to which the principles of the disclosure may be applied, it should be recognized that the illustrated embodiments are only examples of the disclosure and should not be taken as limiting the scope of the disclosure. Rather, the scope of the disclosure is defined by the following claims. We therefore claim all that comes within the scope and spirit of these claims.