Detection assays for coronavirus neutralizing antibodies
12529699 ยท 2026-01-20
Assignee
Inventors
- Stephen J. Russell (Rochester, MN)
- Kah Whye PENG (Rochester, MN, US)
- Patrycja LECH (Rochester, MN, US)
- Rianna VANDERGAAST (Rochester, MN, US)
- Timothy CAREY (Rochester, MN, US)
Cpc classification
G01N2469/20
PHYSICS
C12N15/1055
CHEMISTRY; METALLURGY
International classification
Abstract
The disclosure provides methods for determining the presence of coronavirus neutralizing antibodies in a sample as well as associated compositions and kits. The methods of the disclosure use recombinant vesicular stomatitis virus (VSV) particles, wherein the VSV glycoprotein (G) is replaced by a coronavirus spike(S) glycoprotein or a fragment or a derivative thereof. In a specific embodiment, the S glycoprotein is derived from Severe Acute Respiratory Syndrome coronavirus 2 (SARS-CoV-2) and the methods are used for determining the presence of SARS-CoV-2 neutralizing antibodies.
Claims
1. A replication competent recombinant rhabdovirus particle, wherein (i) the rhabdovirus glycoprotein (G) is replaced by a Severe Acute Respiratory Syndrome coronavirus 2 (SARS-CoV-2) spike (S) glycoprotein or a fragment of the SARS-CoV-2 S glycoprotein comprising the receptor binding domain thereof, and wherein (ii) the rhabdovirus particle comprises a nucleic acid molecule comprising a nucleic acid sequence encoding a reporter protein, wherein the nucleic acid sequence encoding the reporter protein is inserted between a nucleic acid sequence encoding the SARS-CoV-2 S glycoprotein or said fragment of the SARS-CoV-2 S glycoprotein, and a nucleic acid sequence encoding rhabdovirus large (L) protein.
2. The replication competent recombinant rhabdovirus particle of claim 1, wherein the reporter protein is a luciferase or a fluorescent protein.
3. The replication competent recombinant rhabdovirus particle of claim 1, wherein the recombinant rhabdovirus particle is a recombinant vesiculovirus particle.
4. The replication competent recombinant rhabdovirus particle of claim 1, wherein the recombinant rhabdovirus particle is a recombinant vesicular stomatitis virus (VSV) particle.
5. The replication competent recombinant rhabdovirus particle of claim 1, wherein: (i) the SARS-CoV-2 S glycoprotein is a full-length SARS-CoV-2 S glycoprotein; or (ii) the fragment is a SARS-CoV-2 S glycoprotein lacking the 19 C-terminal amino acids as specified in relation to the amino acid sequence of the SARS-CoV-2 full-length S glycoprotein of SEQ ID NO: 1; or (iii) the SARS-CoV-2 S glycoprotein comprises a mutation one or more amino acid insertions, deletions, and/or substitutions listed in Tables 8 and 9, wherein the positions of said insertions, deletions, and/or substitutions are specified in relation as compared to the amino acid sequence of the SARS-CoV-2 full-length S glycoprotein of SEQ ID NO: 1.
6. The replication competent recombinant rhabdovirus particle of claim 1, wherein the recombinant rhabdovirus particle comprises a mutant rhabdovirus matrix (M) protein.
7. The replication competent recombinant rhabdovirus particle of claim 1, wherein the recombinant rhabdovirus particle is a recombinant VSV particle comprising the mutant VSV M protein which comprises a mutation at methionine 51.
8. The replication competent recombinant rhabdovirus particle of claim 7, wherein the recombinant rhabdovirus particle is a recombinant VSV particle comprising the mutant VSV M protein which comprises a mutation at methionine 51 from methionine (M) to arginine (R).
9. A method for determining the presence of a SARS-Cov-2 neutralizing antibody in a sample, the method comprising: a) contacting the sample with a replication competent recombinant rhabdovirus particle according to claim 1; b) after step (a), contacting the replication competent recombinant rhabdovirus particle with the target cell; c) measuring a reporter signal in the cell after step (b); and d) comparing the reporter signal measured in step (c) with a control.
10. The method of claim 9, wherein the target cell is a Vero cell, or Vero-E6 cell.
11. The method of claim 9, further comprising adding a reporter protein substrate for obtaining the reporter signal.
12. The method of claim 11, wherein the reporter protein comprises a luciferase and the reporter protein substrate comprises Luciferin or EnduRen luciferase substrate.
13. The method of claim 9, wherein the sample is serum or plasma.
14. The method of claim 9, wherein the sample is heat-inactivated.
15. The method of claim 9, wherein the method further comprises diluting the sample by a factor of about 1:10 to about 1:320.
16. The method of claim 9, wherein the control is the reporter signal obtained with a control sample not comprising coronavirus neutralizing antibodies, and the method comprises concluding that the tested sample comprises the SARS-CoV-2 neutralizing antibodies when the reporter signal obtained in step (c) is reduced as compared to the control.
17. The method of claim 16, wherein the method comprises determining the concentration of SARS-CoV-2 neutralizing antibodies in the tested sample by comparing the reporter signal to a calibration curve determined from a serial dilution of the control sample comprising a SARS-CoV-2 neutralizing antibody, or a molecule that blocks interaction of the SARS-CoV-2 S glycoprotein with a protein with which the coronavirus S glycoprotein interacts on the target cell, or any combination thereof.
18. The method of claim 9, wherein the reporter signal is measured between about 24 to 30 hours after step (b).
19. The method of claim 9, wherein in step (a) the sample is contacted with the recombinant rhabdovirus particle for about 30 minutes at room temperature.
20. The method of claim 9, wherein the method is conducted in a high throughput format.
21. A polynucleotide encoding the replication competent recombinant rhabdovirus particle according to claim 1, wherein the polynucleotide comprises a nucleic acid sequence encoding a rhabdovirus nucleoprotein (N), a nucleic acid sequence encoding a rhabdovirus phosphoprotein (P), the nucleic acid sequence encoding the rhabdovirus L protein, the nucleic acid sequence encoding the SARS-CoV-2 S glycoprotein or said fragment of the SARS-CoV-2 S glycoprotein, and the nucleic acid sequence encoding the reporter protein inserted as specified in claim 1.
22. A kit for determining the presence of a SARS-Cov-2 neutralizing antibody in a sample comprising: a) a replication competent recombinant rhabdovirus particle according to claim 1, or a polynucleotide encoding the replication competent recombinant rhabdovirus particle according to claim 1, wherein the polynucleotide comprises a nucleic acid sequence encoding a rhabdovirus nucleoprotein (N), a nucleic acid sequence encoding a rhabdovirus phosphoprotein (P), the nucleic acid sequence encoding the rhabdovirus L protein, the nucleic acid sequence encoding the SARS-CoV-2 S glycoprotein or said fragment of the SARS-CoV-2 S glycoprotein, and the nucleic acid sequence encoding the reporter protein inserted as specified in claim 1; and b) a target cell.
23. The kit of claim 22, further comprising c) a control sample not comprising coronavirus neutralizing antibodies; and/or d) a control sample comprising a SARS-CoV-2 neutralizing antibody, or a molecule that blocks interaction of the SARS-CoV-2 S glycoprotein with a protein with which the SARS-Cov-2 S glycoprotein interacts on the target cell, or any combination thereof; and/or e) a substrate for the reporter protein; and/or f) instructions for use.
24. The replication competent recombinant rhabdovirus particle of claim 5, wherein the mutation is selected from the group consisting of N501Y, 69-70 deletion, P681H, Y144 deletion, A570D, T716I, S982A, D1118H, K417N, E484K, D614G, A701V, L18F, D80A, D215G, 242-244 deletion, R246I, K417T, T20N, P26S, D138Y, R190S, H655Y, T1027I, S131, W152C, L452R, Q677H, A22V, S477N, N439K, H69 deletion, V70 deletion, Y453F, 1692V, and M1229I, wherein the position of said mutation is specified in relation to the amino acid sequence of the SARS-CoV-2 full-length S glycoprotein of SEQ ID NO: 1.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
DETAILED DESCRIPTION
Definitions
(25) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs.
(26) Singular forms a, an, and the include plural references unless the context clearly dictates otherwise. Thus, for example, a reference to a method includes one or more methods, and/or steps of the type described herein and/or which will become apparent to those persons skilled in the art upon reading this disclosure.
(27) The term about or approximately includes being within a statistically meaningful range of a value. Such a range can be within an order of magnitude, preferably within 50%, more preferably within 20%, still more preferably within 10%, and even more preferably within 5% of a given value or range. The allowable variation encompassed by the term about or approximately depends on the particular system under study, and can be readily appreciated by one of ordinary skill in the art.
(28) The terms comprise(s), include(s), having, has, and contain(s), are intended to be open-ended transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures.
(29) The terms assay or test as used herein may be used interchangeably with the term method.
(30) Antibody as used herein encompasses polyclonal and monoclonal antibodies and refers to immunoglobulin molecules of classes IgA (e.g., IgA1 or IgA2), IgD, IgE, IgG (e.g., IgG1, IgG2, IgG3 and IgG4) or IgM, or fragments, or derivatives thereof, including without limitation Fab, F(ab) 2, Fd, single chain antibodies, diabodies, bispecific antibodies, bifunctional antibodies, humanized antibodies, and various derivatives thereof.
(31) In the context of the present disclosure, the term neutralizing antibody refers to an antibody that binds to a pathogen (e.g., a virus) and interferes with its ability to infect a cell. Non-limiting examples of neutralizing antibodies include antibodies that bind to a viral particle and inhibit successful transduction, e.g., one or more steps selected from binding, entry, trafficking to the nucleus, and transcription of the viral genome. Some neutralizing antibodies may block a virus at the post-entry step.
(32) The term immune response refers to a response of a cell of the immune system (e.g., a B-cell, T-cell, macrophage or polymorphonucleocyte) to a stimulus such as an antigen (e.g., a viral antigen). Active immune responses can involve differentiation and proliferation of immunocompetent cells, which leads to synthesis of antibodies or the development of cell-mediated reactivity, or both. An active immune response can be mounted by the host after exposure to an antigen (e.g., by infection or by vaccination). Active immune response can be contrasted with passive immunity, which can be acquired through the transfer of substances such as, e.g., an antibody, transfer factor, thymic graft, and/or cytokines from an actively immunized host to a non-immune host.
(33) As used herein in connection with a viral infection and vaccination, the terms protective immune response or protective immunity refer to an immune response that that confers some benefit to the subject in that it prevents or reduces the infection or prevents or reduces the development of a disease associated with the infection. Without wishing to be bound by theory, the presence of SARS-CoV-2 neutralizing antibodies in a subject can indicate the presence of a protective immune response in the subject.
(34) The terms immunogenic composition, vaccine composition, or vaccine, which are used interchangeably, refer to a composition comprising at least one immunogenic and/or antigenic component that induces an immune response in a subject (e.g., humoral and/or cellular response). In certain embodiments, the immune response is a protective immune response. A vaccine may be administered for the prevention or treatment of a disease, such as an infectious disease. A vaccine composition may include, for example, live or killed infectious agents, recombinant infectious agents (e.g., recombinant viral particles, virus-like particles, nanoparticles, liposomes, or cells expressing immunogenic and/or antigenic components), antigenic proteins or peptides, nucleic acids, etc. Vaccines may be administered with an adjuvant to boost the immune response.
(35) The term operably linked includes a linkage of nucleic acid elements in a functional relationship. A nucleic acid sequence is operably linked when it is placed into a functional relationship with another nucleic acid sequence. For instance, a promoter or enhancer, or a 5 regulatory region containing a promoter or enhancer, is operably linked to a coding sequence if it effects the transcription of the coding sequence.
(36) As used herein, the term promoter means a genetic sequence generally in cis and located upstream of a gene, and which facilitates the transcription of the gene. Promoters can be regulated (developmental, tissue specific, or inducible (chemical, temperature)) or constitutively active. In certain embodiments, the promoter is a constitutive mammalian promoter, such as the ubiquitin C promoter (see Schorpp et al., Nucl. Acids Res. 24 (9): 1787-1788, 1996); Byun et al., Biochem. Biophys. Res. Comm 332 (2): 518-523, 2005) or the CMV-IE promoter (see Addison et al., J. Gen. Virol. 78 (7): 1653-1661, 1997; Hunninghake et al., J. Virol. 63 (7): 3026-3033, 1989), or the hCMV-IE promoter (human cytomegalovirus immediate early gene promoter) (see Stinski & Roehr, J. Virol. 55 (2): 431-441, 1985; Hunninghake et al., J. Virol. 63 (7): 3026-3033, 1989). A promoter can comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of same. A promoter can also comprise distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription. A promoter can be derived from sources including viral, bacterial, fungal, plants, insects, and animals. A promoter can regulate the expression of a gene component constitutively or differentially with respect to cell, the tissue or organ in which expression occurs or, with respect to the developmental stage at which expression occurs, or in response to external stimuli such as physiological stresses, pathogens, metal ions, or inducing agents. Representative non-limiting examples of promoters include the bacteriophage T7 promoter, bacteriophage T3 promoter, SP6 promoter, lac operator-promoter, tac promoter, SV40 late promoter, SV40 early promoter, RSV-LTR promoter, CMV IE promoter, SV40 early promoter or SV40 late promoter and the CMV IE promoter.
(37) Signal peptide and leader sequence are used interchangeably herein and refer to an amino acid sequence that can direct localization of a polypeptide. A signal peptide may be capable of directing the polypeptide into a cell's secretory pathway. Signal peptides are often located at the N-terminus of the polypeptides and are often cleaved from the remainder of the polypeptide (often referred to as the mature protein), upon secretion from the cell.
(38) The terms derivative and variant are used herein interchangeably to refer to an entity that has significant structural identity with a reference entity but differs structurally from the reference entity in the presence or level of one or more chemical moieties as compared with the reference entity. In many embodiments, a derivative also differs functionally from its reference entity. In general, whether a particular entity is properly considered to be a derivative of a reference entity is based on its degree of structural identity with the reference entity. As will be appreciated by those skilled in the art, any biological or chemical reference entity has certain characteristic structural elements. A derivative, by definition, is a distinct entity that shares one or more such characteristic structural elements. To give but a few examples, a small molecule may have a characteristic core structural element (e.g., a macrocycle core) and/or one or more characteristic pendent moieties so that a derivative of the small molecule is one that shares the core structural element and the characteristic pendent moieties but differs in other pendent moieties and/or in types of bonds present (single vs double, E vs Z, etc.) within the core. Derivatives which are nucleic acids and polypeptides/proteins encompass mutants. A derivative nucleic acid may have a characteristic sequence element comprised of a plurality of nucleotide residues having designated positions relative to one another in linear or three-dimensional space. In some embodiments, the nucleic acid sequence of a derivative may be 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more identical over the full length of the reference sequence or a fragment thereof. A derivative peptide or polypeptide may have a characteristic sequence element comprised of a plurality of amino acids having designated positions relative to one another in linear or three-dimensional space and/or contributing to a particular biological function. Derivative peptides and polypeptides include peptides and polypeptides that differ in amino acid sequence from the reference peptide or polypeptide by the insertion, deletion, and/or substitution of one or more amino acids, but retain at least one biological activity of such reference peptide or polypeptide (e.g., the ability to mediate cell infection by a virus, the ability to mediate membrane fusion, the ability to be bound by a specific antibody or to promote an immune response, etc.). In some non-limiting embodiments, a derivative peptide or polypeptide shows the sequence identity over the full length with the reference peptide or polypeptide (or a fragment thereof) that is at least 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more. Alternatively or in addition, a derivative peptide or polypeptide may differ from a reference peptide or polypeptide as a result of one or more and/or one or more differences in chemical moieties attached to the polypeptide backbone (e.g., in glycosylation, phosphorylation, acetylation, myristoylation, palmitoylation, oxidation, formylation, amidation, polyglutamylation, ADP-ribosylation, pegylation, biotinylation, etc.). In some embodiments, a derivative peptide or polypeptide lacks one or more of the biological activities of the reference polypeptide or has a reduced or increased level of one or more biological activities as compared with the reference polypeptide. Derivatives of a particular peptide or polypeptide may be found in nature or may be synthetically or recombinantly produced. As used herein, the term derivative or variant also encompassed various chimeric, fusion proteins and conjugates, including fusions or conjugates with detection tags (e.g., HA tag, histidine tag, biotin, fusions with fluorescent or luminescent domains, etc.), dimerization/multimerization sequences, Fc, signaling sequences, etc.
(39) The term coronavirus as used herein refers to the subfamily Coronavirinae within the family Coronaviridae, within the order Nidovirales. Based on the phylogenetic relationships and genomic structures, this subfamily consists of four genera: Alphacoronavirus, Betacoronavirus, Gammacoronavirus and Deltacoronavirus. The alphacoronaviruses and betacoronaviruses infect only mammals. The gammacoronaviruses and deltacoronaviruses infect birds, but some of them can also infect mammals. Alphacoronaviruses and betacoronaviruses usually cause respiratory illness in humans and gastroenteritis in animals. The three highly pathogenic viruses, SARS-CoV-2, SARS-CoV-1 and MERS-CoV cause severe respiratory syndrome in humans. The other four human coronaviruses, HCoV-NL63, HCoV-229E, HCoV-OC43 and HKU1, induce only mild upper respiratory diseases in immunocompetent hosts, although some of them can cause severe infections in infants, young children and elderly individuals. Additional non-limiting examples of commercially important coronaviruses include transmissible gastroenteritis coronavirus (TGEV), porcine respiratory coronavirus, canine coronavirus, feline enteric coronavirus, feline infectious peritonitis virus, rabbit coronavirus, murine hepatitis virus, sialodacryoadenitis virus, porcine hemagglutinating encephalomyelitis virus, bovine coronavirus, avian infectious bronchitis virus, and turkey coronavirus. Reviewed in Cui et al., Nature Reviews Microbiology, 2019, 17:181-192; Fung et al., Annu. Rev. Microbiol., 2019, 73:529-557.
(40) Coronaviruses form enveloped and spherical particles of 80-160 nm in diameter. They contain a positive-sense, non-segmented, single-stranded RNA (ssRNA) genome of 27-32 kb in size. The 5-terminal two-thirds of the genome encodes polyproteins, pp1a and pp1ab. The 3 terminus encodes structural proteins, including envelope glycoproteins spike(S), envelope (E), membrane (M) and nucleocapsid (N). The genomic RNA is 5-capped and 3-polyadenylated and contains multiple open reading frames (ORFs). The invariant gene order is 5-replicase-S-E-M-N-3, with numerous small ORFs (encoding accessory proteins) scattered among the structural genes. The coronavirus replicase is encoded by two large overlapping ORFs (ORF1a and ORF1b) occupying about two-thirds of the genome and is directly translated from the genomic RNA (gRNA). The structural and accessory genes, however, are translated from subgenomic RNAs (sgRNAs) generated during genome transcription/replication. Infection starts with the attachment of the coronavirus to the cognate cellular receptor, which induces endocytosis. Membrane fusion typically occurs in the endosomes, releasing the viral nucleocapsid to the cytoplasm. The genomic RNA (gRNA) serves as the template for translation of polyproteins pp1a and pp1ab, which are cleaved to form nonstructural proteins (nsps). Nsps induce the rearrangement of cellular membrane to form double-membrane vesicles (DMVs), where the viral replication transcription complexes (RTCs) are anchored. Full-length gRNA is replicated via a negative-sense intermediate, and a nested set of subgenomic RNA (sgRNA) species are synthesized by discontinuous transcription. These sgRNAs encode viral structural and accessory proteins. Particle assembly occurs in the ER-Golgi intermediate complex (ERGIC), and mature virions are released in smooth-walled vesicles via the secretory pathway.
(41) Coronavirus entry into host cells is mediated by the transmembrane spike(S) glycoprotein (interchangeably referred to as spike glycoprotein, S glycoprotein, S protein or spike protein) which is the main target of anti-viral neutralizing antibodies and is the focus of therapeutic and vaccine design. S glycoprotein forms homotrimers protruding from the viral surface. S glycoprotein comprises two functional subunits responsible for binding to the host cell receptor (S1 subunit) and fusion of the viral and cellular membranes (S2 subunit). For many coronaviruses, including SARS-CoV-1 and SARS-CoV-2, S glycoprotein is cleaved at the boundary between the S1 and S2 subunits, which remain non-covalently bound in the prefusion conformation. The distal S1 subunit comprises the receptor-binding domain(s) (RBD) and contributes to stabilization of the prefusion state of the membrane-anchored S2 subunit that contains the fusion machinery. S is further cleaved by host proteases at the S2 site located immediately upstream of the fusion peptide. This cleavage has been proposed to activate the protein for membrane fusion via conformational changes. Walls et al., Cell, published online Mar. 9, 2020; available at doi.org/10.1016/j.cell.2020.02.058.
(42) SARS-CoV-1 and SARS-CoV-2 interact directly with angiotensin-converting enzyme 2 (ACE2) to enter target cells and may employ the cellular serine protease, transmembrane protease, serine 2 (TMPRSS2) for S protein priming (Hoffmann et al., Cell, 2020, 181:1-10; available at doi.org/10.1016/j.cell.2020.02.052). SARSCoVS and SARS-CoV-2-S share 76% amino acid identity. The receptor binding domain (RBD) in the S glycoprotein is involved in binding to the ACE2 receptor. Six RBD amino acids have been shown to be critical for binding to the ACE2 receptor and for determining the host range of SARS-CoV-like viruses. They are Y442, L472, N479, D480, T487 and Y4911 in SARS-CoV, which correspond to L455, F486, Q493, S494, N501 and Y505 in SARS-CoV-2 (Andersen et al., Nature Medicine, 2020; available at doi.org/10.1038/s41591-020-0820-9).
(43) The term rhabdovirus as used herein refers to Rhabdoviridae family of viruses in the order Mononegavirales encompassing more than 150 viruses of vertebrates, invertebrates and plants. Examples of rhabdoviruses include rabies virus (RABV) from the Lyssavirus genus, vesiculoviruses from Vesiculovirus genus, the viral hemorrhagic septicemia virus (VHSV) and infectious hematopoietic necrosis virus, both from the Novirhabdovirus genus. Rhabdoviruses are bullet-shaped enveloped viruses with negative-sense single-stranded RNA genome 11-15 kb in length. The genome of rhabdoviruses comprises up to ten genes among which only five are common to all members of the family. These genes encode the nucleoprotein (N), the phosphoprotein (P), the matrix protein (M), the glycoprotein (G) and the large protein (L). The genome is associated with N, L and P to form the nucleocapsid, which is condensed by the M protein into a tightly coiled helical structure. The condensed nucleocapsid is surrounded by a lipid bilayer containing the viral glycoprotein G that constitutes the spikes that protrude from the viral surface. Rhabdoviruses enter the cell via the endocytic pathway and subsequently fuse with the cellular membrane within the acidic environment of the endosome. Both receptor recognition and membrane fusion are mediated by a single transmembrane viral glycoprotein (G). Fusion between the viral envelope and the endosomal membrane is triggered via a low-pH induced (in the endosome) structural rearrangement of the G resulting in the release the viral genome and associated proteins into the cytoplasm of target cells.
(44) As used herein, the term vesiculovirus refers to any virus in the Vesiculovirus genus. Non-limiting examples of vesiculoviruses include, e.g., Vesicular Stomatitis Virus (VSV) (e.g., VSV-New Jersey, VSV-Indiana), Alagoas vesiculovirus, Cocal vesiculovirus, Jurona vesiculovirus, Carajas vesiculovirus, Maraba vesiculovirus, Piry vesiculovirus, Calchaqui vesiculovirus, Yug Bogdanovac vesiculovirus, Isfahan vesiculovirus, Chandipura vesiculovirus, Perinct vesiculovirus, Porton-S vesiculovirus. Vesicular Stomatitis Virus (VSV), in the Vesiculovirus genus, is a prototypic rhabdovirus. While VSV is used as an example in the present disclosure, this disclosure can also be used for other vesiculoviruses and other rhabdoviruses. There are two major serotypes of VSV, New Jersey and Indiana, both of which can infect insects and mammals, causing economically important diseases in cattle, equines and swine. The VSV genome is composed of single-stranded, negative-sense RNA of 11-12 kb, which encodes five viral proteins: the nucleoprotein (N), the phosphoprotein (P), the matrix protein (M), the glycoprotein (G) and the large protein (L). G monomers associate to form trimeric spikes anchored in the viral membrane. Reviewed in, e.g., Sun et al., Future Virol., 2010, 5 (1): 85-96 and Aurlie et al., Viruses 2012, 4:117-139.
(45) As used herein, the phrase non-essential portion(s) of the recombinant VSV genome refers to a region of the VSV genome that can be modified without affecting the development and/or growth of the virus in vitro and/or in vivo and without affecting the virus's functions required to act as an immunogenic composition or vaccine.
(46) As used herein in connection with various recombinant enveloped viral particles, the term pseudotyped refers to viral particles comprising in their lipid envelope molecules, e.g., proteins, glycoproteins, etc, which are mutated and/or heterologous compared to molecules typically found on the surface of a virus from which the particles are derived (i.e., a reference virus), and which may affect, contribute to, direct, redirect and/or completely change the tropism of the viral particle in comparison to the reference virus. In some embodiments, a viral particle is pseudotyped such that it recognizes, binds and/or infects a target (ligand or cell) that is different to that of the reference virus. In some embodiments, a viral particle is pseudotyped such that it does not recognize, bind, and/or infect a target (ligand or cell) of the reference virus.
(47) The term fusogen or fusogenic molecule is used herein to refer to any molecule that can trigger membrane fusion when present on the surface of a virus particle. A fusogen can be, for example, a protein (e.g., a viral glycoprotein) or a fragment or derivative thereof.
(48) The term replication-competent is used herein to refer to viruses (including wild-type and recombinant viral particles) that are capable of infecting and propagating within a susceptible cell.
(49) The term encoding as used herein can refer to encoding from either the (+) or () sense strand of the polynucleotide for expression in the virus particle.
(50) The terms specifically binds, specifically adheres, specifically targets, selectively binds or binding specificity refer to the ability of spike(S) glycoproteins, recombinant viral particles, vaccines, neutralizing antibodies, or other molecules described herein to bind to their target. In certain embodiments, specific binding refers to binding to a target with an affinity that is at least 10, 50, 100, 250, 500, or 1000 times greater than the affinity for a non-target. In certain embodiments, this affinity is determined by an affinity ELISA assay. In certain embodiments, affinity is determined by a BIAcore assay. In certain embodiments, affinity is determined by a kinetic method. In certain embodiments, affinity is determined by an equilibrium/solution method.
(51) As used herein, the term reporter protein refers to any protein which produces a detectable quantifiable signal when present in a cell. Non-limiting examples of reporter proteins useful in the assays of the present disclosure include, e.g., luciferases (including but not limited to, Renilla luciferase, mutant Renilla luciferase RLuc 8, (dCpG) Luciferase, NanoLuc reporter, firefly luciferase, Gaussia luciferase (gLuc), MetLuc, Vibrio fischeri lumazine protein, Vibrio harveyi luminaze protein, inoflagellate luciferase, firefly luciferase YY5 mutant, firefly luciferase LGR mutant, firefly luciferase mutant E, and derivatives thereof) and fluorescent proteins (including but not limited to, green fluorescent protein (GFP) [e.g., Aequoria victoria GFP, Renilla muelleri GFP, Renilla reniformis GFP, Renilla ptilosarcus GFP], GFP-like fluorescent proteins, (GFP-like), enhanced green fluorescent protein (EGFP), yellow fluorescent protein (YFP) [e.g., Topaz, Venus, mCitrine, YPet, TagYFP, PhiYFP, ZsYellow1, mBanana], enhanced yellow fluorescent protein (EYFP), blue fluorescent protein (BFP) [e.g., EBFP2, Azurite, GFP2, GFP10, and mTagBFP], enhanced blue fluorescent protein (EBFP), cyan fluorescent protein (CFP) [e.g., mECFP, Cerulean, CyPet, AmCyan1, Midori-Ishi Cyan, TagCFP, mCFPmm, mTFP1 (Teal)], enhanced cyan fluorescent protein (ECFP), superfolder GFP, superfolder YFP, orange fluorescent protein [e.g., Kusabira Orange, Kusabira Orange2, mOrange, mOrange2, dTomato, dTomato-Tandem, TagRFP, TagRFP-T, DsRed, DsRed2, DsRed-Express (T1), DsRed-Monomer, mTangerine], red fluorescent protein [e.g., mRuby, mApple, mStrawberry, AsRed2, mRFP1, JRed, mCherry, HcRed1, mRaspberry, dKeima-Tandem, HcRed-Tandem, mPlum, tdTomato, AQ143], small ultrared fluorescent protein, FMN-binding fluorescent protein, dsRed, qFP611, Dronpa, TagRFP, KFP, EosFP, IrisFP, Dendra, Kaede, KikGr1, emerald fluorescent protein, Azami Green, mWasabi, TagGFP, TurboGFP, AcGFP, ZsGreen, T-Sapphire, and derivatives thereof), -galactosidase, -glucuronidase, -geo, etc.
(52) The term effective applied to dose or amount refers to that quantity of a compound (e.g., a recombinant virus) or composition (e.g., pharmaceutical, vaccine or immunogenic composition) that is sufficient to result in a desired activity upon administration to a subject in need thereof. Note that when a combination of active ingredients is administered, the effective amount of the combination may or may not include amounts of each ingredient that would have been effective if administered individually. The exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the condition being treated, the particular drug or drugs employed, the mode of administration, and the like.
(53) In the context of the present disclosure insofar as it relates to any of the disease conditions recited herein, the terms treat, treatment, and the like mean to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression of such condition. Within the meaning of the present disclosure, the term treat also denotes to arrest, delay the onset (i.e., the period prior to clinical manifestation of a disease) and/or reduce the risk of developing or worsening a disease. The terms treat, treatment, and the like regarding a state, disorder or condition may also include (1) preventing or delaying the appearance of at least one clinical or sub-clinical symptom of the state, disorder or condition developing in a subject that may be afflicted with or predisposed to the state, disorder or condition but does not yet experience or display clinical or subclinical symptoms of the state, disorder or condition; or (2) inhibiting the state, disorder or condition, i.e., arresting, reducing or delaying the development of the disease or a relapse thereof (in case of maintenance treatment) or at least one clinical or sub-clinical symptom thereof; or (3) relieving the disease, i.e., causing regression of the state, disorder or condition or at least one of its clinical or sub-clinical symptoms. Non-limiting examples of the symptoms of the COVID-19 disease, include, without limitation, fever, cough, shortness of breath, pneumonia, acute respiratory distress syndrome (ARDS), acute lung syndrome, loss of sense of smell, loss of sense of taste, sore throat, nasal discharge, gastro-intestinal symptoms (e.g., diarrhea), organ failure (e.g., kidney failure and renal dysfunction), septic shock, and death. When used in connection with a disease caused by a viral infection (e.g., SARS-CoV-2 infection), the terms prevent, preventing or prevention refer to prevention of spread of infection in a subject exposed to the virus, e.g., prevention of the virus from entering the subject's cells.
(54) The terms individual or subject or patient or animal refers to humans, veterinary animals (e.g., cats, dogs, cows, horses, sheep, pigs, etc.), veterinary avian species, and experimental animal models of diseases (e.g., mice, rats, ferrets, monkeys, etc.). In a preferred embodiment, the subject is a human.
(55) The terms nucleic acid, polynucleotide and nucleotide are used interchangeably and encompass both DNA and RNA, including positive- and negative-stranded, single- and double-stranded, unless specified otherwise.
(56) The phrase pharmaceutically acceptable, as used in connection with compositions described herein, refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to a subject (e.g., a human). Preferably, the term pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans.
(57) The practice of the present disclosure employs, unless otherwise indicated, conventional techniques of statistical analysis, molecular biology (including recombinant techniques), virology, microbiology, cell biology, chemistry and biochemistry, which are within the skill of the art. Such tools and techniques are described in detail in e.g., Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press, 1989 (herein Sambrook et al., 1989); DNA Cloning: A Practical Approach, Volumes I and II (D. N. Glover ed. 1985); Oligonucleotide Synthesis (M. J. Gait ed. 1984); Nucleic Acid Hybridization [B. D. Hames & S. J. Higgins eds. (1985)]; Transcription And Translation [B. D. Hames & S. J. Higgins, eds. (1984)]; Animal Cell Culture [R. I. Freshney, ed. (1986)]; Immobilized Cells And Enzymes [IRL Press, (1986)]; B. Perbal, A Practical Guide To Molecular Cloning (1984); Ausubel, F. M. et al. (eds.). Current Protocols in Molecular Biology. John Wiley & Sons, Inc., 1994. These techniques include site directed mutagenesis as described in Kunkel, Proc. Natl. Acad. Sci. USA 82:488-492 (1985), U.S. Pat. No. 5,071,743, Fukuoka et al., Biochem. Biophys. Res. Commun. 263:357-360 (1999); Kim and Maas, BioTech. 28:196-198 (2000); Parikh and Guengerich, BioTech. 24:4 28-431 (1998); Ray and Nickoloff, BioTech. 13:342-346 (1992); Wang et al., BioTech. 19:556-559 (1995); Wang and Malcolm, BioTech. 26:680-682 (1999); Xu and Gong, BioTech. 26:639-641 (1999), U.S. Patents Nos. 5,789, 166 and 5,932, 419, Hogrefe, Strategies 14. 3:74-75 (2001), U.S. Pat. Nos. 5,702,931, 5,780,270, and 6,242,222, Angag and Schutz, Biotech. 30:486-488 (2001), Wang and Wilkinson, Biotech. 29:976-978 (2000), Kang et al., Biotech. 20:44-46 (1996), Ogel and McPherson, Protein Engineer. 5:467-468 (1992), Kirsch and Joly, Nucl. Acids. Res. 26:1848-1850 (1998), Rhem and Hancock, J. Bacteriol. 178:3346-3349 (1996), Boles and Miogsa, Curr. Genet. 28:197-198 (1995), Barrenttino et al., Nuc. Acids. Res. 22:541-542 (1993), Tessier and Thomas, Meths. Molec. Biol. 57:229-237, and Pons et al., Meth. Molec. Biol. 67:209-218.
(58) Viral Particles
(59) One aspect of the disclosure provides recombinant vesicular stomatitis virus (VSV) particles. VSV is an attractive virus for production of recombinant viral particles, because it can be produced in high titers and does not cause serious pathology in humans. In certain embodiments, in the recombinant VSV particles of the disclosure, the VSV glycoprotein (G) is replaced by a coronavirus spike(S) glycoprotein or a fragment or a derivative thereof
(60) Recombinant VSV particles of the disclosure can be produced using methods known in the art, e.g., by providing in an appropriate host cell: (a) DNA that can be transcribed to encode VSV antigenomic (+) RNA (complementary to the VSV genome), (b) a recombinant source of VSV nucleoprotein (N) protein, (c) a recombinant source of VSV phosphoprotein (P) protein, (d) a recombinant source of VSV large protein (L), and (e) foreign DNA; under conditions such that the DNA is transcribed to produce the antigenomic RNA, and a VSV is produced that contains genomic RNA complementary to the antigenomic RNA produced and foreign RNA, which is not naturally a part of the VSV genome, from the DNA. Methods and compositions useful for generating recombinant VSV particles may be found, for example, in U.S. Pat. Nos. 7,153,510; 9,861,668; 8,012,489; 9,630,996; 8,287,878; 9,248,178 U.S. Patent Publication Nos. 2014/0271564; 2012/0121650; Fukishi et al., J. Gen. Virol., 2005, 86:2269-2274, all of which are incorporated by reference herein in their entirety.
(61) In certain embodiments, the foreign RNA contained within the genome of the recombinant VSV particles, upon expression in an appropriate host cell, produces one or more foreign proteins. In certain embodiments, one foreign protein is a coronavirus spike(S) glycoprotein (e.g., S glycoprotein from SARS-CoV-2) or a fragment or derivative thereof as described in greater detail below.
(62) In certain embodiments, in addition to encoding a coronavirus spike(S) glycoprotein (e.g., S glycoprotein from SARS-CoV-2) or a fragment or derivative thereof, the genome of the recombinant VSV encodes a reporter protein. Non-limiting examples of reporter proteins include, e.g., luciferases (including but not limited to, Renilla luciferase, RLuc8 mutant Renilla luciferase, (dCpG) Luciferase, NanoLuc reporter, firefly luciferase, Gaussia luciferase (gLuc), MetLuc, Vibrio fischeri lumazine protein, Vibrio harveyi luminaze protein, inoflagellate luciferase, firefly luciferase YY5 mutant, firefly luciferase LGR mutant, firefly luciferase mutant E, and derivatives thereof) and fluorescent proteins (including but not limited to, green fluorescent protein (GFP) [e.g., Aequoria victoria GFP, Renilla muelleri GFP, Renilla reniformis GFP, Renilla ptilosarcus GFP], GFP-like fluorescent proteins, (GFP-like), enhanced green fluorescent protein (EGFP), yellow fluorescent protein (YFP) [e.g., Topaz, Venus, mCitrine, YPet, TagYFP, PhiYFP, ZsYellow1, mBanana], enhanced yellow fluorescent protein (EYFP), blue fluorescent protein (BFP) [e.g., EBFP2, Azurite, GFP2, GFP10, and mTagBFP], enhanced blue fluorescent protein (EBFP), cyan fluorescent protein (CFP) [e.g., mECFP, Cerulean, CyPet, AmCyan1, Midori-Ishi Cyan, TagCFP, mCFPmm, mTFP1 (Teal)], enhanced cyan fluorescent protein (ECFP), superfolder GFP, superfolder YFP, orange fluorescent protein [e.g., Kusabira Orange, Kusabira Orange2, mOrange, mOrange2, dTomato, dTomato-Tandem, TagRFP, TagRFP-T, DsRed, DsRed2, DsRed-Express (T1), DsRed-Monomer, mTangerine], red fluorescent protein [e.g., mRuby, mApple, mStrawberry, AsRed2, mRFP1, JRed, mCherry, HcRed1, mRaspberry, dKeima-Tandem, HcRed-Tandem, mPlum, tdTomato, AQ143], small ultrared fluorescent protein, FMN-binding fluorescent protein, dsRed, qFP611, Dronpa, TagRFP, KFP, EosFP, IrisFP, Dendra, Kaede, KikGr1, emerald fluorescent protein, Azami Green, mWasabi, TagGFP, TurboGFP, AcGFP, ZsGreen, T-Sapphire, and derivatives thereof), -galactosidase, -glucuronidase, -geo, etc.
(63) In certain alternative embodiments, the one or more foreign proteins (e.g., a coronavirus S glycoprotein and/or a reporter protein) are not encoded by the genome of the recombinant VSV particle but are incorporated into said VSV particle as proteins upon production of the recombinant viral particles.
(64) In certain embodiments, the recombinant VSV particle is a replication competent viral particle. In certain embodiments, the recombinant VSV particle is a replication-defective viral particle.
(65) In certain embodiments, the recombinant VSV particles of the disclosure are used for seropositivity assays for determining the presence of a coronavirus neutralizing antibody (e.g., a SARS-CoV-2 neutralizing antibody) in a sample from a subject. Such seropositivity assays can be used, for example, for determining whether or not the subject was previously infected by said coronavirus and has produced neutralizing antibodies protecting such subject from the infection (and thus allowing such subject to return to work, etc.). Seropositivity assays of the disclosure can be also used, for example, for determining effectiveness of vaccination, for development of therapeutic antibodies, for selecting best donors for convalescent plasma therapy, for patient contact tracing, for identifying the viral reservoir hosts, for determining the burden of disease, for determining the rate of asymptomatic infections, for identifying the extent of virus spread in households, communities, and specific settings, etc.
(66) In certain embodiments, the seropositivity assays of the disclosure use more than one type of recombinant VSV particles. In certain embodiments, such assays use a mixture of two or more recombinant VSV particles encoding different coronaviral S glycoproteins (e.g., SARS-CoV-2 S glycoproteins originating from different viral strains, variants or mutants).
(67) In certain aspects, the current disclosure provides cells for production of the recombinant VSV particles of the disclosure. Exemplary cells include, but are not limited to, any cell in which VSV grows, e.g., mammalian cells and some insect (e.g., Drosophila) cells. A vast number of primary cells and cell lines commonly known in the art can be used as host cells. By way of example, useful cell lines include but are not limited to BHK (baby hamster kidney) cells, CHO (Chinese hamster ovary) cells, HeLA (human) cells, mouse L cells, Vero (monkey) cells (including Vero-His cells), Vero-Ace-2 cells, Vero-TRMPSS2 cells, Vero-E6 cells, ESK-4, PK-15, EMSK cells, MDCK (Madin-Darby canine kidney) cells, MDBK (Madin-Darby bovine kidney) cells, 293 (human) cells, Hep-2 cells, primary chick embryo fibroblasts, primary chick embryo fibroblasts, quasi-primary continuous cell lines (e.g. AGMK-African green monkey kidney cells), human diploid primary cell lines (e.g. WI-38 and MRC5 cells), and Monkey Diploid Cell Line (e.g. FRhL-Fetal Rhesus Lung cells).
(68) VSV DNA for Transcription to Produce VSV Antigenomic (+) RNA
(69) Vesicular Stomatitis Virus (VSV) is a rhabdovirus that comprises a single (non-segmented) negative-stranded genomic RNA that is generally transcribed by a virion polymerase into five mRNAs encoding five structural proteins. The five structural proteins include glycoprotein (G), large protein (L), phosphoprotein (P), matrix protein (M), and nucleoprotein (N). The nucleocapsid protein encapsidates the RNA genome. Two proteins that form a polymerase complex are bound to the nucleocapsid. A matrix (M) protein is associated with the nucleocapsid and the membrane. A single (transmembrane) envelope spike glycoprotein (G) extends from the viral envelope. The G protein functions to bind virus to a cellular receptor and to catalyze fusion of the viral membrane with cellular membranes to initiate the infectious cycle. The size of the VSV genome is about 11 kilobases.
(70) VSV can be transmitted to a variety of mammalian hosts, generally cattle, horses, swine and rodents. VSV infection of humans is uncommon, and in general is either asymptomatic or characterized by mild flu-like symptoms that resolve in three to eight days without complications. VSV is not considered a human pathogen and pre-existing immunity to VSV is rare in the human population making VSV an attractive viral vector for vaccine and therapeutic applications. Other beneficial characteristics of VSV include, but are not limited to, (i) ability to replicate robustly in cell culture, (ii) inability to either integrate into host cell DNA or undergo genetic recombination, (iii) multiple serotypes can allow for prime-boost immunization strategies, and (iv) foreign genes of interest can be inserted into the VSV genome and expressed abundantly by the viral transcriptase.
(71) Fusion of rhabdoviruses (e.g., VSV) to cells, and their subsequent uptake, is described in Belot, L. et al., Structural and cellular biology of rhabdovirus entry, Adv. Virus Res., 2019, 104:147-183, which is incorporated by reference herein in its entirety, and Albertini, A. A. V. et al., Molecular and Cellular Aspects of Rhabdovirus Entry Viruses, 2012, 4:117-139, which is incorporated by reference herein in its entirety. Further description of endocytosis of VSV is found in Sun, X. et al., Internalization and fusion mechanism of vesicular stomatitis virus and related rhabdoviruses Future Virol., 2010, 5 (1): 85-96, which is incorporated by reference herein in its entirety. For general information on virus-cell fusion, see Igonet, S. et al., SnapShot: Viral and Eukaryotic Protein Fusogens Cell, 2012, 151: 1634el, which is incorporated by reference herein in its entirety.
(72) Cell-cell fusion mediated by other viruses, such as HIV virus, has been described in Kondo, N. et al., Conformational changes of the HIV-1 envelope protein during membrane fusion are inhibited by the replacement of its membrane-spanning domain Journ. Biol. Chem., 2010, 285 (19): 14681-88, which is incorporated by reference herein in its entirety.
(73) Many vesiculoviruses are known in the art and can be made recombinant according to the methods disclosed herein. Non-limiting examples of such vesiculoviruses are listed below:
(74) TABLE-US-00001 Virus Source of virus in nature VSV-New Jersey Mammals, mosquitoes, midges, blackflies, houseflies VSV-Indiana Mammals, mosquitoes, sandflies Alagoas Mammals, sandflies Cocal Mammals, mosquitoes, mites Jurona Mosquitoes Carajas Sandflies Maraba Sandflies Piry Mammals Calchaqui Mosquitoes Yug Bogdanovac Sandflies Isfahan Sandflies, ticks Chandipura Mammals, sandflies Perinct Mosquitoes, sandflies Porton-S Mosquitoes
(75) In certain embodiments, VSVs are the vesiculoviruses used to make the recombinant viruses of the disclosure. In certain embodiments, the recombinant VSV is a recombinant VSV-New Jersey or VSV-Indiana. In certain embodiments, the recombinant VSV is a recombinant VSV-New Jersey. VSV is used as an example in the disclosure below, and this disclosure can also be used for other vesiculoviruses.
(76) Any DNA that can be transcribed to produce VSV antigenomic (+) RNA (complementary to the VSV genome) can be used for the construction of a recombinant DNA containing foreign DNA encoding a heterologous (foreign) protein or peptide, for use in producing the recombinant VSV particles of the disclosure. In certain embodiments, the DNA that can be transcribed to encode VSV antigenomic (+) RNA comprises at least genes for the VSV nucleoprotein (N), the VSV phosphoprotein (P), and the VSV large protein (L).
(77) The VSV vector can be genetically modified to include one or more mutations or mutation classes in the genome. Mutation class, mutation classes or classes of mutation are used interchangeably, and refer to mutations known in the art, when used singly, to attenuate VSV. Exemplary mutation classes include, but are not limited to, a VSV temperature-sensitive N gene mutation (hereinafter, N(ts)), a temperature-sensitive L gene mutation (hereinafter, L(ts)), a point mutation, a G-stem mutation (hereinafter, G(stem)), a non-cytopathic M gene mutation (hereinafter, M(ncp)), a gene shuffling or rearrangement mutation, a truncated G gene mutation (hereinafter, G(ct)), an ambisense RNA mutation, a G gene insertion mutation, a gene deletion mutation and the like. Mutations can be insertions, deletions, substitutions, gene rearrangement or shuffling modifications.
(78) In certain embodiments of the methods disclosed herein, the recombinant VSV particle is replication-competent. In certain other embodiments, the recombinant VSV particle is replication-deficient.
(79) In certain embodiments of the methods and compositions disclosed herein, in the recombinant VSV particle, the VSV G glycoprotein is replaced by a coronavirus spike(S) glycoprotein, or a fragment or derivative thereof, wherein said S glycoprotein, fragment or derivative is capable of mediating infection of a target cell. In certain embodiments, the genome of the recombinant VSV particle lacks a functional VSV G gene and encodes a coronavirus spike(S) glycoprotein, or a fragment or derivative thereof. Also provided is a VSV particle wherein (i) the VSV glycoprotein (G) is replaced by a coronavirus spike(S) glycoprotein or a fragment or a derivative thereof, wherein said S glycoprotein, fragment or derivative is capable of mediating infection of a target cell and wherein (ii) the VSV particle comprises a reporter protein and/or a nucleic acid molecule encoding said reporter protein. The nucleic acid sequence encoding the reporter protein may be inserted between the nucleic acid sequence encoding the S glycoprotein and the nucleic acid sequence encoding VSV large (L) protein.
(80) The mutations can attenuate the infectivity, virulence or pathogenic effects of VSV. The attenuation can be additive or synergistic. With synergistic attenuation, the level of VSV attenuation is greater than additive. Synergistic attenuation of VSV can arise from combining at least two classes of mutation in the same VSV genome, thereby resulting in a reduction of VSV pathogenicity much greater than an additive attenuation level observed for each VSV mutation class alone. A synergistic attenuation of VSV can provide for an LD50 at least greater than the additive attenuation level observed for each mutation class alone (i.e., the sum of the two mutation classes), where attenuation levels (i.e., the LD50) are determined in a small animal neurovirulence model.
(81) The VSV M gene encodes the virus matrix (M) protein, and two smaller in-frame polypeptides (M2 and M3). The M2 and M3 polypeptides can be translated from the same open reading frame (ORF) as the M protein and lack the first 33 and 51 amino acids, respectively. A recombinant VSV vector comprising non-cytopathic M gene mutations (i.e., VSV vectors that also do not express M2 and M3 proteins) can be generated and can further comprise one or more additional mutation(s) thereby resulting in a VSV vector that was highly attenuated in cell culture and in animals.
(82) In certain embodiments, the recombinant VSV particles of the disclosure comprise a non-cytopathic mutation in the M gene. The VSV (Indiana serotype) M gene encodes a 229 amino acid M (matrix) protein in which the first thirty amino acids of the NH2-terminus comprise a proline-rich PPPY (PY) motif (SEQ ID NO: 68). The PY motif of VSV M protein is located at amino acid positions 24-27 in both VSV Indiana (Genbank Accession Number X04452) and New Jersey (Genbank Accession Number M14553) serotypes. The VSV may comprise mutations in the PY motif (e.g., APPY (SEQ ID NO: 69), AAPY (SEQ ID NO: 70), PPAY (SEQ ID NO: 71), APPA (SEQ ID NO: 72), AAPA (SEQ ID NO: 73) and PPPA (SEQ ID NO: 74)). The VSV can comprise any of various amino acid mutations (e.g., deletions, substitutions, insertions, etc.) into the M protein PSAP (PS) motif (SEQ ID NO: 75). These and other mutations in the PY motif may be effective to reduce virus yield by blocking a late stage in virus budding.
(83) The recombinant VSV particles of the disclosure may comprise one or more M gene mutations. Non-limiting examples of M protein mutations include, e.g., a glycine changed to a glutamic acid at position (21), a leucine changed to a phenylalanine at position (111), a methionine changed to an arginine at position (51), a glycine changed to a glutamic acid at position (22), a methionine changed to an arginine at position (48), a leucine changed to a phenylalanine at position (110), a methionine changed to an alanine at position (51), and a methionine changed to an alanine at position (33). See, e.g., U.S. Pat. No. 9,630,996. In various embodiments of the methods described herein, the genome of the recombinant VSV encodes a mutant VSV matrix M protein comprising the M51R mutation. Mutation M51R eliminates M protein's ability to block cellular nucleo-cytoplasmic transport and thus substantially attenuates VSV infectivity.
(84) In certain embodiments, the DNA that can be transcribed to encode VSV antigenomic (+) RNA comprises a gene that encodes a VSV M protein. In certain embodiments, the VSV M protein used in the methods and compositions described herein may comprise the amino acid sequence of SEQ ID NO: 9, or a sequence at least 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more identical to the amino acid sequence of SEQ ID NO: 9. In certain embodiments, the VSV M protein used in the vaccines or methods described herein may consist of the amino acid sequence of SEQ ID NO: 9, or a sequence at least 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more identical to the amino acid sequence of SEQ ID NO: 9. In certain embodiments, the mutated VSV M protein used in the vaccines or methods described herein may comprise the amino acid sequence of SEQ ID NO: 7, or a sequence at least 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more identical to the amino acid sequence of SEQ ID NO: 7. In certain embodiments, the mutant VSV M protein used in the vaccines or methods described herein may consist of the amino acid sequence of SEQ ID NO: 7, or a sequence at least 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more identical to the amino acid sequence of SEQ ID NO: 7.
(85) DNA that can be transcribed to produce VSV (for example) antigenomic (+) RNA (such DNA being referred to herein as VSV () DNA) is available in the art and/or can be obtained by standard methods. VSV () DNA for any serotype or strain known in the art, e.g., the New Jersey or Indiana serotypes of VSV, can be used. The complete nucleotide and deduced protein sequence of the VSV genome is known, and is available as Genbank VSVCG, Accession No. J02428; NCBI Seq ID 335873; and is published in Rose and Schubert, 1987, in The Viruses: The Rhabdoviruses, Plenum Press, NY, pp. 129-166. An example of the complete sequence of the VSV () DNA that is contained in plasmid pVSVFL (+) is shown, e.g., in U.S. Pat. No. 7,153,510, which is incorporated herein in its entirety for all intended purposes. Sequences of other vesiculovirus genomes have been published and are available in the art.
(86) VSV () DNA, if not already available, can be prepared by standard methods, as follows: VSV genomic RNA can be purified from virus preparations, and reverse transcription with long distance polymerase chain reaction used to generate the v () DNA. Alternatively, after purification of genomic RNA, VSV mRNA can be synthesized in vitro, and cDNA prepared by standard methods, followed by insertion into cloning vectors (see, e.g., Rose and Gallione, 1981, J. Virol. 39 (2): 519-528). Individual cDNA clones of VSV RNA can be joined by use of small DNA fragments covering the gene junctions, generated by use of reverse transcription and polymerase chain reaction (RT-PCR) (Mullis and Faloona, 1987, Meth. Enzymol. 155:335-350) from VSV genomic RNA (see Section 6, infra). VSV and other vesiculoviruses are available in the art.
(87) In certain embodiments, one or more, usually unique, restriction sites (e.g., in a polylinker) are introduced into the VSV () DNA, in intergenic regions, or 5 of the sequence complementary to the 3 end of the VSV genome, or 3 of the sequence complementary to the 5 end of the VSV genome, to facilitate insertion of the foreign DNA.
(88) In certain embodiments, the VSV () DNA is constructed so as to have a promoter operatively linked thereto. The promoter should be capable of initiating transcription of the () DNA in an animal or insect cell in which it is desired to produce the recombinant VSV. Promoters which may be used include, but are not limited to, the SV40 early promoter region (Bernoist and Chambon, 1981, Nature 290:304-310), the promoter contained in the 3 long terminal repeat of Rous sarcoma virus (Yamamoto, et al., 1980, Cell 22:787-797), the herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci. U.S.A. 78:1441-1445), the regulatory sequences of the metallothionein gene (Brinster et al., 1982, Nature 296:39-42); heat shock promoters (e.g., hsp70 for use in Drosophila S2 cells); the ADC (alcohol dehydrogenase) promoter, PGK (phosphoglycerol kinase) promoter, alkaline phosphatase promoter, and the following animal transcriptional control regions, which exhibit tissue specificity and have been utilized in transgenic animals: elastase I gene control region which is active in pancreatic acinar cells (Swift et al., 1984, Cell 38:639-646; Ornitz et al., 1986, Cold Spring Harbor Symp. Quant. Biol. 50:399-409; MacDonald, 1987, Hepatology 7:425-515); insulin gene control region which is active in pancreatic beta cells (Hanahan, 1985, Nature 315:115-122), immunoglobulin gene control region which is active in lymphoid cells (Grosschedl et al., 1984, Cell 38:647-658; Adames et al., 1985, Nature 318:533-538; Alexander et al., 1987, Mol. Cell. Biol. 7:1436-1444), mouse mammary tumor virus control region which is active in testicular, breast, lymphoid and mast cells (Leder et al., 1986, Cell 45:485-495), albumin gene control region which is active in liver (Pinkert et al., 1987, Genes and Devel. 1:268-276), alpha-fetoprotein gene control region which is active in liver (Krumlauf et al., 1985, Mol. Cell. Biol. 5:1639-1648; Hammer et al., 1987, Science 235:53-58; alpha 1-antitrypsin gene control region which is active in the liver (Kelsey et al., 1987, Genes and Devel. 1:161-171), beta-globin gene control region which is active in myeloid cells (Mogram et al., 1985, Nature 315:338-340; Kollias et al., 1986, Cell 46:89-94; myelin basic protein gene control region which is active in oligodendrocyte cells in the brain (Readhead et al., 1987, Cell 48:703-712); and myosin light chain-2 gene control region which is active in skeletal muscle (Sani, 1985, Nature 314:283-286). Preferably, the promoter is an RNA polymerase promoter, preferably a bacteriophage or viral or insect RNA polymerase promoter, including but not limited to the promoters for T7 RNA polymerase, SP6 RNA polymerase, and T3 RNA polymerase. If an RNA polymerase promoter is used in which the RNA polymerase is not endogenously produced by the host cell in which it is desired to produce the recombinant VSV, a recombinant source of the RNA polymerase must also be provided in the host cell.
(89) The VSV () DNA can be operably linked to a promoter before or after insertion of foreign DNA. In certain embodiments, a transcriptional terminator is situated downstream of the VSV () DNA.
(90) In another embodiment, a DNA sequence that can be transcribed to produce a ribozyme sequence is situated at the immediate 3 end of the VSV () DNA, prior to the transcriptional termination signal, so that upon transcription a self-cleaving ribozyme sequence is produced at the 3 end of the antigenomic RNA, which ribozyme sequence will autolytically cleave (after a U) this fusion transcript to release the exact 3 end of the VSV antigenomic (+) RNA. Any ribozyme sequence known in the art may be used, as long as the correct sequence is recognized and cleaved. In a preferred aspect, hepatitis delta virus (HDV) ribozyme is used (Perrotta and Been, 1991, Nature 350:434-436; Pattnaik et al., 1992, Cell 69:1011-1020).
(91) An example of a VSV () DNA for use, for insertion of foreign DNA, can thus comprises (in 5 to 3 order) the following operably linked components: the T7 RNA polymerase promoter, VSV () DNA, a DNA sequence that is transcribed to produce an HDV ribozyme sequence (immediately downstream of the VSV () DNA), and a T7 RNA polymerase transcription termination site.
(92) Examples of plasmids that can be used are, pVSVFL (+) or pVSVSS1.
(93) In certain embodiments, a coronavirus spike(S) protein can replace the endogenous VSV G protein in the recombinant VSV particle, or can be expressed as a fusion with the endogenous VSV G protein, or can be expressed in addition to the endogenous VSV G protein either as a fusion or nonfusion protein. For example, the G gene of VSV in the VSV () DNA of plasmid pVSVFL (+) can be excised and replaced, by cleavage at the NheI and MluI sites flanking the G gene and insertion of the desired sequence. In other embodiments, a coronavirus spike(S) protein is expressed as a fusion protein comprising the cytoplasmic domain (and, optionally, also the transmembrane region) of the VSV G protein. In certain embodiments, a coronavirus spike(S) protein forms a part of the VSV envelope and thus is surface-displayed in the VSV particle.
(94) In certain embodiments, foreign DNA is inserted into an intergenic region, or a portion of the VSV () DNA that is transcribed to form the noncoding region of a viral mRNA. In certain embodiments, the foreign DNA is inserted into a coding region of the VSV genome that is non-essential to the virus's development, growth and/or functions required to act as a vaccine. In certain embodiments, the VSV G gene is disrupted. In certain embodiments, the foreign DNA insertion does not disrupt the G gene or G protein function.
(95) Coronavirus Spike(S) Glycoprotein
(96) Coronavirus entry into host cells is mediated by the transmembrane spike(S) glycoprotein (interchangeably referred to as spike glycoprotein, S glycoprotein, S protein or spike protein) which is the main target of anti-viral neutralizing antibodies and is the focus of therapeutic and vaccine design. S glycoprotein forms homotrimers protruding from the viral surface. S glycoprotein comprises two functional subunits responsible for binding to the host cell receptor (S1 subunit) and fusion of the viral and cellular membranes (S2 subunit). For many coronaviruses, including SARS-CoV-1 and SARS-CoV-2, S glycoprotein is cleaved at the boundary between the S1 and S2 subunits, which remain non-covalently bound in the prefusion conformation. The distal S1 subunit comprises the receptor-binding domain(s) (RBD) and contributes to stabilization of the prefusion state of the membrane-anchored S2 subunit that contains the fusion machinery. S is further cleaved by host proteases at the S2 site located immediately upstream of the fusion peptide. This cleavage has been proposed to activate the protein for membrane fusion via conformational changes. Walls et al., Cell, published online Mar. 9, 2020; available at doi.org/10.1016/j.cell.2020.02.058.
(97) SARS-CoV-1 and SARS-CoV-2 can interact directly with angiotensin-converting enzyme 2 (ACE2) to enter target cells and may also employ the cellular serine protease, transmembrane protease, serine 2 (TMPRSS2) for S protein priming (Hoffmann et al., Cell, 2020, 181:1-10; available at doi.org/10.1016/j.cell.2020.02.052). SARSCoV-S und SARS-CoV-2-S share about 76% amino acid identity. The receptor binding domain (RBD) in the S glycoprotein is the most variable part of the coronavirus genome. Six RBD amino acids have been shown to be critical for binding to ACE2 receptors and for determining the host range of SARS-CoV-like viruses. They are Y442, L472, N479, D480, T487 and Y4911 in SARS-CoV, which correspond to L455, F486, Q493, S494, N501 and Y505 in SARS-CoV-2 (Andersen et al., Nature Medicine, 2020; available at doi.org/10.1038/s41591-020-0820-9).
(98) In certain embodiments of the disclosure, the VSV particles comprise the SARS-CoV-2 S glycoprotein or a fragment or derivative thereof, wherein said S glycoprotein, fragment or derivative is capable of mediating infection of a target cell. In various embodiments, the S glycoprotein may be a full-length SARS-CoV-2 S glycoprotein (comprising or consisting of SEQ ID NO: 1) or a fragment or derivative thereof that has at least 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more amino acid sequence identity to SEQ ID NO: 1.
(99) The wild-type coronavirus S glycoprotein comprises an S1 subunit that facilitates binding of the coronavirus to cell surface proteins. Without wishing to be bound by theory, the S1 subunit of the wildtype S glycoprotein controls which cells are infected by the coronavirus. The wild-type S glycoprotein also comprises a S2 subunit, which is a transmembrane subunit that facilitates viral and cellular membrane fusion. In the various aspects and embodiments described herein, a fragment or derivative of SARS-CoV-2 S glycoprotein can comprise the S1 subunit of the SARS-CoV-2 S glycoprotein or a fragment or derivative that has at least 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more amino acid sequence identity to the S1 subunit of the SARS-CoV-2 S glycoprotein. In some embodiments described herein, a fragment or derivative of SARS-CoV-2 S glycoprotein can comprise a sequence that has at least 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more amino acid sequence identity to amino acids 14-684 of SEQ ID NO: 1. In the various aspects and embodiments described herein, a fragment or derivative of SARS-CoV-2 S glycoprotein can comprise the S2 subunit of the SARS-CoV-2 S glycoprotein or a fragment or derivative that has at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more amino acid sequence identity to the S2 subunit of the SARS-CoV-2 S glycoprotein.
(100) The wild-type coronavirus S glycoprotein comprises a receptor binding domain (RBD) that facilitates binding of the coronavirus to its receptor on the host cell. The RBD of the SARS-CoV-2 spike(S) glycoprotein is described, e.g., in Anderson et al., Nature Medicine, 2020 (available at doi.org/10.1038/s41591-020-0820-9). In the various aspects and embodiments described herein, a fragment or derivative of SARS-CoV-2 S glycoprotein can comprise the RBD of the SARS-CoV-2 S glycoprotein, or a fragment or derivative that has at least 74%, 75%, 76%, 77%, 78%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more amino acid sequence identity to the RBD of the SARS-CoV-2 S glycoprotein. In some embodiments described herein, a fragment or derivative of SARS-CoV-2 S glycoprotein can comprise a sequence that has at least 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more amino acid sequence identity to amino acids 319-541 of SEQ ID NO: 1.
(101) In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragment thereof, may comprise or consist of an insertion, deletion, and/or substitution of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, or 39 residues of the SARS-CoV-2 S glycoprotein. Non-limiting examples of amino acids for potential deletion include, e.g., a tyrosine at position (145), an asparagine at position (679), a serine at position (680), proline at position (681), an arginine at position (682), an arginine at position (683), an alanine at position (684), and/or an arginine at position (685), positions as denoted in SEQ ID NO: 1, or the equivalent amino acid residue in a mutant SARS-CoV-2 S glycoprotein sequence. Non-limiting examples of amino acids for potential substitution include, e.g., a leucine changed to a phenylalanine at position (5) a tyrosine changed to an asparagine at position (28), a threonine changed to an isoleucine at position (29), a histidine changed to a tyrosine at position (49), a leucine changed to a phenylalanine at position (54), an asparagine changed to a lysine at position (74), a glutamic acid changed to an aspartic acid at position (96), an aspartic acid changed to an asparagine at position (111), a phenylalanine changed to a leucine at position (157), a glycine changed to a valine at position (181), a serine changed to a tryptophan at position (221), a serine changed to an arginine at position (247), an alanine changed to a threonine at position (348), an arginine changed to an isoleucine at position (408), a glycine changed to a serine at position (476), a valine changed to an alanine at position (483), a histidine changed to a glutamine at position (519), an alanine changed to a serine at position (520), an aspartic acid changed to an asparagine at position (614), an aspartic acid changed to a glycine at position (614), an asparagine changed to an isoleucine at position (679), a serine change to a leucine at position (680), an arginine changed to a glycine at position (682), an arginine changed to a serine at position (683), an arginine changed to a glutamine at position (685), an arginine changed to a serine at position (685), a phenylalanine changed to a cysteine at position (797), an alanine changed to a valine at position (930), an aspartic acid changed to a tyrosine at position (936), an alanine changed to a valine at position (1078), an aspartic acid changed to a histidine at position (1168), and/or an aspartic acid changed to a histidine at position (1259), positions as denoted in SEQ ID NO: 1, or the equivalent amino acid residue in a mutant SARS-CoV-2 S glycoprotein sequence. See Becerra-Flores and Cardozo, SARS-CoV-2 viral spike G614 mutation exhibits higher case fatality rate, The International Journal of Clinical Practice, published online May 6, 2020; Eaaswarkhanth et al., Could the D614G substitution in the SARS-CoV-2 spike(S) protein be associated with higher COVID-19 mortality? International Journal of Infectious Diseases, 96: July 2020, Pages 459-460; Tang et al., The SARS-CoV-2 Spike Protein D614G Mutation Shows Increasing Dominance and May Confer a Structural Advantage to the Furin Cleavage Domain, Preprints 2020, 2020050407 (doi: 10.20944/preprints202005.0407.v1); Hansen et. al., Studies in humanized mice and convalescent humans yield a SARS-CoV-2 antibody cocktail Science, published online Jun. 15, 2020; Lokman et al., Exploring the genomic and proteomic variations of SARS-CoV-2 spike glycoprotein: A computational biology approach, Infection, Genetics and Evolution: Journal of Molecular Epidemiology and Evolutionary Genetics in Infectious Diseases, 2020 June; 84:104389. DOI: 10.1016/j.meegid.2020.104389, each of which incorporated herein by reference in their entirety for all intended purposes. Additional non-limiting examples of amino acid residue positions for insertion, deletion, and/or substitution include those as listed in Tables 8 and 9 (amino acid residue positions are denoted using SEQ ID NO: 1 as a reference sequence, which can be used as a reference for identifying the equivalent amino acid residue in any SARS-CoV-2 S glycoprotein sequence (same as above); references in Table 8 are incorporated herein by reference in their entirety for all intended purposes). Each residue modification listed in Table 8 can separately be used alone or in combination with others to generate variants of a recombinant vesicular stomatitis virus (VSV) particle. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide (e.g., wild-type SARS-CoV-2 spike protein) by changing a serine to an arginine at position (247), an aspartic acid to an asparagine at position (614), and/or an arginine to a glutamine at position (685), positions as denoted in SEQ ID NO: 1, or the equivalent amino acid residue in a mutant SARS-CoV-2 S glycoprotein sequence. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing a serine to an arginine at position (247). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an aspartic acid to an asparagine at position (614). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an arginine to a glutamine at position (685). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing a serine to an arginine at position (247) and an aspartic acid to an asparagine at position (614). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing a serine to an arginine at position (247) and an arginine to a glutamine at position (685). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an aspartic acid to an asparagine at position (614) and an arginine to a glutamine at position (685). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing a serine to an arginine at position (247), an aspartic acid to an asparagine at position (614), and an arginine to a glutamine at position (685). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, result in a more lytic phenotype. In certain embodiments, the SARS-CoV-2 S glycoprotein fragment or derivative may comprise the amino acid sequence of SEQ ID NO: 42, or a sequence at least 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to the amino acid sequence of SEQ ID NO: 42. In certain embodiments, the SARS-CoV-2 S glycoprotein fragment or derivative may be encoded by a codon optimized nucleotide sequence. In various embodiments, SARS-CoV-2 S glycoprotein fragment or derivative may be encoded by the polynucleotide sequence of SEQ ID NO: 43 or a sequence that has at least 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% polynucleotide sequence identity to SEQ ID NO: 43. In certain embodiments, the SARS-CoV-2 S glycoprotein fragment or derivative may comprise the amino acid sequence of SEQ ID NO: 44, or a sequence at least 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to the amino acid sequence of SEQ ID NO: 44. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide (e.g., wild-type SARS-CoV-2 spike protein) by changing an asparagine to a tyrosine at position (501), and/or a glutamic acid to a lysine at position (484), and/or an aspartic acid to a glycine at position (614), and/or deletion of residues 69-70, positions as denoted in SEQ ID NO: 1, or the equivalent amino acid residue in a mutant SARS-CoV-2 S glycoprotein sequence. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an asparagine to a tyrosine at position (501). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing a glutamic acid to a lysine at position (484). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an aspartic acid to a glycine at position (614). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by deletion of residues 69-70. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an asparagine to a tyrosine at position (501) and a glutamic acid to a lysine at position (484). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an asparagine to a tyrosine at position (501) and an aspartic acid to a glycine at position (614). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an asparagine to a tyrosine at position (501) and deletion of residues 69-70. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing a glutamic acid to a lysine at position (484) and an aspartic acid to a glycine at position (614). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing a glutamic acid to a lysine at position (484) and deletion of residues 69-70. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an aspartic acid to a glycine at position (614) and deletion of residues 69-70. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an asparagine to a tyrosine at position (501), a glutamic acid to a lysine at position (484), and an aspartic acid to a glycine at position (614). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an asparagine to a tyrosine at position (501), changing a glutamic acid to a lysine at position (484), and deletion of residues 69-70. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an asparagine to a tyrosine at position (501), changing an aspartic acid to a glycine at position (614), and deletion of residues 69-70. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing a glutamic acid to a lysine at position (484), changing an aspartic acid to a glycine at position (614), and deletion of residues 69-70. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide by changing an asparagine to a tyrosine at position (501), changing a glutamic acid to a lysine at position (484), changing an aspartic acid to a glycine at position (614) and deletion of residues 69-70. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide (e.g., wild-type SARS-CoV-2 spike protein) by inactivating the furin cleavage site within the spike protein. In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, differs in amino acid sequence from the reference peptide or polypeptide (e.g., wild-type SARS-CoV-2 spike protein) by changing Q677TNSPRRARSV687 (SEQ ID NO: 65), as denoted in SEQ ID NO: 1, or the equivalent amino acid residue in a mutant SARS-CoV-2 S glycoprotein sequence, to QTILRSV (SEQ ID NO: 66) or to QTNSPGSASSV (SEQ ID NO: 67). In certain embodiments, the SARS-CoV-2 S glycoprotein derivative, or fragments thereof, result in a monobasic furin cleavage site in the S1/S2 interface (QTILRSV (SEQ ID NO: 66)) or deletion of the furin cleavage site (QTNSPGSASSV (SEQ ID NO: 67)) phenotype. In certain embodiments, the alteration to the furin cleavage site can lead to a spike stabilized pseudoparticles. See Hansen et. al., Studies in humanized mice and convalescent humans yield a SARS-CoV-2 antibody cocktail Science, published online Jun. 15, 2020, incorporated herein by reference in its entirety for all intended purposes.
(102) In certain embodiments, the SARS-CoV-2 S glycoprotein fragment or derivative lacks one or more C-terminal residues of the full-length SARS-CoV-2 S glycoprotein. For example, the SARS-CoV-2 S glycoprotein fragment may lack 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 of the C-terminal residues of the SARS-CoV-2 S glycoprotein. In certain embodiments, the SARS-CoV-2 S glycoprotein fragment or derivative lacks the 19 C-terminal residues of the SARS-CoV-2 S glycoprotein. The SARS-CoV-2 S glycoprotein fragment or derivative may consist of the amino acid sequence of SEQ ID NO: 3, or a sequence at least 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5% or more identical to the amino acid sequence of SEQ ID NO: 3.
(103) In certain embodiments, the SARS-CoV-2 S glycoprotein derivative is a chimeric or fusion molecule which comprises fusogen sequences from viruses other than SARS-CoV-2. In certain embodiments, such chimeras comprise S1 or RBD sequences of SARS-CoV-2 S glycoprotein. In certain embodiments, the fusion protein is a fusion between the extracellular and transmembrane sequence of SARS-CoV-2 S glycoprotein, or a fragment or derivative thereof and a cytoplasmic domain of a non-SARS-CoV-2 fusogen or a fragment or derivative thereof. In certain embodiments, the fusion protein is a fusion between the extracellular sequence of SARS-CoV-2 S glycoprotein, or a fragment or derivative thereof and transmembrane and cytoplasmic domains of a non-SARS-CoV-2 fusogen or a fragment or derivative thereof. Non-limiting examples of non-SARS-CoV-2 fusogens which can be used in the above chimeric and fusion molecules include, for example, coronavirus fusogens (e.g., from SARS-CoV-1 or MERS-CoV), fusogens from VSV or other vesiculoviruses or other viruses from the Rhabdoviridae family, viruses from the Retroviridae family (e.g., human immunodeficiency virus (HIV), murine leukemia virus (MLV), Avian sarcoma leukosis virus (ASLV), Jaagsiekte sheep retrovirus (JSRV)), viruses from the Paramyxoviridae family (e.g., parainfluenza virus 5 (PIV5)), viruses from the Herpesviridae family (e.g., herpes simplex virus (HSV)), viruses from the Togaviridae family (e.g., Semliki Forest virus (SFV), Rubella virus), viruses from the Flaviviridae family (e.g., tick-borne encephalitis virus (TBE), Dengue virus), viruses from the Orthomyxoviridae family (e.g., influenza virus), viruses from the Arenaviridae family (e.g., lymphocytic choriomenengitis virus (LCMV), Lassa fever virus (LASV)), viruses from the Bunyaviridae family (e.g., Uukuniemi Virus (UUKV)), viruses from the Filoviridae family (e.g., Ebola virus (EBOV)), viruses from the Poxviridae family (e.g., Vaccinia virus (VV)), viruses from the Asfaviridae family (e.g., African swine fever virus (ASFV)), viruses from the Arteriviridae family (e.g., porcine reproductive and respiratory syndrome virus (PRRSV)), viruses from the Bornaviridae family (e.g., Borna disease virus (BDV)), viruses from the Hepadnaviridae family (e.g., Hepatitis B virus (HBV)), and viruses from Hantaviridae family (e.g., Andes virus).
(104) In certain embodiments, the fusion protein is a fusion between a SARS-CoV-2 S glycoprotein, or a fragment or derivative thereof and a VSV glycoprotein G protein or a fragment or derivative thereof. In certain embodiments, the fusion protein is a fusion between a SARS-CoV-2 S glycoprotein, or a fragment or derivative thereof and a cytoplasmic portion of the VSV G glycoprotein or a fragment or derivative thereof. In one specific embodiment, the fusion protein comprises the amino acid sequence SEQ ID NO: 5.
(105) In certain embodiments of the assays of the disclosure, to ensure detection of a broader spectrum of the SARS-CoV-2 neutralizing antibodies, the SARS-CoV-2 S glycoprotein or a fragment or derivative thereof can comprise a consensus sequence derived from two or more different strains, mutants or variants of SARS-CoV-2. In other embodiments, to ensure detection of a broader spectrum of the SARS-CoV-2 neutralizing antibodies, the methods of the disclosure use a mixture of SARS-CoV-2 S glycoproteins (or fragments or derivatives thereof) from two or more different strains, mutants or variants of SARS-CoV-2.
(106) Polynucleotide molecules encoding SARS-CoV-2 S glycoprotein or a fragment or derivative thereof can comprise a consensus sequence and/or modification(s) for improved expression of the SARS-CoV-2 S glycoprotein or the fragment or derivative thereof. Modification can include codon optimization, the addition of a Kozak sequence or modified (e.g., optimized) Kozak sequence for increased translation initiation, and/or the addition of a signal peptide/leader sequence (e.g., an immunoglobulin signal peptide such as, e.g., IgE or IgG signal peptide). In certain embodiments, the Kozak sequence or modified (e.g., optimized) Kozak sequence is 3 to the foreign gene. In certain embodiments, the Kozak sequence or modified (e.g., optimized) Kozak sequence is immediately 3 to the foreign gene. In certain embodiments, the Kozak sequence or modified (e.g., optimized) Kozak sequence is 5 to the foreign gene. In certain embodiments, the Kozak sequence or modified (e.g., optimized) Kozak sequence is immediately 5 to the foreign gene.
(107) In some embodiments, the SARS-CoV-2 S glycoprotein or a fragment or derivative thereof comprises a fusions or conjugate with a detection tag (e.g., HA tag, histidine tag, biotin), a reporter protein or a fragment thereof, dimerization/multimerization sequences, Fc, signaling sequences, etc. In some embodiments, the recombinant VSV particles of the disclosure comprise, in addition to the SARS-CoV-2 S glycoprotein or a fragment or derivative thereof, a reporter protein or a fragment thereof, wherein said reporter protein or a fragment thereof is either encoded by the VSV particle genome or is included in it as a protein. Non-limiting examples of reporter proteins include, e.g., luciferases (including but not limited to, Renilla luciferase, RLuc8 mutant Renilla luciferase, (dCpG) Luciferase, NanoLuc reporter, firefly luciferase, Gaussia luciferase (gLuc), MetLuc, Vibrio fischeri lumazine protein, Vibrio harveyi luminaze protein, inoflagellate luciferase, firefly luciferase YY5 mutant, firefly luciferase LGR mutant, firefly luciferase mutant E, and derivatives thereof) and fluorescent proteins (including but not limited to, green fluorescent protein (GFP) [e.g., Aequoria victoria GFP, Renilla muelleri GFP, Renilla reniformis GFP, Renilla ptilosarcus GFP], GFP-like fluorescent proteins, (GFP-like), enhanced green fluorescent protein (EGFP), yellow fluorescent protein (YFP) [e.g., Topaz, Venus, mCitrine, YPet, Tag YFP, PhiYFP, ZsYellow1, mBanana], enhanced yellow fluorescent protein (EYFP), blue fluorescent protein (BFP) [e.g., EBFP2, Azurite, GFP2, GFP10, and mTagBFP], enhanced blue fluorescent protein (EBFP), cyan fluorescent protein (CFP) [e.g., mECFP, Cerulean, CyPet, AmCyan1, Midori-Ishi Cyan, TagCFP, mCFPmm, mTFP1 (Teal)], enhanced cyan fluorescent protein (ECFP), superfolder GFP, superfolder YFP, orange fluorescent protein [e.g., Kusabira Orange, Kusabira Orange2, mOrange, mOrange2, dTomato, dTomato-Tandem, TagRFP, TagRFP-T, DsRed, DsRed2, DsRed-Express (T1), DsRed-Monomer, mTangerine], red fluorescent protein [e.g., mRuby, mApple, mStrawberry, AsRed2, mRFP1, JRed, mCherry, HcRed1, mRaspberry, dKeima-Tandem, HcRed-Tandem, mPlum, tdTomato, AQ143], small ultrared fluorescent protein, FMN-binding fluorescent protein, dsRed, qFP611, Dronpa, TagRFP, KFP, EosFP, IrisFP, Dendra, Kaede, KikGr1, emerald fluorescent protein, Azami Green, mWasabi, TagGFP, TurboGFP, AcGFP, ZsGreen, T-Sapphire, and derivatives thereof), -galactosidase, -glucuronidase, -geo, and fragments thereof.
(108) Production of Recombinant VSV Particles
(109) Recombinant VSV particles are used as an example in the disclosure below, but this disclosure can also be used for other vesiculoviruses.
(110) The recombinant VSV particles of the disclosure are produced by providing in an appropriate host cell: VSV () DNA, in which regions non-essential for replication have been inserted into or replaced by a foreign DNA comprising a sequence encoding a coronavirus S glycoprotein or a fragment or derivative thereof and optionally other sequences discussed above, and recombinant sources of VSV N protein, P protein, L protein and any additional desired VSV protein (e.g., M protein and/or G glycoprotein). In certain embodiments, the production is preferably in vitro (e.g., in cell culture).
(111) The host cell used for recombinant VSV production can be any cell in which VSVs grows. Non-limiting sources of host cells include, prokaryotic cells or a eukaryotic cells, vertebrate cells, mammalian cells, some insect (e.g., Drosophila) cells, primary cells (e.g., primary chick embryo fibroblasts), or cell lines (e.g., BHK (baby hamster kidney) cells, CHO (Chinese hamster ovary) cells, HeLA (human) cells, mouse L cells, Vero (monkey) cells (including Vero-His cells), Vero-Ace-2 cells, Vero-TRMPSS2 cells, Vero-E6 cells, ESK-4, PK-15, EMSK cells, MDCK (Madin-Darby canine kidney) cells, MDBK (Madin-Darby bovine kidney) cells, 293 (human) cells, Hep-2 cells, Human Diploid Primary Cell Lines (e.g. WI-38 and MRC5 cells), Monkey Diploid Cell Line (e.g. FRhL-Fetal Rhesus Lung cells), and Quasi-Primary Continues Cell Line (e.g. AGMK-African green monkey kidney cells), etc.).
(112) The sources of N, P, and L proteins and any additional desired VSV protein (e.g., M protein and/or G glycoprotein) can be the same or can be different recombinant nucleic acid(s), encoding and capable of expressing these proteins in the host cell in which it is desired to produce recombinant VSVs. The nucleic acids encoding the N, P and L proteins and any additional desired VSV protein (e.g., M protein and/or G glycoprotein) can be obtained by any means available in the art. The VSV N, P, L, M and G-encoding nucleic acid sequences have been disclosed and can be used. For example, see Genbank accession no. J02428; Rose and Schubert, 1987, in The Viruses: The Rhabdoviruses, Plenum Press, NY, pp. 129-166. The sequences encoding the N, P and L genes can also be obtained, for example, from plasmid pVSVFL (+), deposited with the ATCC and assigned accession no. 97134, e.g., by PCR amplification of the desired gene (see also U.S. Pat. Nos. 4,683,202, 4,683,195 and 4,889,818; Gyllenstein et al., 1988, Proc. Natl. Acad. Sci. USA 85:7652-7656; Ochman et al., 1988, Genetics 120:621-623; Loh et al., 1989, Science 243:217-220). If a nucleic acid clone of any of the N, P, L, M or G genes is not already available, the clone can be obtained by use of standard recombinant DNA methodology. For example, the DNA may be obtained by standard procedures known in the art such as, e.g., by purification of RNA from VSV virions followed by reverse transcription and PCR (Mullis and Faloona, 1987, Methods in Enzymology 155:335-350). Alternatives include, but are not limited to, chemically synthesizing the gene sequence itself. Other methods are possible and within the scope of the disclosure.
(113) Nucleic acids that encode fragments and derivatives of VSV N, P, L, M, and/or G genes, as well as fragments and derivatives of the VSV () DNA can also be used in the present disclosure, as long as such fragments and derivatives retain the requisite function (e.g., the ability to produce replication competent or non-replication competent VSV particles which can be used in one or more methods of the disclosure). In particular, derivatives can be made by altering sequences by substitutions, additions, or deletions. Furthermore, due to the inherent degeneracy of the genetic code, other DNA sequences which encode substantially the same or a functionally equivalent amino acid sequence may be used in the practice of the methods of the disclosure. Amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity and/or the amphipathic nature of the residues involved.
(114) The desired N/P/L/M/G-encoding nucleic acid can be inserted into an appropriate expression vector, i.e., a vector which contains the necessary elements for the transcription and translation of the inserted protein-coding sequence in the host cell in which it is desired to produce recombinant VSV particles, to create a vector that functions to direct the synthesis of the VSV proteins that will subsequently assemble with the VSV genomic RNA (e.g., produced in the host cell from antigenomic VSV (+) RNA produced, e.g., by transcription of the VSV () DNA).
(115) A variety of vector systems may be utilized to express the N, P and L VSV proteins and any additional desired VSV protein (e.g., M and/or G), as well as to transcribe the VSV () DNA (e.g., comprising a foreign DNA), as long as the vector is functional in the host cell and compatible with any other vector present. The expression elements of vectors vary in their strengths and specificities. Any one of a number of suitable transcription and translation elements may be used, as long as they are functional in the host cell.
(116) Standard recombinant DNA methods may be used to construct expression vectors containing DNA encoding the VSV proteins, and the VSV () DNA containing the foreign DNA, comprising appropriate transcriptional/translational control signals (see, e.g., Sambrook et al., 1989, supra, and methods described hereinabove). Expression may be controlled by any promoter/enhancer element known in the art. Promoters which may be used to control expression can be constitutive or inducible. In a specific embodiment, the promoter is an RNA polymerase promoter.
(117) Transcription termination signals (downstream of the gene), and selectable markers are preferably also included in the expression vector. In addition to promoter sequences, expression vectors for the N, P, L, and any additionally desired VSV proteins, as well as any coronavirus proteins, may contain specific initiation signals for efficient translation of the inserted sequences, e.g., a ribosome binding site.
(118) Specific initiation signals maybe required for efficient translation of the protein coding sequences. These signals include the ATG initiation codon and adjacent sequences. In cases where the entire N, P, L, or other (e.g., M and/or G) VSV gene, including its own initiation codon and adjacent sequences, are inserted into the appropriate vectors, no additional translational control signals may be needed. However, in cases where only a portion of the gene sequence is inserted, exogenous translational control signals, including the ATG initiation codon, must be provided. The initiation codon must furthermore be in phase with the reading frame of the protein coding sequences to ensure translation of the entire insert. These exogenous translational control signals and initiation codons can be of a variety of origins, both natural and synthetic.
(119) In a specific embodiment, a recombinant expression vector provided herein, encoding an N, P, L, and/or other (e.g., M and/or G) protein or functional derivative thereof, comprises the following operatively linked components: a promoter which controls the expression of proteins (e.g., the N, P, L, and/or other VSV protein (for example, M and/or G), a coronavirus protein (e.g., a spike glycoprotein such as the SARS-CoV-2 spike glycoprotein), or a fragment or derivative thereof, a translation initiation signal, a DNA sequence encoding the VSV protein or functional fragment or derivative thereof, and a transcription termination signal. In certain embodiments, the above components are present in 5 to 3 order as listed above. In certain embodiments, genes encoding the M protein, G proteins, and/or coronavirus S glycoprotein or a fragment or derivative thereof are interspersed between the N, P, and/or L proteins. In certain embodiments, genes for the M protein, G protein, and/or coronavirus S glycoprotein or a fragment or derivative thereof are between the genes for P and L proteins (see
(120) In certain embodiments, the genes encoding the N, P, L, and other (e.g., M and/or G) VSV proteins are inserted downstream of the T7 RNA polymerase promoter from phage T7 gene 10, situated with an A in the 3 position. A T7 RNA polymerase terminator and a replicon can be also included in the expression vector. T7 RNA polymerase can be provided to transcribe the VSV protein sequence. The T7 RNA polymerase can be produced from a chromosomally integrated sequence or an episomal vector. In certain embodiments, T7 RNA polymerase can be provided by intracellular expression from a recombinant vaccinia virus vector encoding the T7 RNA polymerase. In certain embodiments, the N, P, L, and/or other (e.g., M and/or G) VSV proteins are each encoded by a DNA sequence operably linked to a promoter in an expression plasmid, containing the necessary regulatory signals for transcription and translation of the encoded proteins. Such an expression plasmid preferably includes a promoter, the coding sequence, and a transcription termination/polyadenylation signal, and optionally, a selectable marker (e.g., -galactosidase).
(121) In certain embodiments, the N, P, L, and/or other (e.g., M and/or G) proteins can be encoded by the same or different plasmids, or a combination thereof. In other embodiments, one or more of the N, P, L, and other (e.g., M and/or G) VSV proteins can be expressed intrachromosomally.
(122) The cloned sequences comprising the VSV () DNA containing the foreign DNA, and the cloned sequences comprising sequences encoding the VSV and foreign proteins can be introduced into the desired host cell by any method known in the art, e.g., transfection, electroporation, infection (when the sequences are contained in, e.g., a viral vector), microinjection, etc. In certain embodiments, a transfection facilitating reagent is added to increase DNA uptake by cells. Many of these reagents are known in the art (e.g., calcium phosphate; Lipofectace (Life Technologies, Gaithersburg, Md.), and Effectene (Qiagen, Valencia, Calif.) are non-limiting examples).
(123) In certain embodiments, DNA comprising VSV () DNA containing foreign DNA encoding a coronavirus S glycoprotein or a fragment or derivative thereof, operably linked to an RNA polymerase promoter (e.g., a bacteriophage RNA polymerase promoter); DNA encoding N, operably linked to the same RNA polymerase promoter; DNA encoding P, operably linked to the same polymerase promoter; and DNA encoding L, operably linked to the same polymerase promoter; are all introduced (e.g., by transfection) into the same host cell, in which host cell the RNA polymerase has been cytoplasmically provided. In certain embodiments, the RNA polymerase is cytoplasmically provided by expression from a recombinant virus vector that replicates in the cytoplasm and expresses the RNA polymerase, most preferably a vaccinia virus vector, that has been introduced (e.g., by infection) into the same host cell. Cytoplasmic provision of RNA polymerase can be used, as this will result in cytoplasmic transcription and processing, of the VSV () DNA comprising the foreign DNA and of the N, P, L, and other (e.g., M and/or G protein) VSV proteins, avoiding splicing machinery in the cell nucleus, and, thereby, maximizing proper processing and production of N, P, L, and other (e.g., M and/or G protein) VSV proteins, and resulting assembly of the recombinant VSVs. Vaccinia virus vectors also cytoplasmically provide enzymes for processing (capping and polyadenylation) of mRNA, facilitating proper translation. In a most preferred aspect, T7 RNA polymerase promoters are employed, and a cytoplasmic source of T7 RNA polymerase is provided by also introducing into the host cell a recombinant vaccinia virus vector encoding T7 RNA polymerase into the host cell. Such vaccinia virus vector can be obtained by well-known methods. In certain embodiments, a recombinant vaccinia virus vector such as vTF7-3 (Fuerst et al., 1986, Proc. Natl. Acad. Sci. U.S.A. 83:8122-8126) can be used.
(124) In other embodiments, the RNA polymerase (e.g., T7 RNA polymerase) can be provided by use of a host cell that expresses T7 RNA polymerase from a chromosomally integrated sequence (e.g., originally inserted into the chromosome by homologous recombination), optionally constitutively, or that expresses T7 RNA polymerase episomally, from a plasmid.
(125) In other embodiments, the VSV () DNA encoding a coronavirus S glycoprotein or a fragment or derivative thereof, operably linked to a promoter, can be transfected into a host cell that stably recombinantly expresses the N, P, L, and any other (e.g., M and/or G protein) VSV proteins from chromosomally integrated sequences.
(126) The cells are cultured and recombinant VSV particles can be recovered, e.g., using standard methods. By way of example, and not limitation, after approximately 24 hours, cells and medium can be collected, freeze-thawed, and the lysates clarified to yield virus preparations. Alternatively, the cells and medium can be collected and simply cleared of cells and debris by low-speed centrifugation.
(127) Confirmation that the appropriate foreign sequence is present in the genome of the recombinant VSV and directs the production of the desired protein(s) in an infected cell, can be performed. Standard procedures known in the art can be used for this purpose. By way of example, and not limitation, genomic RNA can be obtained from the VSV by SDS phenol extraction from virus preparations, and can be subjected to reverse transcription (and/or PCR), followed by e.g., sequencing, Southern hybridization using a probe specific to the foreign DNA, or restriction enzyme mapping, etc. The virus can be used to infect host cells, which can then be assayed for expression of the desired protein by standard immunoassay techniques using an antibody to the protein (e.g., Western blotting), or by assays based on functional activity of the protein. Other techniques are known in the art and can be used.
(128) Large Scale Growth and Purification of the Recombinant Viruses
(129) VSVs are used as an example in the disclosure below, and this disclosure can also be used for other vesiculoviruses.
(130) A non-limiting example of a large-scale production of a recombinant VSV virus following plaque-purification is presented below. Virus from a single plaque (10.sup.5 pfu) is recovered and used to infect 10.sup.7cells (e.g., BHK cells), to yield, generally, 10 ml at a titer of 109-1010 pfu/ml for a total of approximately 1011 pfu. Infection of 10.sup.12 cells can then be carried out (with a multiplicity of infection of e.g., 0.1), and the cells can be grown in suspension culture, large dishes, or roller bottles by standard methods known to those in the art.
(131) Virus for vaccine preparations can then be collected from culture supernatants, and the supernatants clarified to remove cellular debris. If desired, one method of isolating and concentrating the virus that can be employed is by passage of the supernatant through a tangential flow membrane concentration. The harvest can be further reduced in volume by pelleting through a glycerol cushion and by concentration on a sucrose step gradient. An alternate method of concentration is affinity column purification (Daniel et al., 1988, Int. J. Cancer 41:601-608). However, other methods can also be used for purification (see, e.g., Arthur et al., 1986, J. Cell. Biochem. Suppl. 10A: 226), and any possible modifications of the above procedure will be readily recognized by one skilled in the art. Purification should be as gentle as possible, so as to maintain the integrity of the virus particle.
(132) Assays
(133) In one aspect, the disclosure provides a method for determining the presence of a coronavirus neutralizing antibody in a sample. In one embodiment, the sample is contacted with, or incubated with a recombinant vesicular stomatitis virus (VSV) particle, where the VSV glycoprotein (G) is replaced by a coronavirus spike(S) glycoprotein or a fragment or derivative thereof, wherein said S glycoprotein, fragment or derivative is capable of mediating infection of susceptible target cells. Either simultaneously or afterwards, the recombinant VSV particle is contacted with a first target cell expressing a first portion of a reporter protein and a second target cell expressing a second portion of the reporter protein to form a syncytium comprising both the first and the second portion of the reporter protein and producing a detectable reporter signal. The first target cell and the second target cell should be capable of fusing with one another if contacted with the recombinant VSV particle. The reporter signal is measured in the syncytium and compared with a control.
(134) In certain embodiments, the first cell is Vero-DSP1 (Vero-DSP-1-Puro; CLR-73) and the second cell is (Vero-DSP-2-Puro; CLR-74). Vero-DSP1 and Vero-DSP2 are generated by lentivirus transduction of Vero cells. Vero-DSP1 cells express Rluc8 155-156DSP1-7 luciferase-GFP fusion protein (SEQ ID NO: 14) comprising mutant Renilla luciferase RLuc8 fragment amino acids 1-155 and engineered GFP fragment amino acids 1-156. Vero-DSP2 cells express Rluc8 155-156DSP8-11 luciferase-GFP fusion protein (SEQ ID NO: 16) comprising mutant Renilla luciferase RLuc8 fragment amino acids 156-311 and engineered GFP fragment amino acids 157-231. RLuc8 mutant Renilla luciferase contains the mutations A55T, C124A, S130A, K136R, A143M, M185V, M253L, and S287L (see SEQ ID NO: 19). The sequence of engineered GFP is provided in SEQ ID NO: 18.
(135) The first portion of the reporter protein used in any of the above methods of the disclosure may comprise amino acids 1-229 of Renilla luciferase or a mutant thereof and the second portion of the reporter protein may comprise amino acids 230-311 of Renilla luciferase or a mutant thereof. Alternatively, the first portion of the reporter protein may comprise amino acids 1-155 of Renilla luciferase or a mutant thereof and the second portion of the reporter protein may comprise amino acids 156-311 of Renilla luciferase or a mutant thereof. Alternatively, or in addition, the first portion of the reporter protein may comprise amino acids 1-156 of green fluorescent protein (GFP) or a mutant thereof, and the second portion of the reporter protein may comprise amino acids 157-231 of GFP or a mutant thereof. Alternatively, the first portion of the reporter protein may comprise amino acids 1-213 of superfolder GFP, and the second portion of the reporter protein may comprise amino acids 214-230 of superfolder GFP. Alternatively, the first portion of the reporter protein may comprise amino acids 1-154 of superfolder yellow fluorescent protein (YFP), and the second portion of the reporter protein may comprise amino acids 155-262 of superfolder YFP.
(136) In another aspect, the disclosure provides a method for determining the presence of a coronavirus neutralizing antibody in a sample, wherein the sample is contacted with a recombinant vesicular stomatitis virus (VSV) particle where the VSV glycoprotein (G) is replaced by a coronavirus spike(S) glycoprotein or a fragment or a derivative thereof, wherein said S glycoprotein, fragment or derivative is capable of mediating infection of a target cell and wherein the VSV particle comprises a reporter protein or a nucleic acid molecule encoding the reporter protein. The recombinant VSV particle is then contacted with the target cell. The reporter signal is then measured and compared with a control. In certain embodiments, the reporter protein is encoded by the genome of the recombinant VSV particle. In certain embodiments, the reporter protein is incorporated into the recombinant VSV particle without being encoded by the genome of the viral particle. The nucleic acid sequence encoding the reporter protein may be inserted between the nucleic acid sequence encoding the S glycoprotein and the nucleic acid sequence encoding VSV L protein. The target cell may be a Vero cell (including Vero-His cell), Vero-Ace-2 cell, Vero-TRMPSS2 cell, Vero-E6 cell, or any other cell comprising an angiotensin-converting enzyme 2 (ACE2).
(137) In the above methods of the disclosure, the recombinant VSV particle may encode the coronaviral S glycoprotein in the VSV viral genome. Alternatively, the VSV particle may be pseudotyped with the coronaviral S glycoprotein without it being encoded in the genome (e.g., by using a separate plasmid in a packaging cell).
(138) The sample used in the above methods of the disclosure may be, e.g., serum or plasma (e.g., heat-inactivated serum or plasma).
(139) The first step in which the sample is contacted with the recombinant VSV particle may be conducted for about 1 hour at about 37 C. The second step in which the recombinant VSV particle with the target cell may be conducted for 1-12, 1-3, 2-4, 3-5, 4-6, 5-7, 6-8, 7-9, or 8-10 hours at about 37 C.
(140) In various embodiments of the above methods of the disclosure, the methods comprise adding the reporter protein substrate for obtaining the reporter signal. The reporter protein may be a luciferase and the reporter protein substrate may be Luciferin (e.g., d-luciferin), coelenterazine, or EnduRen luciferase substrate.
(141) In some embodiments, the coronavirus S protein, fragment or derivative thereof is derived from SARS-CoV-2. In certain embodiments, the coronavirus S protein is a full-length SARS-CoV-2 S protein (e.g., a protein comprising or consisting of the amino acid sequence of SEQ ID NO: 1). In certain embodiments, the coronavirus S protein is a SARS-CoV-2 S protein lacking 19 C-terminal amino acids (e.g., a protein comprising or consisting of the amino acid sequence of SEQ ID NO: 3). In certain embodiments, the coronavirus S protein, fragment or derivative has at least 77% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1. In certain embodiments, the coronavirus S protein, fragment or derivative has at least 64% amino acid sequence identity to the S1 subunit of the amino acid sequence of SEQ ID NO: 1. In certain embodiments, the coronavirus S protein, fragment or derivative has at least 64% amino acid sequence identity to amino acids 14-684 of the amino acid sequence of SEQ ID NO: 1. In certain embodiments, the coronavirus S protein, fragment or derivative has at least 74% amino acid sequence identity to the RBD domain of the amino acid sequence of SEQ ID NO: 1. In certain embodiments, the coronavirus S protein, fragment or derivative has at least 74% amino acid sequence identity to amino acids 319-541 of the amino acid sequence of SEQ ID NO: 1. In certain embodiments, the recombinant VSV particle comprises a mutant VSV matrix (M) protein. In certain embodiments, the genome of the recombinant VSV encodes a mutant VSV matrix M protein. In certain embodiments, the mutant matrix M protein comprises a mutation at methionine (M) 51 (e.g., a change from methionine (M) to arginine (R)). In certain embodiments, the mutant VSV matrix M protein comprises or consists of the amino acid sequence of SEQ ID NO: 7.
(142) In certain embodiments of the above methods of the disclosure, the control is the reporter signal obtained with a control sample not comprising coronavirus neutralizing antibodies and the method comprises concluding that the tested sample comprises coronavirus neutralizing antibodies when the reporter signal obtained in the sample is reduced as compared to the control. In certain embodiments, the control sample comprises a VSV particle without the coronavirus S glycoprotein or a VSV particle with a mutant S glycoprotein which does not mediate infection of target cells. In certain embodiments of the above methods of the disclosure, the method further comprises comparing the reporter signal obtained in the sample with the reporter signal obtained with a control sample comprising coronavirus neutralizing antibodies or a molecule that blocks interaction of the coronavirus S glycoprotein with a protein with which it interacts on the target cell.
(143) In certain embodiments of the above methods of the disclosure, the method is conducted in a high throughput format.
(144) In one specific embodiment, provided herein is a method for determining the presence of a Severe Acute Respiratory Syndrome coronavirus 2 (SARS-CoV-2) neutralizing antibody in a sample. The method comprises: a) contacting the sample with a recombinant vesicular stomatitis virus (VSV) particle, wherein the VSV glycoprotein (G) is replaced by the full-length SARS-CoV-2 spike(S) glycoprotein or a fragment thereof lacking 19 C-terminal amino acids; b) after step (a), contacting the recombinant VSV particle with a mixture of Vero-DSP1 (Vero-DSP-1-Puro; CLR-73) cells and Vero-DSP2 (Vero-DSP-2-Puro; CLR-74) cells; c) measuring the luciferase signal and/or GFP signal in the cells after step (b), and d) comparing the signal measured in step (c) with a control.
(145) In another specific embodiment, provided herein is a method for determining the presence of a Severe Acute Respiratory Syndrome coronavirus 2 (SARS-CoV-2) neutralizing antibody in a sample, the method comprising: a) contacting the sample with a recombinant vesicular stomatitis virus (VSV) particle wherein (i) the VSV glycoprotein (G) is replaced by the full-length SARS-CoV-2 spike(S) glycoprotein or a fragment thereof lacking 19 C-terminal amino acids and wherein (ii) the VSV particle further comprises a luciferase protein and/or a nucleic acid molecule encoding said luciferase protein; b) after step (a), contacting the recombinant VSV particle with a cell selected from Vero cell, Vero-Ace-2 cell and Vero-E6 cell; c) measuring the luciferase signal in the cell after step (b), and d) comparing the signal measured in step (c) with a control.
(146) The cells used in any of the methods disclosed herein may comprise angiotensin-converting enzyme 2 (ACE2). ACE2 is a functional receptor for coronaviruses, in particular SARS-CoV-1 and SARS-CoV-2. The cells used in any of the methods disclosed herein may further comprise transmembrane protease, serine 2 (TMPRSS2). The non-limiting examples of susceptible target cells which can be used in the methods of the disclosure include, e.g., Vero green monkey kidney epithelial cells (including Vero-His cells), Vero-Ace-2 cells, Vero-TRMPSS2 cells, Vero-E6 cells, avian erythrocytes, and Madin-Darby canine kidney epithelial cells.
(147) In some embodiments, addition of trypsin to a virus and cell mixture may be used to increase virus-mediated cell fusion. Trypsin may be added before the reporter signal is measured in the cells. Trypsin may be added after a virus and cell mixture are incubated with one another, e.g., 2-6 hours after incubation starts, 3-5 hours after incubation starts, about 4 hours after incubation starts, or 4 hours after incubation starts. Trypsin does not need to be removed from the virus and cell mixture after addition. As shown in the data below, addition of trypsin can promote cell fusion. The concentration of trypsin used can range from 0.1 to 4.0 L trypsin/mL media (e.g., OptiMEM), or from 0.1 to 0.6 L trypsin/mL media, 0.2 to 0.7 L trypsin/mL media, 0.3 to 1.2 L trypsin/mL media, 0.5 to 2.0 L trypsin/mL media, 1.0 to 2.5 L trypsin/mL media, 1.5 to 3.0 L trypsin/mL media, or from 2.0 to 4.0 L trypsin/mL media. Trypsin addition to the media during the fusion assay may make the assay more sensitive. Additional trypsin may allow for cell fusion to occur in less time. Additional trypsin may allow for the assay readout (e.g., luciferase activity) to occur more quickly than with less or no trypsin.
(148) In some embodiments, trypsin is not used in the assay. If trypsin is excluded, an additional wash step may not be required even if the serum/virus mixes, or plasma/virus mixes, are removed and replaced with fresh serum media, or media suitable for plasma.
(149) Reporter Proteins
(150) Various split reporter proteins can be used in any of the aspects and embodiments described herein. For example, enzymes that catalyze the conversion of a substrate to a detectable product. Several such systems for split-polypeptide reassemblies include, but are not limited to reassembly of, -galactosidase (Rossi et al., PNAS, 1997, 94:8405-8410), dihydrofolate reductase (DHFR) (Pelletier et al, PNAS, 1998, 95:12141-12146), TEM-1 B-lactamase (LAC) (Galarneau at al., Nat. Biotech. 2002; 20:619-622) and firefly luciferase (Ray et al., PNAS, 2002, 99:3105-3110 and Paulmurugan et al, 2002; PNAS, 99:15608-15613). For example, split -lactamase has been used for the detection of double stranded DNA (see Ooi et al., Biochemistry, 2006, 45:3620-3525). Split polypeptide fragments can be used for real-time signal detection, wherein the fragments are in a fully folded mature conformation enabling rapid signal detection upon complementation.
(151) The split polypeptide fragments can be any polypeptides which associate when brought into close proximity to one another to generate a protein, which can be detected by any means which allows recognition of the assembled polypeptide fragments but not the individual polypeptides fragments. In one embodiment of the current disclosure, the methods encompass the design of split-polypeptide fragments so that they are active immediately upon their reconstitution.
(152) The split polypeptide fragments can be any polypeptide which associate when brought into close proximity to generate an active protein, which can be detected by any means which allows detection of the assembled active protein but not the individual fragments. For example, the two polypeptides may re-associate to generate a protein with enzymatic activity, to generate a protein with luciferase, chromogenic or fluorogenic activity, or which create a protein recognized by an antibody. Furthermore, they are designed so that they are in the active state and primed (i.e. in a ready-state) for reconstitution of the active protein in order to minimize any lag time that is traditionally seen with protein complementation in vitro and in vivo.
(153) The split polypeptide fragments can be fluorescent proteins or polypeptides. In such an embodiment, one of the activated split fluorescent protein fragments contains a mature preformed chromophore that is primed and in the ready-state for immediate fluorescence upon complementation with its cognate activated split-fluorescent fragment(s). For example, using inclusion bodies containing such a split fluorescent fragment comprises about half of a fully folded fluorescent protein with a correctly folded a mature chromophore that does not fluoresce alone, but is primed to fluoresce upon association with its cognate pair.
(154) In the methods described herein, the reporter protein may be a luciferase. Various luciferase enzymes known to those of ordinary skill in the art may be used, with exemplary luciferases including but not limited to, Renilla luciferase, RLuc8 mutant Renilla luciferase, (dCpG) Luciferase, NanoLuc reporter, firefly luciferase, Gaussia luciferase (gLuc), MetLuc, Vibrio fischeri lumazine protein, Vibrio harveyi luminaze protein, inoflagellate luciferase, firefly luciferase mutant YY5 mutant, firefly luciferase LGR mutant, firefly luciferase mutant E, and derivatives thereof.
(155) In the methods described herein where the recombinant VSV particle is contacted with a first cell expressing a first portion of a reporter protein and a second cell expressing a second portion of the reporter protein to form a syncytium, the reporter protein may be luciferase. The first portion and the second portion of the luciferase may be split-polypeptide luciferase fragments. When both of the split-polypeptide luciferase fragments are introduced in the assay system, the first protein and the second protein bind to each other, and as a consequence, will reconstitute the luciferase to recover luciferase activity so that the luciferase is capable of emitting light under adequate luminescent conditions. The luciferase activity may be measured, when the assay system is a cell, by adding luciferin to the cell culture, and preparing a cell extract to measure the luciferase activity. In this case, the activity is readily measurable by using a commercially available Emerald Luc Luciferase Assay Reagent/Lysis Solution (TOYOBO) or the like.
(156) A fusion protein comprising a luciferase fragment can be detected. For example, when a first fusion protein that has been made by fusing a target protein to be detected with luciferase fragment exists in the assay system, a second fusion protein that has been made by fusing a binding protein that binds to the target protein with luciferase fragment is prepared as a probe and is introduced in the assay system. Then, the binding protein in the second fusion protein should bind to the target protein in the first fusion protein; thereby the luciferase fragments interact and gain luciferase activity. By detecting the luciferase activity, the target fusion protein having luciferase fragments can be detected. Specifically, an expression vector expressing the first fusion protein can be prepared and introduced in a cell. Next, an expression vector expressing the second fusion protein can be prepared and introduced in the cell expressing the first fusion protein. Then the fusion protein having a luciferase fragment can be detected by measuring the luciferase activity as described above.
(157) Split luciferase assays are described further in, e.g., Saw, W. T. et al., Using a split luciferase assay (SLA) to measure the kinetics of cell-cell fusion mediated by herpes simplex virus glycoproteins Methods, 2015, 90:68-75, which is incorporated by reference herein in its entirety. The methods described therein can be conducted where both a luciferase and a fluorescent protein are fused together as the reporter protein.
(158) The split polypeptide fragments can comprise fragments of an active enzyme, which can be detected using an enzyme activity assay. In such an embodiment, the enzyme activity is detected by a chromogenic or fluorogenic reaction. In one embodiment, the enzyme is dihydrofolate reductase or -lactamase.
(159) The enzyme can be dihydrofolate reductase (DHFR). For example, Michnick et al. have developed a protein complementation assay consisting of N- and C-terminal fragments of DHFR, which lack any enzymatic activity alone, but form a functional enzyme when brought into close proximity. See, e.g., U.S. Pat. Nos. 6,428,951, 6,294,330, and 6,270,964, which are hereby incorporated by reference. Methods to detect DHFR activity, including chromogenic and fluorogenic methods, are well known in the art.
(160) Various fluorescent proteins may be used in any of the methods and compositions described herein. In the methods disclosed herein, the reporter protein may comprise a fluorescent protein.
(161) The fluorescent protein may be green fluorescent protein (GFP), GFP-like fluorescent proteins (GFP-like), enhanced green fluorescent protein (EGFP). In alternative embodiments, the fluorescent protein is yellow fluorescent protein (YFP), an enhanced yellow fluorescent protein (EYFP), a blue fluorescent protein (BFP), an enhanced blue fluorescent protein (EBFP), a cyan fluorescent protein (CFP), an enhanced cyan fluorescent protein (ECFP), a red fluorescent protein (dsRED) superfolder GFP, superfolder YFP, orange fluorescent protein, red fluorescent protein, small ultrared fluorescent protein, FMN-binding fluorescent protein, dsRed, qFP611, Dronpa, TagRFP, KFP, EosFP, IrisFP, Dendra, Kaede, KikGr1, and derivatives thereof, or any other natural or genetically engineered fluorescent protein of those listed above. In yet further embodiments, the reconstituted fluorescent proteins may comprise of a mixture of fragments from the same or a combination any of the above listed fluorescent proteins.
(162) Green Fluorescent Protein (GFP) is a 238 amino acid long protein derived from the jellyfish Aequorea Victoria. The engineered GFP used in the split constructs of the present disclosure is 231 amino acids long and consists of SEQ ID NO: 18. Fluorescent proteins have also been isolated from other members of the Coelenterata, such as the red fluorescent protein from Discosoma sp. (Matz, M. V. et al. 1999, Nature Biotechnology 17:969-973), GFP from Renilla reniformis, GFP from Renilla Muelleri or fluorescent proteins from other animals, fungi or plants. There are various modified forms of GFP. The blue fluorescent variant of GFP (BFP) is described by Heim et al., Proc. Natl. Acad. Sci. 91:26, 1994, pp 12501-12504), and is a Y66H variant of wild type GFP. The yellow fluorescent variant of GFP (YFP) comprises the S65G, S72A, and T203Y mutations, and is disclosed in International Patent Publication No. WO98/06737. The cyan fluorescent variant of GFP (CFP) comprises the Y66W color mutation and optionally the F64L, S65T, N1461, M153T, V163A folding/solubility mutations. CFP is described in Heim, R., Tsien, R. Y., Curr. Biol. 6, 1996, 178-182). The EGFP variant comprises the F64L and S65T mutations of GFP and insertion of one valine residue after the first methionine. EGFP is described in WO 97/11094 and WO96/23810. The F64L mutation is the amino acid in position 1 upstream from the chromophore. A GFP or GFP variant containing this folding mutation provides an increase in fluorescence intensity when the GFP or GFP variant is expressed in cells at a temperature above about 30 C. (WO 97/11094).
(163) Non-limiting examples of GFPs include: Aequoria victoria GFP, Renilla muelleri GFP, Renilla reniformis GFP, Renilla ptilosarcus GFP, Emerald, Superfolder GFP, Azami Green, mWasabi, TagGFP, TurboGFP, AcGFP, ZsGreen, T-Sapphire.
(164) Non-limiting examples of BFPs include: EBFP2, Azurite, GFP2, GFP10, and mTagBFP.
(165) Non-limiting examples of CFPs include: mECFP, Cerulean, CyPet, AmCyan1, Midori-Ishi Cyan, TagCFP, mCFPmm, and mTFP1 (Teal).
(166) Non-limiting examples of YFPs include: Topaz, Venus, mCitrine, YPet, TagYFP, PhiYFP, ZsYellow1, and mBanana.
(167) Non-limiting examples of orange fluorescent proteins include: Kusabira Orange, Kusabira Orange2, mOrange, mOrange2, dTomato, dTomato-Tandem, TagRFP, TagRFP-T, DsRed, DsRed2, DsRed-Express (T1), DsRed-Monomer, and mTangerine
(168) Non-limiting examples of red fluorescent proteins include: mRuby, mApple, mStrawberry, AsRed2, mRFP1, JRed, mCherry, HcRed1, mRaspberry, dKeima-Tandem, HcRed-Tandem, mPlum, tdTomato, and AQ143.
(169) Also encompassed are fragments and derivatives of the above reporter proteins.
(170) The fluorescent protein may be split into two or more polypeptide or protein fragments, which may be activated. One or more of the activated split fluorescent protein fragments may comprise a mature preformed chromophore that is primed and in the ready-state for immediate fluorescence upon complementation with its cognate activated split-fluorescent fragment(s). For example, using inclusion bodies containing such a split fluorescent fragment comprises about half of a fully folded fluorescent protein with a correctly folded a mature chromophore that does not fluoresce alone, but is primed to fluoresce upon association with its cognate pair.
(171) One or more of the activated split fluorescent protein fragments may comprise a mature preformed chromophore that is active but in a non-fluorescent state. The isolation of the chromophore in its mature, yet inactive, state can allow for the ability to immediately detect fluorescence upon complementation with its corresponding fragment.
(172) The first portion of the reporter protein may comprise amino acids 1-157 of green fluorescent protein (GFP), and the second portion of the reporter protein may comprise amino acids 158-231 of GFP. If the GFP is truncated, the amino acid numbering must be adjusted accordingly. A C-terminal cysteine may be added to the first portion to aid in the conjugation of various nucleic acid binding motifs post expression. An N-terminal cysteine may be added to the second portion to aid in the conjugation of various nucleic acid binding motifs post expression. The first portion comprises an alpha fragment that contains a mature chromophore, which does not fluoresce alone, but is primed to fluoresce when paired with the second portion that comprises a beta fragment. Without wishing to be bound by theory, because the chromophore is preformed, it can immediately fluoresce. The alpha and beta fragments may not reassociate or fluoresce in the absence facilitated association.
(173) The first portion of the reporter protein may comprise amino acids 1-213 of superfolder GFP, and the second portion of the reporter protein may comprise amino acids 214-230 of superfolder GFP. If the superfolder GFP is truncated, the amino acid numbering must be adjusted accordingly. A C-terminal cysteine may be added to the first portion to aid in the conjugation of various nucleic acid binding motifs post expression. An N-terminal cysteine may be added to the second portion to aid in the conjugation of various nucleic acid binding motifs post expression. The first portion comprises an alpha fragment that contains a mature chromophore, which does not fluoresce alone, but is primed to fluoresce when paired with the second portion that comprises a beta fragment.
(174) The first portion of the reporter protein may comprise amino acids 1-154 of superfolder yellow fluorescent protein (YFP), and the second portion of the reporter protein may comprise amino acids 155-262 of superfolder YFP. If the superfolder YFP is truncated, the amino acid numbering must be adjusted accordingly. A C-terminal cysteine may be added to the first portion to aid in the conjugation of various nucleic acid binding motifs post expression. An N-terminal cysteine may be added to the second portion to aid in the conjugation of various nucleic acid binding motifs post expression. The first portion comprises an alpha fragment that contains a mature chromophore, which does not fluoresce alone, but is primed to fluoresce when paired with the second portion that comprises a beta fragment.
(175) The fluorescent protein may detectable by one or more of: flow cytometry, fluorescence plate reader, fluorometer, microscopy, fluorescence resonance energy transfer (FRET), by the naked eye or by other methods known to persons skilled in the art. When using flow cytometry, fluorescence may be detected using a florescence activated cell sorter (FACS) or time lapse microscopy.
(176) In another embodiment of the disclosure, association of activated split-polypeptide fragments can form an assembled protein which contains a discontinuous epitope, which may be detected by use of an antibody which specifically recognizes the discontinuous epitope on the assembled protein but not the partial epitope present on either individual polypeptide. These and other such derivatives can readily be made by the person of ordinary skill in the art based upon well-known techniques and screened for antibodies that recognize the assembled protein by neither protein fragment on its own.
(177) The split polypeptide can be a split fluorescent molecule. The molecule can comprise at least two activated split fluorescent fragments selected from the group consisting of GFP, GFP-like fluorescent proteins, fluorescent proteins, and variants thereof. One of the split-fluorescent fragments can comprise a mature preformed chromophore which is active by in a non-fluorescent state in the dissociated fragment. The activated fluorescent fragments, when associated with each other can contain the full complement of beta-strands necessary for fluorescence but are not fluorescent by themselves. Each of the activated split-fluorescent fragments of the molecule further comprise nucleic acid binding motif. The binding of the nucleic acid binding motifs to a target nucleic acid can facilitate the association of at least two active split-fluorescent fragments and reconstitution of the active fluorescent protein and fluorescent phenotype in real time.
(178) Split fluorescent protein assays are also described in International Patent Publication No. WO 2010/066113, published Jun. 17, 2010, which is incorporated by reference herein in its entirety, and U.S. Patent Publication No. 2009/0220942, which is incorporated by reference herein in its entirety.
(179) A combination split luciferase and split fluorescent protein assay is described further in Nakane, S. et al., Dual Split Protein (DSP) Assay to Monitor Cell-Cell Membrane Fusion, Methods Mol. Biol., 2015, 1313:229-36, which is incorporated by reference herein in its entirety.
(180) In various embodiments, fluorescence may be measured through the use of a flow cytometer or a bead array reader. For example, a BioPlex-100, a BioPlex-200, a Luminex-100, or a Luminex-200 bead array reader may be used.
(181) In some embodiments, before adding the VSV particle to the cells, plating media is removed and replaced with serum media (e.g., 50 L/well OptiMEM). In other embodiments, before adding the virus/serum mixes to the cells, plating media is not changed.
(182) The VSV particle may be present in the serum as a virus/serum mixture. In other embodiments, before adding the virus/serum mixes to the cells, plating media is not changed. The VSV particle may be present in the plasma as a virus/plasma mixture. In other embodiments, before adding the virus/plasma mixes to the cells, plating media is not changed.
(183) The reporter signal in the cells is measured, and then compared with a control.
(184) The period of time for incubating the recombinant VSV particle with the virus/serum mixture, or virus/plasma mixture, may be set as a time period appropriate for such an incubation, such as from about 30 minutes to 3 days, or from about 30 minutes to 75 minutes, from 45 minutes to 90 minutes, from 60 minutes to 2 hours, or from 90 minutes to 3 hours. An exemplary period of time may be about 1 hour.
(185) In some embodiments, after the recombinant VSV particle (e.g., in a mixture with serum or plasma) is added to target cells, the cells with virus are further incubated for 2-6 hours, for about 4 hours, or for 4 hours. If serum or plasma is present after the incubation, the serum or plasma may be removed so as to enhance cell fusion or luciferase activity.
(186) The sample (e.g., serum or plasma) can be obtained from a subject, for example from humans exposed to SARS-CoV-2 infection or vaccinated with SARS-CoV-2 vaccine or another immunogenic composition. The sample may or may not contain some level of SARS-CoV-2 neutralizing antibodies. Antibody responses in COVID-19 patients are described, e.g., in Okba, N. M. A. et al., SARS-CoV-2 specific antibody responses in COVID-19 patients Emerg. Infect. Dis., 2020, 26 (7) (available at doi.org/10.3201/eid2607.200841). It is desirable to quickly determine the level of neutralizing antibody response in a patient sample, and the methods described herein permit rapid evaluation of the presence and/or level of SARS-CoV-2 neutralizing antibodies.
(187) The methods described in Montefiori, D. C., Evaluating neutralizing antibodies against HIV, SIV, and SHIV in luciferase reporter gene assays. Curr. Protoc. Immunol., 2005, Chapter 12, Unit 12.11, which is incorporated by reference herein in its entirety, may also be used as part of the methods described herein.
(188) Kits
(189) The disclosure also provides kits in conjunction with various methods disclosed herein. In certain embodiments, the kit comprises in one or more containers (e.g., separate containers): (a) a first recombinant DNA that can be transcribed in a suitable host cell to produce a VSV antigenomic (+) RNA in which a foreign RNA sequence has been inserted; (b) a second recombinant DNA comprising a sequence encoding a VSV N protein or functional fragment or derivative thereof; (c) a third recombinant DNA comprising a sequence encoding a VSV L protein or functional fragment or derivative thereof; and (d) a fourth recombinant DNA comprising a sequence encoding a VSV P protein or functional fragment or derivative thereof; and optionally (e) a fifth recombinant DNA comprising a sequence encoding a VSV M protein or functional fragment or derivative thereof; and optionally (f) a sixth recombinant DNA comprising a sequence encoding a VSV G protein or functional fragment or derivative thereof. The second, third, fourth, and optionally fifth and/or sixth recombinant DNAs can be part of the same or different DNA molecules. In a preferred embodiment, the sequences encoding the N, L, P, and other proteins are each operably linked to a promoter that controls expression of the N, L, P, and other proteins, respectively, in the suitable host cell. In various embodiments, the kit can contain the various nucleic acids, e.g., plasmid expression vectors, described hereinabove for use in production of recombinant VSV particles.
(190) In another embodiment, a kit of the disclosure comprises (a) a first recombinant DNA that can be transcribed in a suitable host cell to produce a VSV antigenomic DNA in which a portion of the RNA has been inserted into or replaced by a foreign RNA sequence; and (b) a host cell that recombinantly expresses VSV N, P and L proteins and optionally M and/or G proteins. In certain embodiments, the foreign RNA sequence is inserted into a non-essential portion of the recombinant VSV genome. In certain embodiments, the foreign RNA sequence replaces the VSV's G protein.
(191) In certain embodiments, a kit of the disclosure comprises in separate containers: (a) a first plasmid comprising the following operatively linked components: (i) a bacteriophage RNA polymerase promoter, (ii) a DNA comprising a sequence capable of being transcribed in a suitable host cell to produce an RNA molecule comprising a VSV antigenomic RNA in which a portion of the RNA of the VSV has been inserted into or replaced by a foreign RNA sequence, and in which the 3 end of the antigenomic RNA is immediately adjacent to a ribozyme sequence that cleaves at the 3 end of the antigenomic RNA, and (iii) a transcriptional termination signal for the bacteriophage RNA polymerase; and (b) a second plasmid comprising the following operatively linked components: (i) the bacteriophage RNA polymerase promoter, (ii) a DNA comprising a sequence encoding the VSV N protein or functional fragment or derivative thereof, and (ii) a transcriptional termination signal for the bacteriophage RNA polymerase; and (c) a third plasmid comprising the following operatively linked components: (i) the bacteriophage RNA polymerase promoter, (ii) a DNA comprising a sequence encoding the VSV P protein or functional fragment or derivative thereof, and (ii) a transcriptional termination signal for the bacteriophage RNA polymerase; (d) a fourth plasmid comprising the following operatively linked components: (i) the bacteriophage RNA polymerase promoter, (ii) a DNA comprising a sequence encoding the VSV L protein or functional fragment or derivative thereof, and (ii) a transcriptional termination signal for the bacteriophage RNA polymerase; optionally (e) a fifth plasmid comprising the following operatively linked components: (i) the bacteriophage RNA polymerase promoter, (ii) a DNA comprising a sequence encoding the VSV M protein or functional fragment or derivative thereof, and (ii) a transcriptional termination signal for the bacteriophage RNA polymerase; and optionally (f) a sixth plasmid comprising the following operatively linked components: (i) the bacteriophage RNA polymerase promoter, (ii) a DNA comprising a sequence encoding the VSV G protein or functional fragment or derivative thereof, and (ii) a transcriptional termination signal for the bacteriophage RNA polymerase. In certain embodiments, the foreign RNA sequence is inserted into a non-essential portion of the recombinant VSV genome. In certain embodiments, the foreign RNA sequence replaces the VSV's G protein.
(192) In another embodiment, a kit of the disclosure further comprises in a separate container a recombinant vaccinia virus encoding and capable of expressing the bacteriophage RNA polymerase.
(193) In certain embodiments, the components in the containers are in purified form.
(194) The disclosure further provides a kit for detecting coronavirus neutralizing antibodies in a sample (e.g., neutralizing antibodies that target the SARS-CoV-2 S glycoprotein). The kit may comprise: a) a recombinant vesicular stomatitis virus (VSV) particle, where the VSV glycoprotein (G) is replaced by a coronavirus spike(S) glycoprotein or a fragment or a derivative thereof, where the S glycoprotein, fragment or derivative is capable of mediating infection of target cells; b) a first cell expressing a first portion of a reporter protein and a second cell expressing a second portion of the reporter protein, where the first cell and the second cells are capable of fusing with one another if contacted with the recombinant VSV particle, the fusion resulting in the generation of a detectable reporter signal; c) optionally, a positive control and/or a negative control; d) optionally, a substrate for the reporter protein, and e) optionally, instructions for use.
(195) The reporter protein may be any of the enzymes (e.g., luciferase) or fluorescent proteins (e.g., GFP) described herein. In various embodiments, the reporter protein may be incorporated into the VSV particle without being encoded by the genome in the VSV particle. In various embodiments, the reporter protein is encoded by the genome of the VSV particle.
(196) In some embodiments, the positive control may comprise a neutralizing antibody (e.g., an antibody against the SARS-CoV-2 spike(S) glycoprotein). A non-limiting example of a neutralizing antibody against the SARS-CoV-2 S glycoprotein is mAb10914 or mAb10922 (the amino acid and nucleotide sequences of mAb10914 and mAb10922 are provided in the Sequences section, below). Known amounts of a neutralizing antibody can be added to serum or plasma that does not comprise the neutralizing antibody so as to generate a positive control. In some embodiments, the positive control may comprise a molecule that blocks the interaction between the SARS-CoV-2 spike(S) glycoprotein and a protein with which it interacts on the cell surface, e.g., ACE2 or TMPRSS2. Non-limiting examples of such molecules include, e.g., anti-ACE2 antibodies (e.g., CL4013, AC18F, 881CT16.4.4, MA5-31395, and OTI1D2 antibodies), soluble ACE2 proteins (e.g., as disclosed in Fukuski et al., Journal of General Virology, 2005, 86:2269-74, incorporated by reference herein in its entirety), and anti-TMPRSS2 antibodies (e.g., H1H7017N antibody as described in International Patent Pub. No. WO2019/147831, incorporated by reference herein in its entirety). In some embodiments, the positive control may comprise a molecule (e.g., an antibody) that blocks cell-cell fusion. Non-limiting examples of such molecules include, e.g., MC5 and DL11 antibodies described in Saw, W. T. et al., Methods, 2015, 90:68-75, incorporated by reference herein in its entirety.
(197) The negative control can comprise serum or plasma that does not comprise the neutralizing antibody. The negative control can comprise serum or plasma that does not comprise the neutralizing antibody but comprises other antibodies, such as, an antibody that specifically targets a VSV glycoprotein (G), an antibody that specifically targets a VSV matrix protein (M), an antibody that specifically targets another coronavirus spike(S) glycoprotein different from that being tested in the method (e.g., an antibody that specifically targets the SARS-CoV-1 spike(S) glycoprotein but does not bind to the SARS-CoV-2 spike(S) glycoprotein), or monoclonal antibodies specific for HIV antigens (e.g., IgG1b12, 2G12, X5, 2F5, 4E10 as described in Montefiori, D. C., Current Protocols in Immunology, 2004, Chapter 12: Unit 12.11.1, incorporated by reference herein), or any isotype-control antibodies.
(198) In yet another embodiment, the kit may comprise: a) a recombinant vesicular stomatitis virus (VSV) particle where (i) the VSV glycoprotein (G) is replaced by a coronavirus spike(S) glycoprotein or a fragment or a derivative thereof, where said S glycoprotein, fragment or derivative is capable of mediating infection of a target cell and where (ii) the VSV particle comprises a reporter protein and/or a nucleic acid molecule encoding said reporter protein; b) cells susceptible to infection mediated by the coronavirus S glycoprotein; c) optionally, a positive control and/or a negative control; d) optionally, a substrate for the reporter protein, and e) optionally, instructions for use.
(199) A cell growth media and/or fixative may optionally be included in any of the kits.
Examples
(200) The present disclosure is also described and demonstrated by way of the following examples. However, the use of this and other examples anywhere in the specification is illustrative only and in no way limits the scope and meaning of the disclosure or of any exemplified term. Likewise, the disclosure is not limited to any particular preferred embodiments described here. Indeed, many modifications and variations of the disclosure may be apparent to those skilled in the art upon reading this specification, and such variations can be made without departing from the disclosure in spirit or in scope. The disclosure is therefore to be limited only by the terms of the appended claims along with the full scope of equivalents to which those claims are entitled.
Example 1: Preparation of VSV Expressing Spike(S) Glycoprotein Constructs
(201) Infectious clones of Indiana strain VSV were used to generate four recombinant VSV constructs, wherein the VSV (G) glycoprotein was deleted and replaced by codon optimized sequences suitable for expression in human cells and encoding: (1) the full length SARS-CoV-2 spike(S) glycoprotein sequence (NCBI Reference Sequence: NC_045512.2; Protein_ID: YP_009724390.1) (variant 1; VSV SARS-CoV-2 dG=VSV-SARS-CoV-2-S; amino acid sequence SEQ ID NO: 1; codon optimized coding nucleotide sequence SEQ ID NO: 2); (2) the SARS-CoV-2 S glycoprotein sequence with a deletion of 19 amino acids KFDEDDSEPVLKGVKLHYT (SEQ ID NO: 20) at the C terminus (variant 2; VSV SARS-CoV-2 19CT dG=VSV-SARS-CoV-2-S-19CT; amino acid sequence SEQ ID NO: 3; codon optimized coding nucleotide sequence SEQ ID NO: 4); (3) the SARS-CoV-2 S glycoprotein sequence with a replacement of the S glycoprotein cytoplasmic tail with VSV G cytoplasmic tail KLKHTKKRQIYTDIEMNRLGK (SEQ ID NO: 21) (variant 3; VSV SARS-CoV-2 VSV-G CT dG; amino acid sequence SEQ ID NO: 5; codon optimized coding nucleotide sequence SEQ ID NO: 6), or (4) variant 4-the full length SARS-CoV-2 S glycoprotein sequence (VSV-SARS-CoV-2-S; amino acid sequence SEQ ID NO: 1; codon optimized coding nucleotide sequence SEQ ID NO: 2) with the wild-type VSV Kozak sequence (cActATG; SEQ ID NO: 11) in place of the optimized Kozak sequence (caccATG; SEQ ID NO: 12) used in the other three constructs. One set of variant 1-4 constructs (constructs 1-4) was prepared that encoded wild-type VSV M protein (amino acid sequence SEQ ID NO: 9; nucleotide sequence SEQ ID NO: 10). A second set of variant 1-4 constructs (constructs 5-8) was prepared that encoded M protein with the substitution M51R (amino acid sequence SEQ ID NO: 7; nucleotide sequence SEQ ID NO: 8) resulting in virus attenuation. See
(202) The variant 1-4 recombinant viral particles were produced using standard published protocol using transfection with vaccinia-T7 virus (expressing T7 polymerase) followed by co-transfection with N, P and L expression plasmids (with respective genes under the control of T7 promoter) and the viral genome plasmid. A plasmid expressing VSV G was also transfected into the cells to facilitate rescue. The viruses were amplified and propagated in Vero cells. The amplified recombinant viruses do not have VSV (G) glycoprotein and depend on SARS-CoV-2 spike(S) glycoprotein for entry and infection.
(203) Correct incorporation of VSV G, N and M proteins and SARS-CoV-2 S glycoprotein in the recombinant variant 2 VSV-SARS-CoV-2-S-19CT construct 6 (VSV-M51R-nCOV19-S 19CT) virions was analyzed by Western blotting. The results are shown in
Example 2: Development of a High-Throughput IMMUNO-CoV v. 1 Assay for Detecting Antibodies that Neutralize SARS-CoV-2
INTRODUCTION
(204) Laboratory assays to detect SARS-CoV-2 neutralizing antibodies have been developed using clinical isolates of SARS-CoV-2, pseudotyped lentiviral vectors, and pseudotyped Vesicular stomatitis viruses (VSVs). Describe herein is a high-throughput, scalable clinical assay for the detection and quantitation of SARS-CoV-2-neutralizing antibodies using a recombinant VSV engineered to express the SARS-CoV-2 spike(S) glycoprotein in place of the VSV-G glycoprotein. The SARS-CoV-2 spike(S) glycoprotein binds to angiotensin converting enzyme-2 (ACE2) on the cell surface to initiate virus entry into the cell (Hoffman 2020, Walls 2020, Wan 2020). As the primary surface exposed viral protein, the coronavirus spike is a major target of the host immune system (Corman 2016, Liu 2006, Nie 2004, Zhao 2017). Blocking spike interaction with ACE2 prevents virus entry, making spike the primary target of neutralizing antibodies (Walls 2020, Wu 2020). Therefore, the present inventors hypothesized that the detection of antibodies capable of neutralizing VSV expressing spike(S) glycoprotein should directly reflect the level of SARS-CoV-2 neutralizing antibodies present in a sample. Importantly, using spike-expressing VSV in place of SARS-CoV-2 significantly increases assay safety and scalability.
(205) The present assay (IMMUNO-CoV v. 1) exploits the fusion phenotype of SARS-CoV-2 spike glycoprotein-expressing VSV by using a dual split protein (DSP) luciferase reporter system to quantitate virus-induced cell fusion and thereby the level of virus neutralization (
(206) The IMMUNO-CoV v. 1 assay exhibited 100% specificity in validation tests, and across all tests no false positives were detected. In blinded analyses, assay results demonstrated near-perfect correlation (196/197) with available clinical data and qRT-PCR or other serological testing results (commercially available ELISA). To quantitate the strength of the anti-viral response, a calibration curve was developed consisting of different concentrations of anti-SARS-CoV-2-spike monoclonal antibody spiked into pooled SARS-CoV-2 seronegative serum or plasma matrix. Using the calibration curve, neutralizing antibody levels were quantitated in the assay from a single 1:100 serum test dilution, determined to be the minimum recommended dilution. For samples with high levels of SARS-CoV-2-neutralizing antibodies, a second dilution facilitated more precise quantitation. The virus neutralization units (VNUs) calculated using this calibrator method correlated closely (p<0.0001) with plaque reduction neutralization titer-EC50 (PRNT.sub.EC50) values determined by plaque reduction neutralization test against a clinical isolate of SARS-CoV-2. Taken together, these results demonstrate that the present IMMUNO-CoV v. 1 assay accurately quantitates SARS-CoV-2 neutralizing antibodies in samples (e.g., sera or plasma) in biosafety level 2 (BSL2), high-throughput format and can provide vital information for, e.g., evaluating donor eligibility for convalescent plasma therapy programs and participant eligibility for various clinical trials, as well assessing immune responses to candidate SARS-CoV-2 vaccines.
(207) Results
(208) Measurement of VSV-SARS-CoV-2-S-19CT Fusion Through Luciferase Assay
(209) Biosafety level 3 (BSL3) contaminant and practices are required to safely perform neutralization assays utilizing SARS-CoV-2, making widespread testing of patient samples using these assays impractical. The present inventors therefore sought to develop a safer, scalable assay that could be used to detect SARS-CoV-2 neutralizing antibodies in blood samples. The present inventors designed an assay in which syncytia formation in Vero cells, induced by infection with SARS-CoV-2 spike(S) glycoprotein-expressing VSV, is detected using a dual split protein (DSP) luciferase reporter (
(210) Since Vero cells were infected by VSV-SARS-CoV-2-S-19CT and express both ACE2 and TMPRSS2 (
(211) When mixed monolayers of Vero-DSP1 and Vero-DSP2 cells seeded at a 1:1 ratio were infected with VSV-SARS-CoV-2-S-19CT, syncytia formation was observed and luciferase activity was readily detected at 24 hours post infection (
(212) Optimization of VSV-SARS-CoV-2-S-19CT Fusion
(213) Syncytia formation is required to produce functional luciferase in the present assay. However, complete destruction of the cell monolayer following syncytia formation reduces luciferase activity due to loss of cell viability. The inventors therefore determined the optimal time after VSV-SARS-CoV-2-S-19CT infection to measure luciferase. EnduRen Live Cell Substrate (EnduRen) is an engineered pro-substrate, which must be cleaved by cellular esterases to produce the luciferase substrate coelenterazine. Because the pro-substrate is highly stable, luciferase activity can be measured repeatedly at any time between 2 and 24 hours after EnduRen I'M addition to cells. By 15 hours after infection, luciferase activity in infected Vero-DSP1/Vero-DSP2 monolayers was readily distinguished from background signal in mock-infected cells (
(214) To enhance cell fusion and luciferase activity, and thereby increase assay sensitivity, the optimal cell density and virus concentration were also determined. Vero-DSP1/Vero-DSP2 cells were seeded at increasing cell densities and after 24 hours the monolayers were infected with increasing concentrations of VSV-SARS-CoV-2-S-19CT. At all virus dilutions, increasing cell density improved luciferase signal (
(215) Not surprisingly, additional studies across many experiments indicated that different lots of VSV-SARS-CoV-2-S-19CT exhibited different potencies for inducing fusion. An appropriate concentration of virus for assay was therefore determined for each lot of virus based on performance against a set of contrived controls (see below).
(216) Detection of VSV-SARS-CoV-2-S-19CT Neutralization Using the Vero-DSP Reporter Assay
(217) To demonstrate that virus neutralization could be detected using the present assay, the capacity of several purified proteins to inhibit virus-induced fusion was first tested. Affinity-purified polyclonal anti-SARS-CoV-spike antibody and soluble recombinant Ace2 protein bind spike on the virus surface and block entry into cells. Similarly, monoclonal anti-Ace2 antibody blocks the cellular receptors and limits virus entry. All three inhibitors successfully blocked VSV-SARS-CoV-2-S-19CT-induced fusion in a dose-dependent manner (
(218) Optimization of VSV-SARS-CoV-2-S-19CT Neutralization Time
(219) In an early experiment it was observed that even in the absence of any neutralizing serum or inhibitors, incubation of VSV-SARS-CoV-2-S-19CT at 37 C. for 1 hour resulted in a loss of luciferase activity (
(220) Heat Inactivation is not Necessary for Assay Compatibility
(221) To further streamline the assay workflow, it was determined whether heat inactivation of samples is necessary to achieve reliable results. Serum samples were used for testing, due to their more ready availability compared to plasma samples. The inventors initially tested three presumptive SARS-CoV-2 seronegative samples and a commercially available sera pool (generated before fall of 2019) at a 1:100 dilution. In the sera pool, and two of the three negative sera, heat-inactivation lead to a modest decrease in luciferase activity (
(222) Determination of the Minimum Recommended Dilution
(223) Sample interference is common in serological assays at high sample concentrations. Therefore, the inventors defined the minimum recommended dilution for assay samples, in which false positives due to sample interference are nearly eliminated. To this end, 39 presumptive SARS-CoV-2 seronegative samples were assayed at 2-fold serial dilutions ranging from 1:10 through 1:320. As expected, interference with virus fusion and luciferase activity was observed at higher serum concentrations (
(224) Development of a Contrived Positive Control
(225) Due to the limited availability of large quantities of qualified SARS-CoV-2 seropositive sera, the inventors sought to develop a contrived positive control for the assay. To this end, various concentrations of mAb10914, a monoclonal antibody that binds to the SARS-CoV-2 spike(S) glycoprotein, were spiked into pooled SARS-CoV-2 seronegative serum or media alone. As a control, isotype antibody was also used. As expected, mAb10914 caused dose-dependent neutralization of VSV-SARS-CoV-2-S-19CT in both media and pooled negative sera (
(226) Examination of Assay Specificity and Sensitivity
(227) CPC High value was used to define assay specificity and sensitivity. To measure specificity, 30 presumptive SARS-CoV-2 seronegative samples were tested alone or spiked with 2 g/mL (CPC High) of mAb10914. This evaluation was conducted to verify that at the optimized 1:100 serum dilution no false positives were obtained and that all contrived positive controls showed virus neutralization. In two separate analytical runs performed by different analysts, no false positives or negatives were observed (Table 1). One negative sample was qualified as indeterminant in the first assay due to one replicate having signal <50%. However, in the second assay the sample was correctly identified as negative. Thus, in this validation IMMUNO-CoV v. 1 assay sensitivity and specificity was 100%. To measure assay specificity near the limit of detection, 30 presumptive SARS-CoV-2 seronegative samples (at 1:100 serum dilution) were tested alone; and 19 of the samples were also measured after spike with 0.35 g/mL of mAb10914. 11 of the samples were spiked with 2 g/mL mAb10914, which is not near the limit of detection. The experiment demonstrated 68% sensitivity near the limit of detection (Table 2).
(228) To evaluate assay sensitivity, a similar, but single-blinded analysis was performed using the same 30 presumptive SARS-CoV-2 seronegative samples. Duplicate samples were assayed at 1:100, where one replicate sample was spiked with mAb10914 at 2 g/mL (CPC High) or 0.35 g/mL (borderline inhibition), before being assigned blinded IDs. Of the 30 negative samples, 26 were identified as negative and 4 as indeterminant (Table 2). 10 of the 11 CPC High samples were detected, and sample preparation error was suspected in the single positive not identified. From the 19 borderline samples, 13 were identified as positive, 4 as negative, and 2 as indeterminant, concordant with the samples containing only a low-level of neutralizing antibody and 0.35 g/mL being close to the previously estimated assay limit of detection.
(229) To further evaluate assay specificity, samples from patients who had recovered from documented infections with four common coronaviruses (HCoV-NL63, HCOV-229E, HCoV-OC43 and HKU1) prior to December 2019 were tested. No cross-reactivity with the common coronaviruses was observed demonstrating strong IMMUNO-CoV v. 1 assay specificity for SARS-CoV-2.
(230) Demonstration of Clinical Agreement
(231) Given that the present assay performed well with the contrived controls, the inventors proceeded with blinded studies to determine whether results correlated well with clinical symptoms. Serum samples were acquired from negative donors (symptomless, negative for SARS-CoV-2 by PCR, or SARS-CoV-2 seronegative by ELISA), positive donors (positive for SARS-CoV-2 by PCR or SARS-CoV-2 seropositive by ELISA), and contact positive donors (not tested, but in direct contact with someone positive for SARS-CoV-2 by PCR). A total of 230 samples were received and blinded to the assay analysts until after testing was complete. Of the 125 negative samples received, all 125 tested negative in the assay (Table 3), providing further evidence of the assay's excellent specificity. All 38 of the known SARS-CoV-2 seropositive samples also tested positive in the assay. From the 34 samples obtained from donors that had previously tested positive for SARS-CoV-2 by PCR, neutralizing antibodies were identified in 31 samples. Upon closer examination, one sample was expected to be negative because it was collected only 8 days after positive PCR test, which is not sufficient time for a strong antibody response to develop. From donors who had contact with someone positive for SARS-CoV-2, 13 of 33 samples (39.4%) were identified as positive for neutralizing antibodies. Taken together, the present data indicate that the assay has excellent clinical agreement.
(232) Correlation Between VSV-SARS-CoV-2-S-19CT and SARS-CoV-2 Neutralization
(233) The strong clinical agreement observed for the assay supported the inventors' premise that neutralization of VSV-SARS-CoV-2-S-19CT accurately reflects neutralization of SARS-CoV-2. In order to directly demonstrate this correlation, 20 of the serum samples from above were also tested against a clinical isolate of SARS-CoV-2 in a BSL-3 plaque reduction neutralization test (PRNT) (PRNT is described, e.g., in Wang et al., Nat Commun 11, 2251 (2020) doi.org/10.1038/s41467-020-16256-y; Okba et al., Emerg Infect Dis. 2020 July doi.org/10.3201/eid2607.200841; Ranawaka et al., Euro Surveill. 2020; 25 (16): pii=2000421. doi.org/10.2807/1560-7917.ES.2020.25.16.2000421). Each of the 5 samples that tested negative in the present assay were also below the limit of detection in the PRNT assay (Table 4). Likewise, the 15 samples that tested positive in the present assay also were positive in the PRNT assay. Moreover, quantitative virus neutralizing units (VNUs) determined in the present assay correlated closely with PRNT50% and PRNT.sub.EC50 values (Tables 4-5 and
(234) Correlation between VNU values and symptom severity was investigated for 31 positive samples for which clinical symptoms were self-reported (
Example of a 96-Well Plate Layout for the Assay
(235) A non-limiting example of a 96-well plate layout for the assay is shown in
(236) To determine the result the following steps are performed: 1. Luciferase activity is measured (2000 ms integration/well, 200 ms settle time between wells) and the output unit is relative light unit (RLU). 2. The average (mean) RLU from the BC wells is determined and subtracted from each other to give background-corrected RLU values. 3. The mean corrected RLUs from the NC wells is determined. 4. Controls are examined for any obvious outliers, which are removed from mean values. 5. The percent luciferase signal is determined for each sample and standard (calculated for each replicate well individually). Percent luciferase signal is:
(237)
DISCUSSION
(238) High demand for serological tests to detect anti-SARS-CoV-2 antibodies is fueled by necessity to understand past rates of infection and evaluate the efficacy of vaccines and plasma therapies. Numerous ELISA and rapid diagnostic tests have been developed to detect anti-SARS-CoV-2 antibodies, and several are approved in various countries for diagnostic testing. Yet, an easily scalable serological assay for detecting antibodies capable of neutralizing SARS-CoV-2 has remained elusive. Described herein is IMMUNO-CoV v. 1 assay for the detection of SARS-CoV-2 neutralizing antibodies that is high-throughput, performed under lower biosafety (BSL2) conditions, scalable, and quantitative. The present assay is useful, e.g., for screening donor samples for SARS-CoV-2 plasma therapy trials, evaluating immune responses to candidate vaccines, and better understanding how antibody responses relate to SARS-CoV-2 immunity.
(239) The present assay exploits the fusion phenotype of recombinant VSV-SARS-CoV-2-S-19CT (or other similar constructs such as VSV-SARS-CoV-2-S) to produce quantitative luciferase signal in a 96-well plate format (
(240) During testing, three samples collected from donors that were positive for SARS-CoV-2 by PCR test were negative using the present assay (Table 4). One of these samples was deemed a true negative, as it was received only 8 days after the positive PCR test, earlier than a strong antibody immune response is expected, and the sample also tested negative in the SARS-CoV-2 PRNT50 assay. Whether the other two samples represent false or true negatives has not yet been determined. Possibly, the samples indeed lacked any significant level of neutralizing antibodies, which supports the hypothesis that a positive PCR test results alone do not guarantee a protective antibody response. Alternatively, the samples may have only possessed low levels of neutralizing antibodies that were missed by the present assay. Studies performed using the contrived control spiked into negative pooled sera at a low level, suggested that near the limit of detection assay sensitivity is 68% (Table 2). However, sensitivity was 90.9% when the contrived control was spiked in at a higher concentration (2 g/mL). Over half of the clinical samples tested exhibited virus neutralization units (VNUs) equivalent to at least 2 g/mL neutralizing antibody. It is not surprising, therefore, that when calculating sensitivity based on blinded tests, a much higher degree of sensitivity (97.2%) is observed. Signal below 50% is cutoff. Variability was within acceptable limits.
(241) The RBD of spike is likely the primary target of neutralizing antibodies, yet additional studies are needed to determine whether the assay, which only measures disruption of RBD-ACE2 binding, will accurately quantitate total SARS-CoV-2 neutralizing antibodies. Notably, the RBD domain of coronaviruses constantly switches between a standing-up and lying-down position (Yuan 2017 and Gui 2017), suggesting that some neutralizing antibody targeting may be context dependent. As proteolytic activation of spike is also required for membrane fusion and virus entry into cells the S1/S2 cleavage boundary may also be a target for neutralizing antibodies. Several recently developed assays use viral vectors pseudotyped with SARS-CoV-2 spike glycoprotein. However, scalability of pseudotyped viruses is more challenging than with live-replicating viruses (as used in the present assay), offering the present assay an advantage for widespread diagnostic testing.
(242) Another advantage of the present assay is that the level of SARS-CoV-2 neutralizing antibodies is quantitated without the need for a full dilution series of the test samples. A minimum recommended dilution of 1:100 was determined for the assay. At this dilution, about 16.9% of samples fell above the linear range of the calibration curve. For samples containing high levels of SARS-CoV-2 neutralizing antibodies, a second dilution (e.g., 1:1000) can facilitate a more precise quantitation of antibody levels.
(243) Additional testing has indicated that the Vero-DSP1 and Vero-DSP2 cell lines can be passaged for at least three weeks without impact on assay performance and that the SARS-CoV-2 neutralizing antibodies detected using this assay are stable under a number of storage conditions, including refrigeration for up to one week and multiple freeze-thaw cycles. Experiments with NL1 and a small pool of presumptive SARS-CoV-2 seronegative plasma (
(244) Studies with MERS and SARS-CoV have demonstrated antibody dependent enhancement of infection in vitro (Yip, Wang, Wan, and Jaume). Studies in NHP also suggest possible disease augmentation with increasing antibody levels for SARS-CoV (Liu et al. 2019). Some evidence supports antibody dependent enhancement in clinical cases of SARS (Ho 2005, Peiris 2003). Yet early studies using COVID-19 convalescing plasma to treat severe cases of COVID-19 have shown great promise. As researchers work to further refine convalescing plasma therapies, develop monoclonal antibody therapies, and engineer effective vaccines that produce strong anti-SARS-CoV-2 immune responses, there is clearly still much to be learned about the interaction between SARS-CoV-2 and the immune system. How total anti-SARS-CoV-2 antibody levels relate to neutralizing antibody levels is a key piece of this puzzle. A piece that the present assay can help to answer.
(245) Materials and Methods
(246) Cells. African green monkey Vero cells, Vero-His, and baby hamster kidney BHK-21 cells were maintained in high-glucose DMEM supplemented with 5% fetal bovine serum and 1X penicillin/streptomycin (complete media) at 37 C./5% CO.sub.2.
(247) Vero-DSP1 (Vero-DSP-1-Puro; CLR-73) and Vero-DSP2 (Vero-DSP-2-Puro; CLR-74) cells were generated by transducing Vero cells (African green monkey-derived kidney epithelial cells) with self-inactivating lentiviral vectors SFFV-DSP1-7-P2A-Puro or SFFV-DSP8-11-P2A-Puro expressing Rluc8 155-156DSP1-7 and Rluc8 155-156DSP8-11, respectively, under control of the spleen focus forming virus (SFFV) promoter and linked to the puromycin resistance gene via a P2A cleavage peptide. Transduced cells were selected using 10 g/mL puromycin. Following selection Vero-DSP cells were maintained in complete media supplemented with 5 g/mL puromycin. Puromycin was excluded removed when cells were seeded for assays.
(248) Vero-DSP1 cells express Rluc8 155-156DSP1-7 luciferase-GFP fusion protein (SEQ ID NO: 14) comprising RLuc8 mutant Renilla luciferase fragment amino acids 1-155 and engineered GFP fragment amino acids 1-156. Vero-DSP2 cells express Rluc8 155-156DSP8-11 luciferase-GFP fusion protein (SEQ ID NO: 16) comprising RLuc8 mutant Renilla luciferase fragment amino acids 157-311 and engineered GFP fragment amino acids 157-231. RLuc8 mutant Renilla luciferase contains the mutations A55T, C124A, S130A, K136R, A143M, M185V, M253L, and S287L (see SEQ ID NO: 19). The sequence of engineered GFP is provided in SEQ ID NO: 18.
(249) Generation of VSV-SARS-CoV-2-S-419CT. As discussed in Example 1, above, the full length SARS-CoV-2 spike(S) glycoprotein sequence (NCBI Reference Sequence: NC_045512.2; Protein_ID: YP_009724390.1) (variant 1; VSV SARS-CoV-2 dG=VSV-SARS-CoV-2-S; amino acid sequence SEQ ID NO: 1; codon optimized coding nucleotide sequence SEQ ID NO: 2); (2) the SARS-CoV-2 S glycoprotein sequence with a deletion of 19 amino acids KFDEDDSEPVLKGVKLHYT (SEQ ID NO: 20) at the C terminus (variant 2; VSV SARS-CoV-2 19CT dG=VSV-SARS-CoV-2-S-19CT; amino acid sequence SEQ ID NO: 3; codon optimized coding nucleotide sequence SEQ ID NO: 4). Full-length human codon-optimized SARS-CoV-2 spike(S) glycoprotein (NC_045512.2) was cloned in pUC57. The plasmid was used as a PCR template to generate a cDNA encoding SARS-CoV-2-S with a deletion in the nucleotides encoding the C-terminal 19 amino acids (S-19CT) and 5 MluI and 3 NheI restriction sites. To generate the viral genome, the amplified PCR product containing S-19CT was cloned into pVSV-M51R in place of VSV-G using the MluI and NheI restriction sites (
(250) Infections. Vero monolayers in 6-well plates were inoculated with 2 mL of passage 3 VSV-SARS-CoV-2-S-19CT in OptiMEM or OptiMEM alone (mock). After 4 hours at 37 C./5% CO.sub.2, the inoculums were removed and the cells were rinsed once with OptiMEM. Fresh OptiMEM alone or OptiMEM containing 4 g/mL trypsin were added to wells. Cells were returned to the 37 C./5% CO.sub.2 incubator until 20 hours after infection, when they were photographed at 100 magnification using an inverted microscope.
(251) Reagents. EnduRen live cell substrate was prepared according to manufacturer's instructions (Promega #E6482). For inhibition studies, mouse anti-SARS-CoV-2 spike antibody (GeneTex #GTX632604), affinity-purified, polyclonal anti-human-ACE2 antibody (R&D Systems #AF933), and recombinant human ACE2 (R&D Systems #933-ZN-010) were diluted in OptiMEM to the desired concentrations.
(252) Luciferase Assays. Assays were performed in 96-well black-walled plates with clear bottoms. EnduRen substrate was added to wells (final concentration of 7.5 M) at various times after infection, but at least 2 hours before reading bioluminescence on a Tecan Infinity or Tecan M Plex instrument (2000 ms integration, 200 ms settle time). For kinetic experiments, repeated bioluminescence reads were performed without the addition of more EnduRen for up to 24 hours after initial EnduRen addition; at later time points additional EnduRen was added to wells at least 2 hours prior to reading bioluminescence.
(253) Collection of plasma and sera samples. A clinical protocol to collect blood samples for assay validation was reviewed and approved by Western IRB (study ID: VYR-CoV-001). Serum and plasma samples were collected from patients who had previously tested positive for SARS-CoV-2 infection by a PCR test, from patients who had known exposure to individuals infected with SARS-CoV-2 and symptoms of COVID-19, as well as a cohort of patients of were presumed negative for antibodies, i.e. individuals who never had symptoms of COVID-19 disease and were likely never exposed. A total of 150 adults were enrolled at BioTrial based in Newark, New Jersey and Olmsted Medical Center in Rochester, Minnesota. Eighty additional sera aliquots from samples that had been tested using the EUROIMMUN assay.
(254) Blinded sample testing. Sera samples were assigned a random ID prior to being given to analysts for assay testing. Samples were assayed in batches, with an unknown number of expected positive and negative samples in each batch. Each sample was assayed at a 1:100 dilution, with all positive and some negative samples being further assayed in a dilution series including 1:100, 1:200, 1:400, 1:800, and 1:1600.
(255) PRNT Assay. Sera was heat-inactivated for 30 minutes at 56 C. and serially diluted in X. SARS-CoV-2 was diluted to 800 PFU/mL and mixed with an equal volume of diluted sera (final dilutions of serum with virus 1:20, 1:40, 1:80, 1:160, 1:320, 1:640, 1:1280, 1:2560, 1:5120, 1:10240, 1:20480, 1:40960). Virus mixed with an equal volume of media alone was used as a control. After a 1 hour incubation at 37 C., 250 L of virus/serum or virus/media mixes were used to inoculate Vero-E6 monolayers in 6-well plates. Inoculations proceeded for 1 hour at 37 C. with occasional rocking, before monolayers were overlaid with 3 mL of 0.4% low-melting agarose in Minimal Essential Media supplemented with 2% fetal bovine serum and 1X penicillin/streptomycin. Plates were incubated at 37 C. until plaques appeared, then fixed with 10% formaldehyde, and stained with 0.25% crystal violet. Plaques were counted and the number of plaques at each dilution was plotted and used to determine the PRNT.sub.EC50 value for each sample by a nonlinear regression model. Plaque counts greater than 30 were too numerous to count and were considered as equivalent to the virus/media control. The PRNT50% titer was determined as the highest dilution (represented as the reciprocal) of serum that inhibited 50% of plaques relative to the virus/media control well.
(256) Flow cytometry. Vero-DSP1 cells were dislodged using Versene, counted, and transferred to microcentrifuge tubes (510.sup.5 cells/tube was used for ACE2 staining and 1.510.sup.6 cells/tube was used for TMPRSS2 staining). For ACE2 staining, cells were pelleted and resuspended in 100 L FACS buffer (2% FBS in DPBS) containing 0.2 g goat-anti-human ACE2 (R&D Systems #AF933). After 30 minutes on ice, cells were rinsed with 1 mL FACS buffer and resuspended in 100 L FACS buffer containing 5 L donkey-anti-goat IgG-PE secondary antibody. After 30 minutes on ice, cells were rinsed with 1 mL FACS buffer and fixed with 1% paraformaldehyde for 15 minutes on ice. Cells were washed twice with FACS buffer, resuspended in 500 L FACS buffer and analyzed on a CYTOFLEX flow cytometer (Beckman Coulter). For TMPRSS2 staining cells were resuspended in 1 mL ice-cold 70% ethanol in DPBS and incubated on ice for 10 minutes. Cells were centrifuged, washed once with 1 mL FACS buffer, and resuspended in 100 L of a 0.5% saponin solution containing 4 g rabbit anti-TMPRSS2 (Invitrogen #PA5-14264). After 30 minutes on ice, samples were washed twice with 1 mL FACS buffer and resuspended in 100 L of a 0.5% saponin solution containing 2 L goat anti-rabbit IgG-AF647 secondary antibody. After 30 minutes on ice, cells were washed twice with FACS buffer and fixed with 1% paraformaldehyde for 15 minutes on ice. Cells were washed twice with FACS buffer, resuspended in 500 L FACS buffer and analyzed on a CYTOFLEX flow cytometer (Beckman Coulter). For both ACE2 and TMPRSS2 staining, secondary antibody only controls were used for isotype.
(257) Immunoblot. Total cells and culture supernatants of Vero cells infected with VSV-GFP or VSV-SARS-CoV-2-S-19CT or mock-infected were harvested 48 hours after infection. Virus was released from the cell membranes by freeze-thaw and cell debris was removed by centrifugation. Samples were diluted in duplicate in LDS sample buffer (Invitrogen #B0007) and reducing agent (Invitrogen #B0009) according to the manufacturer's directions, incubated at 70 C. for 10 minutes, and 40 L of each sample was ran on duplicate 4-12% Bis-Tris 15-well gels (Invitrogen #NW04125Box) along with precision plus protein dual color standard (Bio-Rad #161-0374). Proteins were transferred to nitrocellulose membranes using a Power Blotter XL. Membranes were blocked in 5% non-fat dry milk in TBST, washed three times with TBST, and incubated for 1 hour at room temperature with primary antibody mouse anti-SARS-CoV-2 spike (1:1000, GeneTex #GTX632604) or rabbit polyclonal anti-VSV (1:5000, Imanis Life Sciences #REA005). Membranes were washed three times with TBST and incubated for 1 hour at room temperature with secondary antibody goat anti-mouse IgG-HRP (Prometheus #20-304) or goat anti-rabbit IgG-HRP (Prometheus #20-303) at 1:20,000. Membranes were washed three times with TBST, and protein bands were developed for 2 minutes at room temperature using ProSignal Dura ECL Reagent (Prometheus #20-301). Protein bands were imaged using a Bio-Rad ChemiDoc Imaging System.
(258) Determination of percent response and virus neutralization units. Raw relative light unit (RLU) values for each well were blank corrected using the mean RLU value from background wells receiving pooled SARS-CoV-2 seronegative serum at 1:100 but not virus. The percent response was determined for each sample well as the corrected RLU value divided by the mean corrected RLU value from negative control wells receiving virus and pooled SARS-CoV-2 seronegative serum at 1:100 multiplied by 100%. Samples with a percent response <50% for both sample replicates were classified as positive. Samples with a percent response 50% for both sample replicates were classified as negative. When one replicate exhibited a positive response and the other a negative response, the sample was classified as indeterminant and assay was repeated. Virus neutralizing titers (VNUs) were determined for positive samples based on a calibration curve. The calibration curve was run on each plate and consisted of mAb10914 spiked into pooled SARS-CoV-2 seronegative sera at 3, 1, 0.33, 0.11, and 0.037 g/mL. From the calibration curve, the equivalent concentration of neutralizing antibody for a given percent response was determined. To convert to VNU, the antibody equivalent concentration was multiplied by 100.
(259) Statistical Analyses. Descriptive statistics, comparisons, and regression analyses were performed in Graph Pad Prism, v8.4.0 (San Diego, CA). Tests for normality of variance were conducted, and whenever possible parametric comparisons were used. For non-normal datasets, non-parametric approaches were used. A four-parameter non-linear regression was used for the calibration curve of the virus neutralizing units within the assay. For correlation analyses, Spearman's rank-order correlation analysis was conducted.
(260) TABLE-US-00002 TABLE 1 Assay specificity and sensitivity Analyst A Analyst B Diluted CPC Diluted CPC Matrix spike* Matrix spike Total Tested 30 30 30 30 Number Positive 0 30 0 30 Number Negative 29 0 30 0 Number indeterminant 1 30 0 0 *CPC spike: mAb10914 spiked into diluted matrix sample at 2 g/mL. Sample identified as indeterminant due to one replicate with signal <50%.
(261) TABLE-US-00003 TABLE 2 Assay specificity near the limit of detection Sample Type* Negative Borderline Positive Number of samples 30 19 11 Result positive 0 13 10 Result negative 26 4 1 Result indeterminant.sup.$ 4 2 0 *Sample Type: Negative is diluted seronegative (matrix) sample; borderline is diluted matrix spiked with mAb10914 at 0.35 g/mL; positive is diluted matrix spiked with mAb10914 at 2 g/mL. .sup.$Indeterminant: one replicate with signal >50%, other replicate with signal <50%. Technical error during sample preparation is suspected.
(262) TABLE-US-00004 TABLE 3 Clinical correlation-blinded studies Number Number Total Negative Positive tested Results Results Negatives 125 125 0 Presumptive (not tested) 83 83 0 Negative by ELISA* 42 42 0 Positives 72 3 69 Positive by PCR 34 3 31 Positive by ELISA 38 0 38 Contact Positives.sup.$ 33 20 13 .sup.$Donors were not tested but had contact with someone confirmed positive by PCR. One sample received only 8 days after positive PCR result. *Samples also tested by EPITOPE IgG ELISA (clinically validated
(263) TABLE-US-00005 TABLE 4 Correlation between IMMUNO-COV v. 1 and SARS-CoV2 Plaque Reduction Neutralization Test IMMUNO- IMMUNO- Random COV COV Clinical ID Result VNU* PRNT.sub.EC50 Correlation RID-165 Negative N/A <20.sup.$ Presumed Negative RID-152 Negative N/A <20 Presumed Negative RID-121 Negative N/A <20 Contact positive RID-195 Negative N/A <20 Contact positive RID-239 Negative N/A <20 PCR positive 8-days before testing RID-142 Positive 31.8 340.0 PCR Positive RID-168 Positive 69.9 277.7 Contact tested positive RID-272 Positive 95.2 319.8 PCR Positive RID-288 Positive 125.5 530.7 Contact tested positive RID-144 Positive 134.2 665.8 PCR Positive RID-138 Positive 281.7 2061 Contact tested positive RID-193 Positive 345.4 1545 PCR Positive RID-183 Positive 402.6 1449 PCR Positive RID-167 Positive 430.7 845.6 Contact tested positive RID-287 Positive 447.8 2130 PCR Positive RID-290 Positive 491.0 2999 Contact tested positive RID-192 Positive 775.7 4362 Contact tested positive RID-194 Positive 1504.9 1502 Contact tested positive RID-235 Positive 2046.6 7311 PCR Positive RID-236 Positive 2702.5 5203 PCR Positive *VNU: Virus Neutralization Unit. Arbitrary quantitative value assigned based on calibration curve; higher VNUs represent higher neutralizing antibody levels. .sup.$The limit of detection for this assay is 20. PRNT50: Plaque Reduction Neutralization Titer 50%. Highest sample dilution able to inhibit at least 50% of plaque formation; expressed as the recipricol value.
(264) TABLE-US-00006 TABLE 5 Correlation between IMMUNO-COV v. 1 and SARS-CoV2 Plaque Reduction Neutralization Test VNU PRNT Result <10 <1:40 Negative 10 to 30 1:40 to 1:80 Borderline 30 to 75 1:160 Positive 75 to 150 1:320 Positive 150 to 300 1:640 Positive 300 to 600 1:1280 Positive 600 to 1500 1:2560 Positive 1500 to 3000 1:5120 Positive >3000 >10240 Positive
Core Validation
(265) Core specificity is tested as follows. At least 30 sera samples from assumed SARS-CoV-2 seronegative individuals are analyzed on the assay in duplicate at their MRD. Additionally, for each serum sample analyzed, a corresponding CPCH sample is prepared by spiking into each sample at the concentration determined in the above section on optimized sample dilution, and then analyzed in duplicate. This assessment should be completed on at least two assay runs by two separate analysts. The mean response and % CV for each replicate dilution is reported.
(266) A false positive rate is determined by the percentage of control matrix samples that generate a response below 50%. Acceptance criteria for false positive rate is below 5%.
(267) A false negative rate is determined by the percentage of CPCH samples that generate a response above 50%. The false negative rate is reported in the final assay validation summary but does not have acceptance criteria.
(268) Clinical agreement is determined as follows. At least three sera samples from convalescent patients who previously tested positive for SARS-CoV-2 by a molecular diagnostic test or another serological method, or were declared presumed positive by a medical professional due to onset of symptoms is tested on the assay. Information from presumed-positive patients is self-reported. This assessment is completed by plating the diluted samples in duplicate on at least one assay run, performed by one analyst. If possible, due to available sample volumes, this analysis is completed with three assay runs by at least two analysts. Submission of samples is conducted single-blinded to the analyst(s) with a mix a presumed positive and presumed negative samples. Presumed positive samples is analyzed by another serological method to allow for an accuracy assessment.
(269) The mean response and % CV for each replicate dilution is reported. Clinical agreement is reported if response is observed below 50% at the MRD for all presumed positive samples tested. Following the initial screen, the samples are analyzed in a dilution series starting at the MRD, and determining the dilution titer result may be performed. Obtaining a dilution titer result is optional, and is not required for the assay validation. There should be 90% agreement for positive versus negative determination for samples compared to results obtained by the alternative serological method.
(270) Intra-assay precision is determined as follows. The intra-operator and intra-assay precision is tested by preparing CPCH, CPCL, and untreated serum matrix pool for use as quality control (QC) samples. Twenty replicates of each QC sample are tested by one operator within a single assay run. An assay run may consist of sample plates due to sample capacity. All twenty replicates for each QC sample may be analyzed on the same assay plate, but this is not required.
(271) The mean response, SD, and % CV are reported. The acceptance for each QC sample is based on the % CV, with an acceptance level of 20%. For the CPCH sample, acceptance criteria of 30% CV or within a reference range of Mean Response3SD is accepted. This measure is chosen due to the high % CV expected in low response outputs. An error rate of up to 10% is accepted.
(272) Inter-assay precision and inter-analyst precision are determined as follows. CPCH, CPCL and the untreated serum matrix pool is prepared and analyzed in duplicate for at least three assay runs by at least two analysts across multiple days.
(273) The mean response, SD, and % CV is reported. The acceptance for each QC sample is based on the % CV, with an acceptance level of 20%. For the CPCH sample, acceptance criteria of 30% CV or within a reference range of Mean Response3SD is accepted. This measure was chosen due to the high % CV expected in low response outputs. An error rate of up to 10% is accepted.
(274) Inter-laboratory precision is determined as follows. CPCH, CPCL and untreated serum matrix pool is prepared at the testing facility. Sample levels is single-blinded and sent with reagents to complete the assay at an alternate test site. At least one assay run should be completed with the samples analyzed in duplicate. The alternate test site and responsible personnel for the alternate test site is identified in the final assay validation report.
(275) Mean response, SD, and % CV are reported. Acceptance for each QC sample is based on the % CV, with an acceptance level of 520%. For the CPCH sample, acceptance criteria of 530% CV or within a reference range of Mean Response3SD is accepted. This measure was chosen due to the high % CV expected in low response outputs. An error rate of up to 10% is accepted.
(276) The robustness of stability of a first cell line is determined as follows. Analysis of ACE-2 expression on Vero-DSP1 and Vero-DSP2 cell lines is determined by flow cytometry. Based on the anticipated use of the cells, each cell line is tested at multiple intervals to determine consistent receptor expression throughout the anticipated use of the cells. Cells initially are tested within 48 hours after plating from frozen stocks at an initial passage after thawing. Repeat analyses take place at multiple passages out to a minimum of 6 passages or to a minimum time length of 3 weeks from thaw. The specific intervals tested and determined interval for acceptable stability is indicated in the final assay validation report. A single analysis run consisting of an anti-ACE-2 stained sample and an appropriate flow cytometry negative control sample is obtained at each interval tested.
(277) The median fluorescence intensity (MFI) and Half-Peak % CV is reported for both the ACE-2 stained cells, and for the negative staining control. The staining index is calculated at each interval and reported in the final assay validation report. Acceptance criteria for the flow cytometry assessment is described as follows.
(278) The median fluorescence intensity (MFI) and Half-Peak % CV is reported for both the ACE-2 stained cells, and for the negative staining control. The acceptance range is calculated from data collected at the first cell passage, within 48-hours of the cells being thawed. The acceptable MFI range is calculated as follows:
(279)
(280) Where % CVhp is defined as the half-peak % CV from the flow cytometer instrument. All analyses conducted at other intervals should fall within MFI range established from this calculation for both the ACE-2 stained cells, and for the negative staining control.
(281) The robustness of stability of a second cell line is determined as follows. Analysis of functional DSP on Vero-DSP1 and Vero-DSP2 cell lines is determined by level of luminescence generated in presence of CPCH, CPCL, and CM. An assay run is conducted on cells thawed from a cryovial aliquot, allowed to expand for two days, and then passaged for use in the assay. The time from thawing of cells to reading of the assay plate would be 4 total days. The assay run should include CPCH, CPCL and untreated matrix pool prepared and analyzed in duplicate. For each successive split of the cells, assay plates are prepared, and an assay run is completed including CPCH, CPCL and untreated matrix pool prepared and analyzed in duplicate. The specific number of passages and assay runs is not known, but cells are carried for a period of at least three weeks from when the cells initially thawed, and at each split, an assay plate is plated to conduct an assay run, setup on the next day, and read two days after plating.
(282) Mean response, SD, and % CV are reported. Performance at each level is compared to the mean response obtained from the first assay run on the cells (read 4 days cell thaw). Percent Relative Error (% RE) from the first assay run on the cell is calculated. Acceptance criteria are defined as +30% RE obtained from the CPCL sample. The CPCL sample was chosen to evaluate stability when it is suspected the CPCL response falls within the linear range of the assay.
(283) The robustness of viral stock stability is determined as follows. A virus stock tube is thawed for use in the assay, and then stored on wet ice or refrigerated conditions (2 to 8 C.) for up to 24-hours. At least three assay runs are prepared from this single tube at multiple intervals. Each assay run includes CPCH, CPCL and untreated matrix pool plated in duplicate. The specific timed intervals tested includes an assay plate prepared within 1 hour of thawing (fresh virus), an assay plate prepared between 22 and 24 hours after thawing, and at least one intermediate time interval (i.e. within 12 hours of thawing).
(284) Mean response, SD, and % CV are reported. Performance at each level is compared to the mean response obtained from the less than one hour interval. The percent relative error (% RE) from the less than one hour interval is calculated. Acceptance criteria are defined as +30% RE obtained from the CPCL sample. The CPCL sample was chosen to evaluate stability as it is suspected the CPCL response falls within the linear range of the assay.
(285) The robustness of sample matrix stability is determined as follows. From the minimum three samples obtained above, analysis is conducted as quickly as possible following collection. Duration of time from collection to analysis is reported. During the analysis procedure, additional matrix aliquots is prepared to be used for stability assessment. Stability is conducted for samples stored in a freezer set to maintain a temperature 20 C., as well as the other conditions described.
(286) Time/Temperature: Due to variability in sample volume, the specific number of aliquots able be prepared is unknown but is reported in the validation assay report. Minimum stability assessments are prepared at the following intervals as shown in Table 6, below.
(287) TABLE-US-00007 TABLE 6 Refrigerator Freezer Benchtop Time 1-week 1-week 1-month hours Temperature 2 to 8 C. 5-20 C. 5-20 C. 19 to 28 C.
(288) A freeze-thaw (FT) cycle is defined as allowing frozen sample to thaw completely (>_15 minutes removal from freezer, and visual determination of sample appearance as completely liquid state), and then returning sample to freezer 6 hours prior to thawing again to conduct analysis. Three FT cycles are performed.
(289) Samples are analyzed in duplicate at each of the described intervals listed above. The mean response, SD, and % CV are reported. Performance at each level is compared to the mean response obtained from the initial analysis result. Percent Relative Error (% RE) from the initial analysis is calculated. Acceptance criteria are defined as +30% RE.
(290) Statistical Analysis
(291) A negative threshold determination is performed as follows. Biological outliers are identified using a Tukey Boxplot1. The first quartile, the third quartile, interquartile range or IQR (third quartilefirst quartile), upper fence (third quartile+k*IQR), and lower fence (first quartilek*IQR) are calculated. The constant k are defined as equal to 3. Biological outliers are excluded from further calculation of the negative threshold determination.
(292) Non-excluded data from all runs are pooled. Variance in normality is analyzed using an appropriate statistical test such as the Shapiro-Wilk test or the Anderson-Darling test. See, John W. Tukey, Journal of Computational and Graphical Statistics, 1993, 2:1-33 and Shapiro, S. S. and Wilk, M. B., Biometrika, 1965, 52 (3-4): 591-611. See, Anderson, T. W. and Darling, D. A., A Test of Goodness of Fit. Journal of the American Statistical Association, 1954, 49 (268): 765-769.
(293) If the data distribution is normal, use a parametric approach with =0.05:
Negative Threshold Determination=mean normalized response1.646SD
(294) If the data distribution is non-normal, use a non-parametric approach:
Negative Threshold Determination=95th percentile of the data
(295) The flow cytometry cell analysis acceptance criteria is as follows. The median fluorescence intensity (MFI) and Half-Peak % CV is reported for both the ACE-2 stained cells, and for the negative staining control. The acceptance range is calculated from data collected at the first cell passage, within 48-hours of the cells being thawed. The acceptable MFI range is calculated as follows:
(296)
(297) The % CVhp is defined as the half-peak % CV from the flow cytometer instrument. All analyses conducted at other intervals should fall within MFI range established from this calculation for both the ACE-2 stained cells, and for the negative staining control.
Example 3: The Use of IMMUNO-CoV v. 1 Assay to Detect SRS-CoV-2-Neturalizing Antibodies in Plasma
(298) The present Example demonstrates compatibility of plasma with the IMMUNO-CoV v. 1 assay of the invention.
(299)
(300) Pooled SARS-CoV-2 seronegative plasma (not heat-inactivated) containing stepped concentrations of anti-SARS-CoV-2 spike antibody mAb10914 was mixed with VSV-SARS-CoV2 v1.0 (VSV-SARS-CoV-2-S-19CT). After a 30-minute incubation at room temperature, the plasma/virus mixes were overlaid onto Vero-DSP1/DSP2 monolayers. Luciferase activity was measured after approximately 24 hours. As shown in
(301) In another experiment, dilutions of pooled SARS-CoV-2 seronegative plasma or plasma from a COVID-19 convalescing individual (NL1) were mixed with VSV-SARS-CoV2 v.1.0 virus (VSV-SARS-CoV-2-S-19CT). After a 1-hour incubation at 37 C., the plasma/virus mixes were overlaid onto Vero-DSP1/DSP2 cell monolayers. Luciferase activity was measured approximately 24 hours later. As shown in
(302) The effect of heat inactivation on plasma samples was also investigated. One aliquot was stored on ice while the other was incubated for 30 minutes at 56 C. Due to plasma thermal coagulation, samples were clarified by centrifugation before they were used in the assay. Each aliquot was then diluted in OptiMEM and mixed with VSV-SARS-CoV-2-S-19CT to a final dilution of 1:80, 1:160, 1:320, 1:640, 1:1280, and 1:2560. Following a 30-minute incubation at room temperature, the virus/plasma mixes were overlaid onto Vero-DSP1/Vero-DSP2 monolayers. Luciferase activity was measured after approximately 24 hours. The results are shown in
Example 4: The Use of IMMUNO-CoV v. 1 Assay to Detect SRS-CoV-2-Neturalizing Antibodies in Saliva
(303) Compatibility of saliva with the IMMUNO-CoV v. 1 assay was demonstrated by spiking pooled human saliva with anti-SARS-CoV-2 spike antibody mAb10914. Specifically, pooled saliva prepared from individuals prior to the COVID pandemic spiked with mAb10914 at stepped concentrations (QC-High, Mid, and Low). In order to prevent bacterial contamination associated with the use of saliva, all saliva samples were spiked with an Antibiotic/Antimycotic (Ab/Am) mix, diluted to a final dilution of 1:6.25 in OptiMEM, and filtered through a 0.22 um filter pre-wet with OptiMEM containing Ab/Am mix. The final concentrations of the Ab/Am components in the saliva were as follows: 0.2 mg/mL Ampicillin, 0.1 mg/mL Gentamicin sulfate, 4 g/mL Amphotericin B. Contrived positive control samples with various concentrations of mAb10914 were prepared by adding the mAb10914 to the saliva before the addition of Ab/Am or filtration, to ensure that the filtration did not remove inhibitory antibody from the saliva samples.
(304) The filtered samples were further diluted serially in OptiMEM before being mixed with VSV-SARS-CoV2 v.1.0 virus (VSV-SARS-CoV-2-S-19CT). After a 30-minute incubation at room temperature the saliva/virus mixes were overlaid onto Vero-DSP1/Vero-DSP2 monolayers. Luciferase activity was measured approximately 24 hours later. The concentration of mAb10914 in the samples after mix with virus at the 1:100 dilution shown were: 2 g/mL (QC-High), 0.6 g/mL (QC-Mid), and 0.4 g/mL (QC-Low). At higher saliva concentrations sample interference was observed.
(305) As demonstrated in
Example 5: Development of IMMUNO-CoV assay v. 2
(306) As depicted in
(307) In IMMUNO-CoV assay v. 2, serum or plasma samples are incubated with the virus (e.g., VSV-SARS-CoV-2-S-19CT-luc or VSV-SARS-CoV-2-S-luc), and the mixtures are then combined with or overlaid onto Vero cells (or other susceptible cells). In the absence of SARS-CoV-2-neutralizing antibodies, the virus infects cells and reporter (e.g., luciferase) activity is detected. If the test samples contain SARS-CoV-2-neutralizing antibodies, virus infection is inhibited and reporter (e.g., luciferase) activity is reduced. Controls such as pooled SARS-CoV-2 seronegative serum/plasma or serum/plasma alone or serum/plasma mixed with stepped concentrations of anti-SARS-CoV-2 spike monoclonal antibody mAb10914 are used to quantitate the level of the neutralizing response. The IMMUNO-CoV assay v. 2 workflow is shown in
(308) In the experiment shown in
(309) In the experiment shown in
(310) Additional experiments were directed to optimizing IMMUNO-CoV assay v. 2 conditions, including determining whether Vero-His, Vero-E6, or engineered Vero cells that overexpress Ace-2 and/or TRMPSS2 work best in the assay.
(311) For generation of Vero-Ace-2 and Vero-TRMPSS2 cells, plasmids with Ace-2 (GenBank Accession No. BC039902) and/or TMPRSS2 (GenBank Accession No. BC051839) were purchased from ABM (Cat. #1116701; abmgood.com/ACE2-ORF-Vector-1116701.html #Ace2 and Cat. #471480110000; abmgood.com/TMPRSS2-ORF-Vector-4714801.html #471480110000). The Ace-2 and TMPRSS2 were subcloned into a lentiviral vector construct. Vero cells were then transduced with the lentiviral vector(s) and selected with appropriate selection antibiotic.
(312)
(313) In the experiment shown in
(314) As shown in
(315) The experiments shown in
(316) As shown in
(317) TABLE-US-00008 TABLE 7 Comparison of percent responses in IMMUNO-COV Assay versions 1 and 2 Concentration of % Luciferase Signal mAb10914 Version 1 Version 2 (Flue) 0.6 g/mL 32.5% 1.2% 0.4 g/mL 47.5% 2.6%
Percent Response=(luciferase signal=luciferase signal from negative control)100% Lower percent response indicates a greater reduction in luciferase and virus inhibition Values represent the average (mean) from 24 wells run on 6 different plates for each sample.
(318)
REFERENCES
(319) Casadevall A, Pirofski LA. The convalescent sera option for containing COVID-19. 379 J Clin Invest 2020 Mar. 13. pii: 138003. doi: 10.1172/JCI138003 Corman et al., 2016. Viral shedding and antibody response in 37 patients with Middle East respiratory syndrome coronavirus infection. Clin Infect Dis 62:477-483. Gui, M et al. (2017) Cryo-electron microscopy structure of the SARS-CoV spike flycoprotein reveal a prerequisite conformational state for receptor binding. Cell Res. 27:119-129. Ho M. S., Chen W. J., Chen H. Y. Neutralizing antibody response and SARS severity. Emerg Infect Dis. 2005; 11 (11): 1730-1737. Hoffmann, M., Kleine-Weber, H., Schroeder, S., Kruger, N., Herrler, T., Erichsen, S., Schiergens, T. S., Herrler, G., Wu, N. H., Nitsche, A., et al. (2020). SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell.181:271-280 Jaume M., Yip M. S., Cheung C. Y. Anti-severe acute respiratory syndrome coronavirus spike antibodies trigger infection of human immune cells via a pH- and cysteine protease-independent FcgammaR pathway. J Virol. 2011; 85 (20): 10582-10597. Koff W C, Burton D R, Johnson P R, et al. Accelerating next-generation vaccine development for global disease prevention. Science. 2013; 340 (6136). Liu, W., Fontanet, A., Zhang, P. H., Zhan, L., Xin, Z. T., Baril, L., Tang, F., Lv, H., and Cao, W. C. (2006). Two-year prospective study of the humoral immune response of patients with severe acute respiratory syndrome. J. Infect. Dis. 193, 792-795. Liu, L et al. (2019) Anti-spike IgG causes severe acute lung injury by skewing macrophage responses during acute ARS-CoV infection. JCI Insight. 4 (4): e123158. Nie Y, Wang G, Shi X, Zhang H, Qiu Y, He Z, et al. Neutralizing antibodies in patients with severe acute respiratory syndrome-associated coronavirus infection. J Infect Dis. 2004; 190:1119-26. Peiris J. S., Chu C. M., Cheng V. C. Clinical progression and viral load in a community outbreak of coronavirus-associated SARS pneumonia: a prospective study. Lancet. 2003; 361 (9371): 1767-1772. Walls, A. C., Park, Y. J., Tortorici, M. A., Wall, A., McGuire, A. T., and Veesler, D. (2020). Structure, Function, and Antigenicity of the SARS-CoV-2 Spike Glycoprotein. Cell.181:281-292. Wan, Y., Shang, J., Graham, R., Baric, R. S., and Li, F. (2020). Receptor recognition by novel coronavirus from Wuhan: An analysis based on decade-long structural studies of SARS. Journal of Virology, JVI.00127-00120. Wang S. F., Tseng S. P., Yen C. H. Antibody-dependent SARS coronavirus infection is mediated by antibodies against spike proteins. Biochem Biophys Res Commun. 2014; 451 (2): 208-214. Yip M. S., Leung H. L., Li P. H. Antibody-dependent enhancement of SARS coronavirus infection and its role in the pathogenesis of SARS. Hong Kong Med J. 2016; 22 (3 Suppl 4): 25-31. Yuan, Y. et al. (2017) Cryo-EM structure of MERS-CoV and SARS-CoV spike flyocpoteins reveal the dynamic receptor binding domains. Natu. Commun. 8:15092. Zhao J et al Recovery from the Middle East respiratory syndrome is associated with antibody and T-cell responses (2017). Sci Immunol 2:5393.
Example 6: Generation of Variants of SARS-CoV-2
(320) The SARS-CoV-2 spike glycoprotein mutants were human codon optimized and synthesized with a deletion in the nucleotides encoding the C-terminal 19 amino acids (S-19CT). The variants of SARS-CoV-2 were cloned into a plasmid encoding the VSV genome using the restriction sites MluI and NheI. The plasmid was sequence verified and used for infectious virus rescue on BHK-21 cells. VSV-G was co-transfected into the BHK-21 cells to facilitate rescue but was not present in subsequent passages of the virus.
(321) TABLE-US-00009 TABLE 8 Non-Limiting Examples of Amino Acid Residue Positions for Insertion, Deletion, and/or Substitution to Generate Recombinant VSV Particle Variants Mutations Location Phenotypes References COVID VARIANT: B.1.1.7 lineage, (20I/501Y.V1 or VOC 202012/01) Origin: UK hCoV-19/England/SHEF-10C8326/2021 N501Y RBD One of the six key amino Horby P, Huntley C, Davies N, Edmunds J, acids interacting with Ferguson N, Medley G, et al. NERVTAG paper ACE-2 receptor. on COVID-19 variant of concern B.1.1.7 Associated with increased (2021) transmissibility (more [www.gov.uk/government/publications/nervtag- efficient/rapid paper-on-covid-19-variant-ofconcern-b117] transmissibility). Accession number: SAMN17373206 69-70 Potential conformational Wu K, Werner AP, Moliva JI, et al. mRNA- deletion change in spike protein. 1273 vaccine induces neutralizing antibodies Reduced sensitivity to against spike mutants from global SARS-CoV- neutralizing antibodies. 2 variants. [Preprint Posted Jan. 25, 2021] Associated with increased GenBank: MW487270.1 transmissibility (more efficient/rapid transmissibility). P681H Near Associated with increased Xie X, Zou J, Fontes-Garfias CR, et al. S1/S2 transmissibility (more Neutralization of N501Y mutant SARS-CoV-2 furin efficient/rapid by BNT162b2 vaccine-elicited sera. [Preprint cleavage transmissibility). Posted Jan. 7, 2021] site Greaney AJ, Loes AN, Crawford KHD, et al. Comprehensive mapping of mutations to the SARS-CoV-2 receptor-binding domain that affect recognition by polyclonal human serum antibodies. [Preprint Posted Jan. 4, 2021] Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/NYI.B1- 7.01-21/2021, complete genome Y144 del Weisblum Y, Schmidt F, Zhang F, et al. Escape from neutralizing antibodies by SARS-CoV-2 spike protein variants [eLife 2020;9:e61312] A570D T716I S982A D1118H COVID VARIANT: B.1.351 (20H/501Y.V2) Origin: South Africa K417N RBD Resistant to neutralizing Weisblum Y, Schmidt F, Zhang F, et al. Escape antibodies. from neutralizing antibodies by SARS-CoV-2 spike protein variants [eLife 2020;9:e61312] hCoV-19/Belgium/AZDelta05413-2105R/2021 E484K RBD Resistant to neutralizing Resende PC, Bezerra JF, de Vasconcelos RHT, antibodies. E484K may at al. Spike E484K mutation in the first SARS- affect neutralization by CoV-2 reinfection case confirmed in Brazil, some polyclonal and 2020external icon. [Posted on mAb, potentially by www.virological.orgexternal icon on Jan. disrupting the 10, 2021] immunodominant B cell epitope, and is thought to be the mutation that drives immune escape. N501Y RBD Resistant to neutralizing antibodies, increased transmissibility. D614G A701V L18F NTD D80A NTD D215G NTD L242-244 NTD del R246I NTD Disrupts N5-loop (large, solvent exposed loop in NTD) and displaces the loop COVID VARIANT: (B1.1.28.1 or 20J/501.V3, 484K.V2) Origin: Brazil K417T RBD altered transmissibility Resende PC, Bezerra JF, de Vasconcelos RHT, E484K RBD and antigenic profile, at al. Spike E484K mutation in the first SARS- N501Y RBD which may affect ability CoV-2 reinfection case confirmed in Brazil, L18F NTD of Ab generated through 2020external icon. [Posted on T20N NTD previous natural infection www.virological.orgexternal icon on Jan. P26S or vaccination to 10, 2021] D138Y recognize and neutralize hCoV-19/Brazil/RR-1087/2021 R190S virus D614G H655Y T1027I COVID VARIANT: B.1.429 (CAL.20C, CA VUI) Origin: California S131 W152C L452R D614G COVID VARIANT: B.1.2 lineage 20C-US Q677H Adjacent Adrian A. Pater et al., Emergence and to furin Evolution of a Prevalent New SARS-CoV-2 cleavage Variant in the United States site [doi.org/10.1101/2021.01.11.426287] Other mutations in ORFs COVID VARIANT: B1.1.17 Weisblum Y, Schmidt F, Zhang F, et al. Escape from neutralizing antibodies by SARS-CoV-2 spike protein variants [eLife 2020;9:e61312] COVID VARIANT: 20E (EU1) A22V D614G COVID VARIANT: 20A.EU2 S477N D614G COVID VARIANT: N439K-D614G N439K D614G COVID VARIANT: Mink Cluster 5 variant H69 del V70 del Y453F RBD Increased binding affinity for mink Ace2. D614G I692V M1229I
(322) TABLE-US-00010 TABLE 9 Non-Limiting Examples of Recombinant VSV Particle Variants Variant Name Mutations VSV-SARS-CoV2-S_E484K E484K VSV-SARS-CoV2-S_B.1.351_NTD L18F, D80A, D215G, 242-244 del, R246I, A701V VSV-SARS-CoV2-S_B.1.351_RBD K417N, E484K, N501Y, D614G VSV-SARS-CoV2-S_B.1.351 K417N, E484K, N501Y, D614G, L18F, D80A, D215G, 242-244 del, R246I, A701V VSV-SARS-CoV2-S_B.1.1.7_RBD N501Y, 69-70 del, P681H VSV-SARS-CoV2-S_B.1.1.7 N501Y, 69-70 del, P681H, Y144 del, A570D, T716I, S982A, D1118H VSV-SARS-CoV2-S_B.1.1.28_RBD K417T, E484K, N501Y
Example 7: Sample Collection Kits for Dried Bloodspot (DBS) Sampling
(323) A non-limiting example of a standard Dried Bloodspot (DBS) collection procedure was performed as described below. Sample collection kits for DBS sampling contained all of the necessary components to perform the sample collection.
(324) For the DBS collection procedure, the following steps were performed: 1. A bloodspot collection card was prepared for collection: a. The bloodspot collection card contained Whatman 903TM filter paper, which was protected by a paper cover. b. The cover was folded back and creased to keep the filter paper portion of the card exposed. c. If self-performing the collection, the card was taped to the edge of a table with the exposed filter paper overhanging the table. 2. The sample collection site was wiped with an alcohol prep pad, and then the skin was allowed to dry for about 30 seconds. a. The Recommended collection site was on the finger pad of a preferred finger, near the fingertip. 3. A contact-activated lancet (BD Microtainer, Ref #: 366594) was provided as the recommended lancet. a. Blue-color contact-activated lancet was considered high flow and comprised either a 14-guage needle or 1.5 mm wide blade with a 2.0 mM incision depth. b. There was a blue twist-off cover that was removed for the lancet to be activated. c. With the cover removed, the activation area of the lancet was firmly pushed against collection site, which resulted in a minor incision. 4. A gauze square (included in the kit) was used to wipe the first drop of blood away. 5. A droplet of blood on fingertip was then allowed to fall onto the filter paper, which was printed with 5 circles. A description of the DBS collection card comprising the 5 printed circles is provided in
Example 8: IMMUNO-CoV V2 Bloodspot Assay Sample Analysis Protocol
(325) The present example provides a IMMUNO-CoV V2 Bloodspot Assay Setup and Bloodspot Assay Maps, which describe the Dried Bloodspot Assay Sample Analysis protocol. Specifically, the procedure describes assaying of 6 bloodspot samples using 6 dilutions beginning at a 1:4 and diluting serial 2-fold out to a 1:128 dilution. Exemplar Bloodspot Assay Maps showing various bloodspot sample dilutions are described for a U-well (or U-bottom) Plate (
(326) The following is a list of reagents was needed to perform the procedure: VSV-SARS2-Fluc OptiMEM mAb10914 mAb10922 Pooled negative serum D-luciferin
(327) For the IMMUNO-CoV V2 Bloodspot Assay Setup, the following steps were performed:
(328) Cells were seeded according to IMMUNO-CoV V2 Cell Preparation procedures of the present disclosure. Cells were seeded 16 to 24 hours before being used for assay. 1. Dried Bloodspot (DBS) sample processing was started approximately 1.5 hours before assay plating began. 2. For each DBS sample, a inch (6 mm) hole punch was used to punch a single punch/spot into an appropriately labeled 1.7 mL microcentrifuge tube. Bloodspot collection cards were viewed from the back when punching to ensure the punchout location was being taken from a location where capillary whole blood had saturated through the entire area of the filter paper being sampled. 3. Once all sample punches were added to tubes, 400 L OptiMEM was added to each sample tube. For DBS sampling clarification, extractions were conducted using 200 L, the assay recommended minimum volume to use per each 6 mm spot. Because 400 L was used in the present extraction, this was considered a 1:2 dilution, which after mixing with the virus resulted in a 1:4 starting dilution. This provided adequate volume to transfer 240 L of eluent to a U-bottom plate at later steps. 4. The tubes were incubated at room temperature for 1 hour on a plate shaker, shaking at 450 rpm setting. 5. Following 1 hour incubation, a micropipette was used to transfer supernatant to a new tube. The filter paper punch was pushed to the side with the pipette tip, and the extracted whole blood eluent was easily collected. 6. A brief centrifugation step (1000 x g for approximately 30 seconds) was performed before sampling bloodspot eluent to reduce the frequency of small filter paper debris from transferring to the U-bottom plate during assay setup. 7. 120 L OptiMEM was placed in wells of U-bottom suspension 96-well culture plates indicated by grey shading according to plate layout maps, as shown in
(329) TABLE-US-00011 Pooled Working stock Mix negative serum mAb10922 OptiMEM NC 8 L None 312 L PC 12.5 L 3.1 L 484.4 L 12. 120 L of controls were added to U-bottom plates according to the plate layout map (
(330) TABLE-US-00012 Virus Virus Vol. Virus Vol. OptiMEM Lot Titer (8.4 10.sup.4 titer) (14-vol. virus) mL mL 18. 120 L of prepared virus was added to all wells of U-well plates and mixed by pipetting. 19. Plates were incubated at room temperature for 30 to 45 min. 20. 100 L of samples were transferred from U-bottom plates to a plate of cells in duplicate according to Assay Plate layout maps (
(331) As a non-limiting example, extracting of the blood spots was performed with either OptiMEM or PBST. For OptiMEM conditions, the OptiMEM started at 1:2 dilutions in the assay (neat elution, 1:2 when diluted with virus) and PBST started at a 1:10 dilution (1:10 after virus addition).
(332) A proof-of-concept experiment demonstrated that the bloodspot matrix was completely compatible at a 1:20 dilution of matrix (
(333) TABLE-US-00013 Sequences AminoAcidSequenceofSARS-CoV-2full-lengthSglycoprotein (SEQIDNO:1;variant1andvariant4;NCBIReferenceSequence: YP_009724390.1;S1subunitisunderlined;RBDsiteisshowninbold) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTW FHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVI KVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREF VFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSS GWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSP TKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGN YNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVV LSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAV RDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGS NVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENS VAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALT GIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAG FIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQI PFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANL AATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAH FPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEEL DKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYI WLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT CodonOptimizedNucleotideSequenceofSARS-CoV-2full-lengthS glycoprotein(SEQIDNO:2;variant1andvariant4) atgttcgtcttcctggtcctgctgcctctggtctcctcacagtgcgtcaatctgacaactcgga ctcagctgccacctgcttatactaatagcttcaccagaggcgtgtactatcctgacaaggtgtt tagaagctccgtgctgcactctacacaggatctgtttctgccattctttagcaacgtgacctgg ttccacgccatccacgtgagcggcaccaatggcacaaagcggttcgacaatcccgtgctgcctt ttaacgatggcgtgtacttcgcctctaccgagaagagcaacatcatcagaggctggatctttgg caccacactggactccaagacacagtctctgctgatcgtgaacaatgccaccaacgtggtcatc aaggtgtgcgagttccagttttgtaatgatcccttcctgggcgtgtactatcacaagaacaata agagctggatggagtccgagtttagagtgtattctagcgccaacaactgcacatttgagtacgt gagccagcctttcctgatggacctggagggcaagcagggcaatttcaagaacctgagggagttc gtgtttaagaatatcgacggctacttcaaaatctactctaagcacacccccatcaacctggtgc gcgacctgcctcagggcttcagcgccctggagcccctggtggatctgcctatcggcatcaacat cacccggtttcagacactgctggccctgcacagaagctacctgacacccggcgactcctctagc ggatggaccgccggcgctgccgcctactatgtgggctacctccagccccggaccttcctgctga agtacaacgagaatggcaccatcacagacgcagtggattgcgccctggaccccctgagcgagac aaagtgtacactgaagtcctttaccgtggagaagggcatctatcagacatccaatttcagggtg cagccaaccgagtctatcgtgcgctttcctaatatcacaaacctgtgcccatttggcgaggtgt tcaacgcaacccgcttcgccagcgtgtacgcctggaataggaagcggatcagcaactgcgtggc cgactatagcgtgctgtacaactccgcctctttcagcacctttaagtgctatggcgtgtccccc acaaagctgaatgacctgtgctttaccaacgtctacgccgattctttcgtgatcaggggcgacg aggtgcgccagatcgcccccggccagacaggcaagatcgcagactacaattataagctgccaga cgatttcaccggctgcgtgatcgcctggaacagcaacaatctggattccaaagtgggcggcaac tacaattatctgtaccggctgtttagaaagagcaatctgaagcccttcgagagggacatctcta cagaaatctaccaggccggcagcaccccttgcaatggcgtggagggctttaactgttatttccc actccagtcctacggcttccagcccacaaacggcgtgggctatcagccttaccgcgtggtggtg ctgagctttgagctgctgcacgccccagcaacagtgtgcggccccaagaagtccaccaatctgg tgaagaacaagtgcgtgaacttcaacttcaacggcctgaccggcacaggcgtgctgaccgagtc caacaagaagttcctgccatttcagcagttcggcagggacatcgcagataccacagacgccgtg cgcgacccacagaccctggagatcctggacatcacaccctgctctttcggcggcgtgagcgtga tcacacccggcaccaatacaagcaaccaggtggccgtgctgtatcaggacgtgaattgtaccga ggtgcccgtggctatccacgccgatcagctgaccccaacatggcgggtgtacagcaccggctcc aacgtcttccagacaagagccggatgcctgatcggagcagagcacgtgaacaattcctatgagt gcgacatcccaatcggcgccggcatctgtgcctcttaccagacccagacaaactctcccagaag agcccggagcgtggcctcccagtctatcatcgcctataccatgtccctgggcgccgagaacagc gtggcctactctaacaatagcatcgccatcccaaccaacttcacaatctctgtgaccacagaga tcctgcccgtgtccatgaccaagacatctgtggactgcacaatgtatatctgtggcgattctac cgagtgcagcaacctgctgctccagtacggcagcttttgtacccagctgaatagagccctgaca ggcatcgccgtggagcaggataagaacacacaggaggtgttcgcccaggtgaagcaaatctaca agaccccccctatcaaggactttggcggcttcaatttttcccagatcctgcctgatccatccaa gccttctaagcggagctttatcgaggacctgctgttcaacaaggtgaccctggccgatgccggc ttcatcaagcagtatggcgattgcctgggcgacatcgcagccagggacctgatctgcgcccaga agtttaatggcctgaccgtgctgccacccctgctgacagatgagatgatcgcacagtacacaag cgccctgctggccggcaccatcacatccggatggaccttcggcgcaggagccgccctccagatc ccctttgccatgcagatggcctataggttcaacggcatcggcgtgacccagaatgtgctgtacg agaaccagaagctgatcgccaatcagtttaactccgccatcggcaagatccaggacagcctgtc ctctacagccagcgccctgggcaagctccaggatgtggtgaatcagaacgcccaggccctgaat accctggtgaagcagctgagcagcaacttcggcgccatctctagcgtgctgaatgacatcctga gccggctggacaaggtggaggcagaggtgcagatcgaccggctgatcaccggccggctccagag cctccagacctatgtgacacagcagctgatcagggccgccgagatcagggccagcgccaatctg gcagcaaccaagatgtccgagtgcgtgctgggccagtctaagagagtggacttttgtggcaagg gctatcacctgatgtccttccctcagtctgccccacacggcgtggtgtttctgcacgtgaccta cgtgcccgcccaggagaagaacttcaccacagcccctgccatctgccacgatggcaaggcccac tttccaagggagggcgtgttcgtgtccaacggcacccactggtttgtgacacagcgcaatttct acgagccccagatcatcaccacagacaacaccttcgtgagcggcaactgtgacgtggtcatcgg catcgtgaacaataccgtgtatgatccactccagcccgagctggacagctttaaggaggagctg gataagtatttcaagaatcacacctcccctgacgtggatctgggcgacatcagcggcatcaatg cctccgtggtgaacatccagaaggagatcgaccgcctgaacgaggtggctaagaatctgaacga gagcctgatcgacctccaggagctgggcaagtatgagcagtacatcaagtggccctggtacatc tggctgggcttcatcgccggcctgatcgccatcgtgatggtgaccatcatgctgtgctgtatga catcctgctgttcttgcctgaagggctgctgtagctgtggctcctgctgtaagtttgacgagga tgactctgaacctgtgctgaagggcgtgaagctgcattacacctaa AminoAcidSequenceofSARS-CoV-219CTSglycoprotein (SEQIDNO:3;variant2;S1subunitisunderlined;RBDsiteis showninbold) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTW FHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVI KVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREF VFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSS GWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSP TKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGN YNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVV LSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAV RDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGS NVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENS VAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALT GIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAG FIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQI PFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANL AATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAH FPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEEL DKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYI WLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCC CodonOptimizedNucleotideSequenceofSARS-CoV-2A19CTSglycoprotein (SEQIDNO:4;variant2) atgttcgtcttcctggtcctgctgcctctggtctcctcacagtgcgtcaatctgacaactcgga ctcagctgccacctgcttatactaatagcttcaccagaggcgtgtactatcctgacaaggtgtt tagaagctccgtgctgcactctacacaggatctgtttctgccattctttagcaacgtgacctgg ttccacgccatccacgtgagcggcaccaatggcacaaagcggttcgacaatcccgtgctgcctt ttaacgatggcgtgtacttcgcctctaccgagaagagcaacatcatcagaggctggatctttgg caccacactggactccaagacacagtctctgctgatcgtgaacaatgccaccaacgtggtcatc aaggtgtgcgagttccagttttgtaatgatcccttcctgggcgtgtactatcacaagaacaata agagctggatggagtccgagtttagagtgtattctagcgccaacaactgcacatttgagtacgt gagccagcctttcctgatggacctggagggcaagcagggcaatttcaagaacctgagggagttc gtgtttaagaatatcgacggctacttcaaaatctactctaagcacacccccatcaacctggtgc gcgacctgcctcagggcttcagcgccctggagcccctggtggatctgcctatcggcatcaacat cacccggtttcagacactgetggccctgcacagaagctacetgacacccggcgactcctctage ggatggaccgccggcgctgccgcctactatgtgggctacctccagccccggaccttcctgctga agtacaacgagaatggcaccatcacagacgcagtggattgcgccctggaccccctgagcgagac aaagtgtacactgaagtcctttaccgtggagaagggcatctatcagacatccaatttcagggtg cagccaaccgagtctatcgtgcgctttcctaatatcacaaacctgtgcccatttggcgaggtgt tcaacgcaacccgcttcgccagcgtgtacgcctggaataggaagcggatcagcaactgcgtggc cgactatagcgtgctgtacaactccgcctctttcagcacctttaagtgctatggcgtgtccccc acaaagctgaatgacctgtgctttaccaacgtctacgccgattctttcgtgatcaggggcgacg aggtgcgccagatcgcccccggccagacaggcaagatcgcagactacaattataagctgccaga cgatttcaccggctgcgtgatcgcctggaacagcaacaatctggattccaaagtgggcggcaac tacaattatctgtaccggctgtttagaaagagcaatctgaagcccttcgagagggacatctcta cagaaatctaccaggccggcagcaccccttgcaatggcgtggagggctttaactgttatttccc actccagtcctacggcttccagcccacaaacggcgtgggctatcagccttaccgcgtggtggtg ctgagctttgagctgctgcacgccccagcaacagtgtgcggccccaagaagtccaccaatctgg tgaagaacaagtgcgtgaacttcaacttcaacggcctgaccggcacaggcgtgctgaccgagtc caacaagaagttcctgccatttcagcagttcggcagggacatcgcagataccacagacgccgtg cgcgacccacagaccctggagatcctggacatcacaccctgctctttcggcggcgtgagcgtga tcacacccggcaccaatacaagcaaccaggtggccgtgctgtatcaggacgtgaattgtaccga ggtgcccgtggctatccacgccgatcagctgaccccaacatggcgggtgtacagcaccggctcc aacgtcttccagacaagagccggatgcctgatcggagcagagcacgtgaacaattcctatgagt gcgacatcccaatcggcgccggcatctgtgcctcttaccagacccagacaaactctcccagaag agcccggagcgtggcctcccagtctatcatcgcctataccatgtccctgggcgccgagaacagc gtggcctactctaacaatagcatcgccatcccaaccaacttcacaatctctgtgaccacagaga tcctgcccgtgtccatgaccaagacatctgtggactgcacaatgtatatctgtggcgattctac cgagtgcagcaacctgctgctccagtacggcagcttttgtacccagctgaatagagccctgaca ggcatcgccgtggagcaggataagaacacacaggaggtgttcgcccaggtgaagcaaatctaca agaccccccctatcaaggactttggcggcttcaatttttcccagatcctgcctgatccatccaa gccttctaagcggagctttatcgaggacctgctgttcaacaaggtgaccctggccgatgccggc ttcatcaagcagtatggcgattgcctgggcgacatcgcagccagggacctgatctgcgcccaga agtttaatggcctgaccgtgctgccacccctgctgacagatgagatgatcgcacagtacacaag cgccctgctggccggcaccatcacatccggatggaccttcggcgcaggagccgccctccagatc ccctttgccatgcagatggcctataggttcaacggcatcggcgtgacccagaatgtgctgtacg agaaccagaagctgatcgccaatcagtttaactccgccatcggcaagatccaggacagcctgtc ctctacagccagcgccctgggcaagctccaggatgtggtgaatcagaacgcccaggccctgaat accctggtgaagcagctgagcagcaacttcggcgccatctctagcgtgctgaatgacatcctga gccggctggacaaggtggaggcagaggtgcagatcgaccggctgatcaccggccggctccagag cctccagacctatgtgacacagcagctgatcagggccgccgagatcagggccagcgccaatctg gcagcaaccaagatgtccgagtgcgtgctgggccagtctaagagagtggacttttgtggcaagg gctatcacctgatgtccttccctcagtctgccccacacggcgtggtgtttctgcacgtgaccta cgtgcccgcccaggagaagaacttcaccacagcccctgccatctgccacgatggcaaggcccac tttccaagggagggcgtgttcgtgtccaacggcacccactggtttgtgacacagcgcaatttct acgagccccagatcatcaccacagacaacaccttcgtgagcggcaactgtgacgtggtcatcgg catcgtgaacaataccgtgtatgatccactccagcccgagctggacagctttaaggaggagctg gataagtatttcaagaatcacacctcccctgacgtggatctgggcgacatcagcggcatcaatg cctccgtggtgaacatccagaaggagatcgaccgcctgaacgaggtggctaagaatctgaacga gagcctgatcgacctccaggagctgggcaagtatgagcagtacatcaagtggccctggtacatc tggctgggcttcatcgccggcctgatcgccatcgtgatggtgaccatcatgctgtgctgtatga catcctgctgttcttgcctgaagggctgctgtagctgtggctcctgctgttaa AminoAcidSequenceofSARS-CoV-2VSVGCTglycoprotein(SEQIDNO:5; variant3;thesequenceofVSVGcytoplasmictailisshowninbold,underline) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVN FNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSY ECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQE VFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC LGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRA SANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPA ICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDP LQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMKLKHTKKRQIYTDIEMNRLGK CodonOptimizedNucleotideSequenceofSARS-CoV-2VSVGCTglycoprotein (SEQIDNO:6;variant3;thesequenceencodingVSVGcytoplasmictailis showninCAPs) atgttcgtcttcctggtcctgctgcctctggtctcctcacagtgcgtcaatctgacaactcgga ctcagctgccacctgcttatactaatagcttcaccagaggcgtgtactatcctgacaaggtgtt tagaagctccgtgctgcactctacacaggatctgtttctgccattctttagcaacgtgacctgg ttccacgccatccacgtgagcggcaccaatggcacaaagcggttcgacaatcccgtgctgcctt ttaacgatggcgtgtacttcgcctctaccgagaagagcaacatcatcagaggctggatctttgg caccacactggactccaagacacagtctctgctgatcgtgaacaatgccaccaacgtggtcatc aaggtgtgcgagttccagttttgtaatgatcccttcctgggcgtgtactatcacaagaacaata agagctggatggagtccgagtttagagtgtattctagcgccaacaactgcacatttgagtacgt gagccagcctttcctgatggacctggagggcaagcagggcaatttcaagaacctgagggagttc gtgtttaagaatatcgacggctacttcaaaatctactctaagcacacccccatcaacctggtgc gcgacctgcctcagggcttcagcgccctggagcccctggtggatctgcctatcggcatcaacat cacccggtttcagacactgctggccctgcacagaagctacctgacacccggcgactcctctagc ggatggaccgccggcgctgccgcctactatgtgggctacctccagccccggaccttcctgctga agtacaacgagaatggcaccatcacagacgcagtggattgcgccctggaccccctgagcgagac aaagtgtacactgaagtcctttaccgtggagaagggcatctatcagacatccaatttcagggtg cagccaaccgagtctatcgtgcgctttcctaatatcacaaacctgtgcccatttggcgaggtgt tcaacgcaacccgcttcgccagcgtgtacgcctggaataggaagcggatcagcaactgcgtggc cgactatagcgtgctgtacaactccgcctctttcagcacctttaagtgctatggcgtgtccccc acaaagctgaatgacctgtgctttaccaacgtctacgccgattctttcgtgatcaggggcgacg aggtgcgccagatcgcccccggccagacaggcaagatcgcagactacaattataagctgccaga cgatttcaccggctgcgtgatcgcctggaacagcaacaatctggattccaaagtgggcggcaac tacaattatctgtaccggctgtttagaaagagcaatctgaagcccttcgagagggacatctcta cagaaatctaccaggccggcagcaccccttgcaatggcgtggagggctttaactgttatttccc actccagtcctacggcttccagcccacaaacggcgtgggctatcagccttaccgcgtggtggtg ctgagctttgagctgctgcacgccccagcaacagtgtgcggccccaagaagtccaccaatctgg tgaagaacaagtgcgtgaacttcaacttcaacggcctgaccggcacaggcgtgctgaccgagtc caacaagaagttcctgccatttcagcagttcggcagggacatcgcagataccacagacgccgtg cgcgacccacagaccctggagatcctggacatcacaccctgctctttcggcggcgtgagcgtga tcacacccggcaccaatacaagcaaccaggtggccgtgctgtatcaggacgtgaattgtaccga ggtgcccgtggctatccacgccgatcagctgaccccaacatggcgggtgtacagcaccggctcc aacgtcttccagacaagagccggatgcctgatcggagcagagcacgtgaacaattcctatgagt gcgacatcccaatcggcgccggcatctgtgcctcttaccagacccagacaaactctcccagaag agcccggagcgtggcctcccagtctatcatcgcctataccatgtccctgggcgccgagaacagc gtggcctactctaacaatagcatcgccatcccaaccaacttcacaatctctgtgaccacagaga tcctgcccgtgtccatgaccaagacatctgtggactgcacaatgtatatctgtggcgattctac cgagtgcagcaacctgctgctccagtacggcagcttttgtacccagctgaatagagccctgaca ggcatcgccgtggagcaggataagaacacacaggaggtgttcgcccaggtgaagcaaatctaca agaccccccctatcaaggactttggcggcttcaatttttcccagatcctgcctgatccatccaa gccttctaagcggagctttatcgaggacctgctgttcaacaaggtgaccctggccgatgccggc ttcatcaagcagtatggcgattgcctgggcgacatcgcagccagggacctgatctgcgcccaga agtttaatggcctgaccgtgctgccacccctgctgacagatgagatgatcgcacagtacacaag cgccctgctggccggcaccatcacatccggatggaccttcggcgcaggagccgccctccagatc ccctttgccatgcagatggcctataggttcaacggcatcggcgtgacccagaatgtgctgtacg agaaccagaagctgatcgccaatcagtttaactccgccatcggcaagatccaggacagcctgtc ctctacagccagcgccctgggcaagctccaggatgtggtgaatcagaacgcccaggccctgaat accctggtgaagcagctgagcagcaacttcggcgccatctctagcgtgctgaatgacatcctga gccggctggacaaggtggaggcagaggtgcagatcgaccggctgatcaccggccggctccagag cctccagacctatgtgacacagcagctgatcagggccgccgagatcagggccagcgccaatctg gcagcaaccaagatgtccgagtgcgtgctgggccagtctaagagagtggacttttgtggcaagg gctatcacctgatgtccttccctcagtctgccccacacggcgtggtgtttctgcacgtgaccta cgtgcccgcccaggagaagaacttcaccacagcccctgccatctgccacgatggcaaggcccac tttccaagggagggcgtgttcgtgtccaacggcacccactggtttgtgacacagcgcaatttct acgagccccagatcatcaccacagacaacaccttcgtgagcggcaactgtgacgtggtcatcgg catcgtgaacaataccgtgtatgatccactccagcccgagctggacagctttaaggaggagctg gataagtatttcaagaatcacacctcccctgacgtggatctgggcgacatcagcggcatcaatg cctccgtggtgaacatccagaaggagatcgaccgcctgaacgaggtggctaagaatctgaacga gagcctgatcgacctccaggagctgggcaagtatgagcagtacatcaagtggccctggtacatc tggctgggcttcatcgccggcctgatcgccatcgtgatggtgaccatcatgctgtgctgtatgA AATTAAAGCACACCAAGAAAAGACAGATTTATACAGACATAGAGATGAACCGACTTGGAAAGTA A AminoAcidSequenceofMutantVSVMatrix(M)Protein(M51R)(SEQIDNO:7) MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDERDTHDPNQLRYEKS FFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQ PEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDH FNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF NucleotideSequenceofMutantVSVMatrix(M)Protein(M51R)(SEQIDNO:8) ATGAGTTCCTTAAAGAAGATTCTCGGTCTGAAGGGGAAAGGTAAGAAATCTAAGAAATTAGGGA TCGCACCACCCCCTTATGAAGAGGACACTAGCATGGAGTATGCTCCGAGCGCTCCAATTGACAA ATCCTATTTTGGAGTTGACGAGCGAGACACCTATGATCCGAATCAATTAAGATATGAGAAATTC TTCTTTACAGTGAAAATGACGGTTAGATCTAATCGTCCGTTCAGAACATACTCAGATGTGGCAG CCGCTGTATCCCATTGGGATCACATGTACATCGGAATGGCAGGGAAACGTCCCTTCTACAAAAT CTTGGCTTTTTTGGGTTCTTCTAATCTAAAGGCCACTCCAGCGGTATTGGCAGATCAAGGTCAA CCAGAGTATCACGCTCACTGCGAAGGCAGGGCTTATTTGCCACATAGGATGGGGAAGACCCCTC CCATGCTCAATGTACCAGAGCACTTCAGAAGACCATTCAATATAGGTCTTTACAAGGGAACGAT TGAGCTCACAATGACCATCTACGATGATGAGTCACTGGAAGCAGCTCCTATGATCTGGGATCAT TTCAATTCTTCCAAATTTTCTGATTTCAGAGAGAAGGCCTTAATGTTTGGCCTGATTGTCGAGA AAAAGGCATCTGGAGCGTGGGTCCTGGACTCTATCGGCCACTTCAAATGA AminoAcidSequenceoftheWild-TypeVSVMatrix(M)Protein(SEQIDNO:9) MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKS FFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQ PEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDH FNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF NucleotideSequenceoftheWild-TypeVSVMatrix(M)Protein(SEQIDNO:10) ATGAGTTCCTTAAAGAAGATTCTCGGTCTGAAGGGGAAAGGTAAGAAATCTAAGAAATTAGGGA TCGCACCACCCCCTTATGAAGAGGACACTAGCATGGAGTATGCTCCGAGCGCTCCAATTGACAA ATCCTATTTTGGAGTTGACGAGATGGACACCTATGATCCGAATCAATTAAGATATGAGAAATTC TTCTTTACAGTGAAAATGACGGTTAGATCTAATCGTCCGTTCAGAACATACTCAGATGTGGCAG CCGCTGTATCCCATTGGGATCACATGTACATCGGAATGGCAGGGAAACGTCCCTTCTACAAAAT CTTGGCTTTTTTGGGTTCTTCTAATCTAAAGGCCACTCCAGCGGTATTGGCAGATCAAGGTCAA CCAGAGTATCACGCTCACTGCGAAGGCAGGGCTTATTTGCCACATAGGATGGGGAAGACCCCTC CCATGCTCAATGTACCAGAGCACTTCAGAAGACCATTCAATATAGGTCTTTACAAGGGAACGAT TGAGCTCACAATGACCATCTACGATGATGAGTCACTGGAAGCAGCTCCTATGATCTGGGATCAT TTCAATTCTTCCAAATTTTCTGATTTCAGAGAGAAGGCCTTAATGTTTGGCCTGATTGTCGAGA AAAAGGCATCTGGAGCGTGGGTCCTGGACTCTATCGGCCACTTCAAATGA wild-typeVSVKozaksequence(SEQIDNO:11) CACTATG optimizedKozaksequence(SEQIDNO:12) CACCATG AminoAcidSequenceofSARS-CoV-1Spike(S)protein(SEQIDNO:13;UniProtKB/ Swiss-Prot:P59594.1) MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYS NVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRAC NFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDG FLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGY LKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIYQTSNFRVVPSGDVVRFPNIT NLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYA DSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKL RPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCG PKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPC SFGGVSVITPGTNASSEVAVLYQDVNCTDVSTAIHADQLTPAWRIYSTGNNVNFSISITTEVMP VSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTP TLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFN GLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQ KQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRL DKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYH LMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSP QIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASV VNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIAGLIAIVMVTILLCCMTSC CSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT SARS-CoV-1 ResiduesSARS-CoV-1 ResiduesSARS-CoV-2 % subunits/domains (SEQIDNO:13) (SEQIDNO:1) identity Fullprotein 1-1255 75.9 Signalpeptide 1-13 53.9 Extracellular 14-1195 Transmembrane 1196-1216 Cytoplasmic 1217-1255 97.4 S1 14-667 14-684 63.6 S2 668-1255 90 S2 798-1255 93 Cleavagesite 667-668 100 Cleavagesite 797-798 100 Receptor-binding 306-527 319-541 73.1 domain(RBD) Fusionpeptide 770-788 83.3 CLUSTALO(1.2.4)multiplesequencealignmentofspike(S)glycoproteinsequences fromSARS-CoV-1(SEQIDNO:13)andSARS-CoV-2(SEQIDNO:1) SARS1 MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFL 60 SARS2 MFVFLVLLPLVSSQCVNLTT--RTQLPPAY--TNSFTRGVYYPDKVFRSSVLHSTQDLFL 56 **:**::**.*..::***.********::***,,*:****** SARS1 PFYSNVTGFHTIN-------HTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQS 113 SARS2 PFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQS 116 **:******:*::*.***:**:**:***:*****::***:**:*::.*:** SARS1 VIIINNSTNVVIRACNFELCDNPFFAVSKPMGT----QTHTMIFDNAFNCTFEYISDAFS 169 SARS2 LLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFL 176 ::*:**:*****:.*:*::*::**:.*..::.::..*******:*:* SARS1 LDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINIT 229 SARS2 MDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINIT 236 :*:.*.****:**********:::*.:**::*****.**.:*:*:..**:***** SARS1 NFRAILTAFS------PAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPL 283 SARS2 RFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPL 296 .*:::*:.:..*:.****:****:***:***:***********::** SARS1 AELKCSVKSFEIDKGIYQTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERK 343 SARS2 SETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRK 356 :***::***::************:.:*******************:******:** SARS1 KISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTG 403 SARS2 RISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTG 416 :**************:******************:********::**:********** SARS1 VIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPD 463 SARS2 KIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG 476 ***************:***:.*:*:.*******:*:.:*:*******.:.. SARS1 GKPCTP-PALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKN 522 SARS2 STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKN 536 ..**..:***:**:.****.*:***************:***********:*:** SARS1 QCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVS 582 SARS2 KCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVS 596 SARS1 VITPGTNASSEVAVLYQDVNCTDVSTAIHADQLTPAWRIYSTGNNV-------------- 628 SARS2 VITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHV 656 *******:*.:***********:*.*********:**:****.** SARS1 ------------------------------------------------------------ 628 SARS2 NNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPT 716 SARS1 NFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDR 688 SARS2 NFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDK 776 **:**:***::****:******.**********:*****************:***.***: SARS1 NTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQ 748 SARS2 NTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQ 836 **:********:****:****************:********************:** SARS1 YGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQI 808 SARS2 YGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQI 896 **:***************************:*****:**::***:************ SARS1 PFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNA 868 SARS2 PFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNA 956 *******************************.**.:**:**::*::************* SARS1 QALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAA 928 SARS2 QALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAA 1016 ************************************************************ SARS1 EIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFT 988 SARS2 EIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFT 1076 **************************************:**************:**:*** SARS1 TAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNT 1048 SARS2 TAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNT 1136 *******:***:*************:*****:.*********************:*** SARS1 VYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNES 1108 SARS2 VYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNES 1196 ************************************************************ SARS1 LIDLQELGKYEQYIKWPWYVWLGFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKF 1168 SARS2 LIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKF 1256 *******************:****************:*************.********* SARS1 DEDDSEPVLKGVKLHYT 1185 SARS2 DEDDSEPVLKGVKLHYT 1273 ***************** Rluc8155-156DSP1-7luciferase-GFPfusionprotein(SEQIDNO:14;Renilla luciferasefragmentaa1-155isunderlined;linkerisnothighlighted;fragmentaa 1-156ofengineeredGFPisshowninbold) MASKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNATSSYLWRHVV PHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFH YAYEHQDRIKAIVHMESVVDVIESWDESGGGGMSKGEELFTGVVPILVELDGDVNGHKFSVRGE GEGDATIGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQER TISFKDDGKYKTRAVVKFEGDTLVNRIELKGTDFKEDGNILGHKLEYNFNSHNVYITADK NucleotideSequenceofRluc8155-156DSP1-7construct(SEQIDNO:15;codingORFnt 1068-2018) agatcttcaatattggccattagccatattattcattggttatatagcataaatcaatat tggctattggccattgcatacgttgtatctatatcataatatgtacatttatattggctc atgtccaatatgaccgccatgttggcattgattattgactagttattaatagtaatcaat tacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaa tggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgt tcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggta aactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgt caatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcc tacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggca gtacaccaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccat tgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaa taaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataag cagagctcgtttagtgaaccgtcagatcactagaagctttattgcggtagtttatcacag ttaaattgctaacgcagtcagtgcttctgacacaacagtctcgaacttaagctgcagaag ttggtcgtgaggcactgggcaggtaagtatcaaggttacaagacaggtttaaggagacca atagaaactgggcttgtcgagacagagaagactcttgcgtttctgataggcacctattgg tcttactgacatccactttgcctttctctccacaggtgtccactcccagttcaattacag ctcttaaggctagagtacttaatacgactcactataggctagccaccatggcttccaagg tgtacgaccccgagcaacgcaaacgcatgatcactgggcctcagtggtgggctcgctgca agcaaatgaacgtgctggactccttcatcaactactatgattccgagaagcacgccgaga acgccgtgatttttctgcatggtaacgctacctccagctacctgtggaggcacgtcgtgc ctcacatcgagcccgtggctagatgcatcatccctgatctgatcggaatgggtaagtccg gcaagagcgggaatggctcatatcgcctcctggatcactacaagtacctcaccgcttggt tcgagctgctgaaccttccaaagaaaatcatctttgtgggccacgactggggggctgctc tggcctttcactacgcctacgagcaccaagacaggatcaaggccatcgtccatatggaga gtgtcgtggacgtgatcgagtcctgggacgagtccggaggaggcggaatgagcaagggcg aggagctgttcaccggcgtggtgcccatcctggtggagctggacggcgacgtgaacggcc acaagttcagcgtgagaggcgagggcgagggcgacgccaccatcggcaagctgaccctga agttcatctgcaccaccggcaagctgcccgtgccctggcccaccctggtgaccaccctga cctacggcgtgcagtgcttcagcagataccccgaccacatgaagagacacgacttcttca agagcgccatgcccgagggctacgtgcaggagagaaccatcagcttcaaggacgacggca agtacaagaccagagccgtggtgaagttcgagggcgacaccctggtgaacagaatcgagc tgaagggcaccgacttcaaggaggacggcaacatcctgggccacaagctggagtacaact tcaacagccacaacgtgtacatcaccgccgacaagtgatctagagcggccgcttcgagca gacatgataagatacattgatgagtttggacaaaccacaactagaatgcagtgaaaaaaa tgctttatttgtgaaatttgtgatgctattgctttatttgtaaccattataagctgcaat aaacaagttaacaacaacaattgcattcattttatgtttcaggttcagggggaggtgtgg gaggttttttaaagcaagtaaaacctctacaaatgtggtaaaatcgataaggatccaggt ggcacttttcggggaaatgtgcgcggaacccctatttgtttatttttctaaatacattca aatatgtatccgctcatgagacaataaccctgataaatgcttcaataatattgaaaaagg aagagtatgagtattcaacatttccgtgtcgcccttattcccttttttgcggcattttgc cttcctgtttttgctcacccagaaacgctggtgaaagtaaaagatgctgaagatcagttg ggtgcacgagtgggttacatcgaactggatctcaacagcggtaagatccttgagagtttt cgccccgaagaacgttttccaatgatgagcacttttaaagttctgctatgtggcgcggta ttatcccgtattgacgccgggcaagagcaactcggtcgccgcatacactattctcagaat gacttggttgagtactcaccagtcacagaaaagcatcttacggatggcatgacagtaaga gaattatgcagtgctgccataaccatgagtgataacactgcggccaacttacttctgaca acgatcggaggaccgaaggagctaaccgcttttttgcacaacatgggggatcatgtaact cgccttgatcgttgggaaccggagctgaatgaagccataccaaacgacgagcgtgacacc acgatgcctgtagcaatggcaacaacgttgcgcaaactattaactggcgaactacttact ctagcttcccggcaacaattaatagactggatggaggcggataaagttgcaggaccactt ctgcgctcggcccttccggctggctggtttattgctgataaatctggagccggtgagcgt gggtctcgcggtatcattgcagcactggggccagatggtaagccctcccgtatcgtagtt atctacacgacggggagtcaggcaactatggatgaacgaaatagacagatcgctgagata ggtgcctcactgattaagcattggtaactgtcagaccaagtttactcatatatactttag attgatttaaaacttcatttttaatttaaaaggatctaggtgaagatcctttttgataat ctcatgaccaaaatcccttaacgtgagttttcgttccactgagcgtcagaccccgtagaa aagatcaaaggatcttcttgagatcctttttttctgcgcgtaatctgctgcttgcaaaca aaaaaaccaccgctaccagcggtggtttgtttgccggatcaagagctaccaactcttttt ccgaaggtaactggcttcagcagagcgcagataccaaatactgttcttctagtgtagccg tagttaggccaccacttcaagaactctgtagcaccgcctacatacctcgctctgctaatc ctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccgggttggactcaaga cgatagttaccggataaggcgcagcggtcgggctgaacggggggttcgtgcacacagccc agcttggagcgaacgacctacaccgaactgagatacctacagcgtgagctatgagaaagc gccacgcttcccgaagggagaaaggcggacaggtatccggtaagcggcagggtcggaaca ggagagcgcacgagggagcttccagggggaaacgcctggtatctttatagtcctgtcggg tttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcaggggggcggagccta tggaaaaacgccagcaacgcggcctttttacggttcctggccttttgctggccttttgct cacatggctcgac Rluc8155-156DSP8-11luciferase-GFPfusionprotein(SEQIDNO:16;Renilla luciferasefragmentaa156-311isunderlined;linkerisnothighlighted;fragment aa157-231ofengineeredGFPisshowninbold) MQKNGIKANFTVRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQTVLSKDPNEKRDHMV LHEYVNAAGITGGGGSWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYL EPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIV EGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQ NucleotideSequenceofRluc8155-156DSP8-llconstruct(SEQIDNO:17;codingORFnt 1068-1778) agatcttcaatattggccattagccatattattcattggttatatagcataaatcaatat tggctattggccattgcatacgttgtatctatatcataatatgtacatttatattggctc atgtccaatatgaccgccatgttggcattgattattgactagttattaatagtaatcaat tacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaa tggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgt tcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggta aactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgt caatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcc tacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggca gtacaccaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccat tgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaa taaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataag cagagctcgtttagtgaaccgtcagatcactagaagctttattgcggtagtttatcacag ttaaattgctaacgcagtcagtgcttctgacacaacagtctcgaacttaagctgcagaag ttggtcgtgaggcactgggcaggtaagtatcaaggttacaagacaggtttaaggagacca atagaaactgggcttgtcgagacagagaagactcttgcgtttctgataggcacctattgg tcttactgacatccactttgcctttctctccacaggtgtccactcccagttcaattacag ctcttaaggctagagtacttaatacgactcactataggctagccaccatgcagaagaacg gcatcaaggccaacttcaccgtgagacacaacgtggaggacggcagcgtgcagctggccg accactaccagcagaacacccccatcggcgacggccccgtgctgctgcccgacaaccact acctgagcacccagaccgtgctgagcaaggaccccaacgagaagagagaccacatggtgc tgcacgagtacgtgaacgccgccggcatcaccggcggtggcggatcctggcctgacatcg aggaggatatcgccctgatcaagagcgaagagggcgagaaaatggtgcttgagaataact tcttcgtcgagaccgtgctcccaagcaagatcatgcggaaactggagcctgaggagttcg ctgcctacctggagccattcaaggagaagggcgaggttagacggcctaccctctcctggc ctcgcgagatccctctcgttaagggaggcaagcccgacgtcgtccagattgtccgcaact acaacgcctaccttcgggccagcgacgatctgcctaagctgttcatcgagtccgaccctg ggttcttttccaacgctattgtcgagggagctaagaagttccctaacaccgagttcgtga aggtgaagggcctccacttcctccaggaggacgctccagatgaaatgggtaagtacatca agagcttcgtggagcgcgtgctgaagaacgagcagtaattctagagcggccgcttcgagc agacatgataagatacattgatgagtttggacaaaccacaactagaatgcagtgaaaaaa atgctttatttgtgaaatttgtgatgctattgctttatttgtaaccattataagctgcaa taaacaagttaacaacaacaattgcattcattttatgtttcaggttcagggggaggtgtg ggaggttttttaaagcaagtaaaacctctacaaatgtggtaaaatcgataaggatccagg tggcacttttcggggaaatgtgcgcggaacccctatttgtttatttttctaaatacattc aaatatgtatccgctcatgagacaataaccctgataaatgcttcaataatattgaaaaag gaagagtatgagtattcaacatttccgtgtcgcccttattcccttttttgcggcattttg ccttcctgtttttgctcacccagaaacgctggtgaaagtaaaagatgctgaagatcagtt gggtgcacgagtgggttacatcgaactggatctcaacagcggtaagatccttgagagttt tcgccccgaagaacgttttccaatgatgagcacttttaaagttctgctatgtggcgcggt attatcccgtattgacgccgggcaagagcaactcggtcgccgcatacactattctcagaa tgacttggttgagtactcaccagtcacagaaaagcatcttacggatggcatgacagtaag agaattatgcagtgctgccataaccatgagtgataacactgcggccaacttacttctgac aacgatcggaggaccgaaggagctaaccgcttttttgcacaacatgggggatcatgtaac tcgccttgatcgttgggaaccggagctgaatgaagccataccaaacgacgagcgtgacac cacgatgcctgtagcaatggcaacaacgttgcgcaaactattaactggcgaactacttac tctagcttcccggcaacaattaatagactggatggaggcggataaagttgcaggaccact tctgcgctcggcccttccggctggctggtttattgctgataaatctggagccggtgagcg tgggtctcgcggtatcattgcagcactggggccagatggtaagccctcccgtatcgtagt tatctacacgacggggagtcaggcaactatggatgaacgaaatagacagatcgctgagat aggtgcctcactgattaagcattggtaactgtcagaccaagtttactcatatatacttta gattgatttaaaacttcatttttaatttaaaaggatctaggtgaagatcctttttgataa tctcatgaccaaaatcccttaacgtgagttttcgttccactgagcgtcagaccccgtaga aaagatcaaaggatcttcttgagatcctttttttctgcgcgtaatctgctgcttgcaaac aaaaaaaccaccgctaccagcggtggtttgtttgccggatcaagagctaccaactctttt tccgaaggtaactggcttcagcagagcgcagataccaaatactgttcttctagtgtagcc gtagttaggccaccacttcaagaactctgtagcaccgcctacatacetcgctctgctaat cctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccgggttggactcaag acgatagttaccggataaggcgcagcggtcgggctgaacggggggttcgtgcacacagcc cagcttggagcgaacgacctacaccgaactgagatacctacagcgtgagctatgagaaag cgccacgcttcccgaagggagaaaggcggacaggtatccggtaagcggcagggtcggaac aggagagcgcacgagggagcttccagggggaaacgcctggtatctttatagtcctgtcgg gtttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcaggggggcggagcct atggaaaaacgccagcaacgcggcctttttacggttcctggccttttgctggccttttgc tcacatggctcgac EngineeredGFP(SEPIDNO:18) MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATIGKLTLKFICTTGKLPVPWPTLVTTL TYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGKYKTRAVVKFEGDTLVNRIELKGT DFKEDGNILGHKLEYNFNSHNVYITADKMQKNGIKANFTVRHNVEDGSVQLADHYQQNTPIGDG PVLLPDNHYLSTQTVLSKDPNEKRDHMVLHEYVNAAGIT RLuc8(SEQIDNO:19) MASKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNATSSYLWRHVV PHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFH YAYEHQDRIKAIVHMESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMR KLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIE SDPGFFSNAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQ 19aminoacidsofSARS-CoV-2Sglycoproteincytoplasmictaildeletedinvariant2 (SEQIDNO:20) KFDEDDSEPVLKGVKLHYT VSVGglycoproteincytoplasmictailsequenceusedinvariant3(SEQIDNO:21) KLKHTKKRQIYTDIEMNRLGK SequencesofmAbl0914antibody: Component SEQID Part Sequence NO AminoAcidSequences HCVR EVQLVESGGGLVQPGGSLRLSCAASGLIVSRNYMIWVRQAPGKGLEWVSV 22 IYSGGSTFYADSVKGRFTISRHNSKNTLYLQMNSLRAEDTAVYYCARDLG TGGMDVWGQGTTVTVSS HCDR1 GLIVSRNY 24 HCDR2 IYSGGST 26 HCDR3 ARDLGTGGMDV 28 LCVR DIQLTQSPSFLSASVGDRVTITCWASQGISSYLAWYQQKPGKAPKLLIYA 30 ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPLTFGG GTKVEIK LCDR1 QGISSY 32 LCDR2 AAS 34 LCDR3 QQLNSYPLT 36 HC EVQLVESGGGLVQPGGSLRLSCAASGLIVSRNYMIWVRQAPGKGLEWVSV 38 IYSGGSTFYADSVKGRFTISRHNSKNTLYLQMNSLRAEDTAVYYCARDLG TGGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC NVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK LC DIQLTQSPSFLSASVGDRVTITCWASQGISSYLAWYQQKPGKAPKLLIYA 40 ASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPLTFGG GTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG LSSPVTKSFNRGEC NucleotideSequences HCVR gaggtgcagctggtggagtctggaggaggcttggtccagcctggggggtc 23 cctgagactctcctgtgcagcctctgggttaatagtcagtcgcaactaca tgatctgggtccgccaggctccagggaaggggctggagtgggtctcagtt atttatagcggtggtagcacattctacgcagactccgtgaagggccgatt caccatctccagacacaattccaagaacacgctgtatcttcaaatgaaca gcctgagggctgaggacacggccgtatattactgtgcgagagatctgggt acaggaggtatggacgtctggggccaagggaccacggtcaccgtctcctc a HCDR1 gggttaatagtcagtcgcaactac 25 HCDR2 atttatagcggtggtagcaca 27 HCDR3 gcgagagatctgggtacaggaggtatggacgtc 29 LCVR gacatccagttgacccagtctccatccttcctgtctgcatctgtaggaga 31 cagagtcaccatcacttgctgggccagtcagggcattagcagttatttag cctggtatcagcaaaaaccagggaaagcccctaagctcctgatctatgct gcatccactttgcaaagtggggtcccatcaaggttcagcggcagtggatc tgggacagaattcactctcacaatcagcagcctgcagcctgaagattttg caacttattactgtcaacagcttaatagttaccctctcactttcggcgga gggaccaaggtggagatcaaa LCDR1 cagggcattagcagttat 33 LCDR2 gctgcatcc 35 LCDR3 caacagcttaatagttaccctctcact 37 HC gaggtgcagctggtggagtctggaggaggcttggtccagcctggggggtc 39 cctgagactctcctgtgcagcctctgggttaatagtcagtcgcaactaca tgatctgggtccgccaggctccagggaaggggctggagtgggtctcagtt atttatagcggtggtagcacattctacgcagactccgtgaagggccgatt caccatctccagacacaattccaagaacacgctgtatcttcaaatgaaca gcctgagggctgaggacacggccgtatattactgtgcgagagatctgggt acaggaggtatggacgtctggggccaagggaccacggtcaccgtctcctc agcctccaccaagggcccatcggtcttccccctggcaccctcctccaaga gcacctctgggggcacagcggccctgggctgcctggtcaaggactacttc cccgaaccggtgacggtgtcgtggaactcaggcgccctgaccagcggcgt gcacaccttcccggctgtcctacagtcctcaggactctactccctcagca gcgtggtgaccgtgccctccagcagcttgggcacccagacctacatctgc aacgtgaatcacaagcccagcaacaccaaggtggacaagaaagttgagcc caaatcttgtgacaaaactcacacatgcccaccgtgcccagcacctgaac tcctggggggaccgtcagtcttcctcttccccccaaaacccaaggacacc ctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgag ccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggagg tgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgtac cgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaa ggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgaga aaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacacc ctgcccccatcccgggatgagctgaccaagaaccaggtcagcctgacctg cctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagca atgggcagccggagaacaactacaagaccacgcctcccgtgctggactcc gacggctccttcttcctctacagcaagctcaccgtggacaagagcaggtg gcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcaca accactacacgcagaagtccctctccctgtctccgggtaaatga LC gacatccagttgacccagtctccatccttcctgtctgcatctgtaggaga 41 cagagtcaccatcacttgctgggccagtcagggcattagcagttatttag cctggtatcagcaaaaaccagggaaagcccctaagctcctgatctatgct gcatccactttgcaaagtggggtcccatcaaggttcagcggcagtggatc tgggacagaattcactctcacaatcagcagcctgcagcctgaagattttg caacttattactgtcaacagcttaatagttaccctctcactttcggcgga gggaccaaggtggagatcaaacgaactgtggctgcaccatctgtcttcat cttcccgccatctgatgagcagttgaaatctggaactgcctctgttgtgt gcctgctgaataacttctatcccagagaggccaaagtacagtggaaggtg gataacgccctccaatcgggtaactcccaggagagtgtcacagagcagga cagcaaggacagcacctacagcctcagcagcaccctgacgctgagcaaag cagactacgagaaacacaaagtctacgcctgcgaagtcacccatcagggc ctgagctcgcccgtcacaaagagcttcaacaggggagagtgttag SequencesofmAb10922antibody: Component SEQID Part Sequence NO AminoAcidSequences HCVR EVQLVESGGGLVQPGGSLRLSCAASGFTFSIYEMNWVRQAPGKGLEWVSY 45 ITSSGTTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCASSS SSGYYFDYWGQGTLVTVSS HCDR1 GFTFSIYE 46 HCDR2 ITSSGTTI 47 HCDR3 ASSSSSGYYFDY 48 LCVR DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPP 49 NLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYST PPTFGQGTKLEIK LCDR1 QSVLYSSNNKNY 50 LCDR2 WAS 51 LCDR3 QQYYSTPPT 52 HC EVQLVESGGGLVQPGGSLRLSCAASGFTFSIYEMNWVRQAPGKGLEWVSY 53 ITSSGTTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCASSS SSGYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK LC DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPP 54 NLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYST PPTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREA KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC EVTHQGLSSPVTKSFNRGEC NucleotideSequences HCVR gaggtgcagctggtggagtctgggggaggcttggtacagcctggagggtc 55 cctgagactctcctgtgcagcctctggattcaccttcagtatttatgaaa tgaactgggtccgccaggctccagggaaggggctggagtgggtttcatac attactagtagtggtactaccatatactacgcagactctgtgaagggccg attcaccatctccagagacaacgccaagaactcactgtatctgcaaatga acagcctgagagccgaggacacggctgtttattactgtgcgagtagcagc tcgtccgggtactactttgactactggggccagggaaccctggtcaccgt ctcctca HCDR1 ggattcaccttcagtatttatgaa 56 HCDR2 attactagtagtggtactaccata 57 HCDR3 gcgagtagcagctcgtccgggtactactttgactac 58 LCVR gacatcgtgatgacccagtctccagactccctggctgtgtctctgggcga 59 gagggccaccatcaactgcaagtccagccagagtgttttatacagctcca acaataagaactacttagcttggtaccagcagaaaccaggacagcctcct aatctgctcatttactgggcatctacccgggaatccggggtccctgaccg attcagtggcagcgggtctgggacagatttcactctcaccatcagcagcc tgcaggctgaagatgtggcagtttattactgtcagcaatattatagtact cctcccacttttggccaggggaccaagctggagatcaaa LCDR1 cagagtgttttatacagctccaacaataagaactac 60 LCDR2 tgggcatct 61 LCDR3 cagcaatattatagtactcctcccact 62 HC gaggtgcagctggtggagtctgggggaggcttggtacagcctggagggtc 63 cctgagactctcctgtgcagcctctggattcaccttcagtatttatgaaa tgaactgggtccgccaggctccagggaaggggctggagtgggtttcatac attactagtagtggtactaccatatactacgcagactctgtgaagggccg attcaccatctccagagacaacgccaagaactcactgtatctgcaaatga acagcctgagagccgaggacacggctgtttattactgtgcgagtagcagc tcgtccgggtactactttgactactggggccagggaaccctggtcaccgt ctcctcagcctccaccaagggcccatcggtcttccccctggcaccctcct ccaagagcacctctgggggcacagcggccctgggctgcctggtcaaggac tacttccccgaaccggtgacggtgtcgtggaactcaggcgccctgaccag cggcgtgcacaccttcccggctgtcctacagtcctcaggactctactccc tcagcagcgtggtgaccgtgccctccagcagcttgggcacccagacctac atctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaaagt tgagcccaaatcttgtgacaaaactcacacatgcccaccgtgcccagcac ctgaactcctggggggaccgtcagtcttcctcttccccccaaaacccaag gacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtgga cgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcg tggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagc acgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaa tggcaaggagtacaagtgcaaggtctccaacaaagccctcccagccccca tcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtg tacaccctgcccccatcccgggatgagctgaccaagaaccaggtcagcct gacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtggg agagcaatgggcagccggagaacaactacaagaccacgcctcccgtgctg gactccgacggctccttcttcctctacagcaagctcaccgtggacaagag caggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctc tgcacaaccactacacgcagaagtccctctccctgtctccgggtaaatga LC gacatcgtgatgacccagtctccagactccctggctgtgtctctgggcga 64 gagggccaccatcaactgcaagtccagccagagtgttttatacagctcca acaataagaactacttagcttggtaccagcagaaaccaggacagcctcct aatctgctcatttactgggcatctacccgggaatccggggtccctgaccg attcagtggcagcgggtctgggacagatttcactctcaccatcagcagcc tgcaggctgaagatgtggcagtttattactgtcagcaatattatagtact cctcccacttttggccaggggaccaagctggagatcaaacgaactgtggc tgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaatctg gaactgcctctgttgtgtgcctgctgaataacttctatcccagagaggcc aaagtacagtggaaggtggataacgccctccaatcgggtaactcccagga gagtgtcacagagcaggacagcaaggacagcacctacagcctcagcagca ccctgacgctgagcaaagcagactacgagaaacacaaagtctacgcctgc gaagtcacccatcagggcctgagctcgcccgtcacaaagagcttcaacag gggagagtgttag AminoAcidSequenceofSARS-CoV-219CTCPELyticVariant(SEQIDNO:42;CPE Variant) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTW FHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVI KVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREF VFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRRYLTPGDSSS GWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSP TKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGN YNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVV LSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAV RDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQNVNCTEVPVAIHADQLTPTWRVYSTGS NVFQTRAGCLIGAEHVNNSYECDIPIGAGIGASYQTQTNSPRRAQSVASQSIIAYTMSLGAENS VAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALT GIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAG FIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQI PFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANL AATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAH FPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDWIGIVNNTVYDPLQPELDSFKEEL DKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYI WLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCC CodonOptimizedPolynucleotideSequenceofSARS-CoV-219CTCPELyticVariant (SEQIDNO:43;CPEVariant) atgttcgtcttcctggtcctgctgcctctggtctcctcacagtgcgtcaatctgacaactcgga ctcagctgccacctgcttatactaatagcttcaccagaggcgtgtactatcctgacaaggtgtt tagaagctccgtgctgcactctacacaggatctgtttctgccattctttagcaacgtgacctgg ttccacgccatccacgtgagcggcaccaatggcacaaagcggttcgacaatcccgtgctgcctt ttaacgatggcgtgtacttcgcctctaccgagaagagcaacattatcagaggctggatctttgg caccacactggactccaagacacagtctctgctgatcgtgaacaatgccaccaacgtggtcatc aaggtgtgcgagttccagttttgtaatgatcccttcctgggcgtgtactatcacaagaacaata agagctggatggagtccgagtttagagtgtattctagcgccaacaactgcacatttgagtacgt gagccagcctttcctgatggacctggagggcaagcagggcaatttcaagaacctgagggagttc gtgtttaagaatatcgacggctacttcaaaatctactctaagcacacccccatcaacctggtgc gcgacctgcctcagggcttcagcgccctggagcccctggtggatctgcctatcggcatcaacat cacccggtttcagacactgetggccctgcacagaagatacetgacacccggcgactcctctagc ggatggaccgccggcgctgccgcctactatgtgggctacctccagccccggaccttcctgctga agtacaacgagaatggcaccatcacagacgcagtggattgcgccctggaccccctgagcgagac aaagtgtacactgaagtcctttaccgtggagaagggcatctatcagacatccaatttcagggtg cagccaaccgagtctatcgtgcgctttcctaatatcacaaacctgtgcccatttggcgaggtgt tcaacgcaacccgcttcgccagcgtgtacgcctggaataggaagcggatcagcaactgcgtggc cgactatagcgtgctgtacaactccgcctctttcagcacctttaagtgctatggcgtgtccccc acaaagctgaatgacctgtgctttaccaacgtctacgccgattctttcgtgatcaggggcgacg aggtgcgccagatcgcccccggccagacaggcaagatcgcagactacaattataagctgccaga cgatttcaccggctgcgtgatcgcctggaacagcaacaatctggattccaaagtgggcggcaac tacaattatctgtaccggctgtttagaaagagcaatctgaagcccttcgagagggacatctcta cagaaatctaccaggccggcagcaccccttgcaatggcgtggagggctttaactgttatttccc actccagtcctacggcttccagcccacaaacggcgtgggctatcagccttaccgcgtggtggtg ctgagctttgagctgctgcacgccccagcaacagtgtgcggccccaagaagtccaccaatctgg tgaagaacaagtgcgtgaacttcaacttcaacggcctgaccggcacaggcgtgctgaccgagtc caacaagaagttcctgccatttcagcagttcggcagggacatcgcagataccacagacgccgtg cgcgacccacagaccctggagatcctggacatcacaccctgctctttcggcggcgtgagcgtga tcacacccggcaccaatacaagcaaccaggtggccgtgctgtatcagaacgtgaattgtaccga ggtgcccgtggctatccacgccgatcagctgaccccaacatggcgggtgtacagcaccggctcc aacgtcttccagacaagagccggatgcctgatcggagcagagcacgtgaacaattcctatgagt gcgacatcccaatcggcgccggcatctgtgcctcttaccagacccagacaaactctcccagaag agcccagagcgtggcctcccagtctatcatcgcctataccatgtccctgggcgccgagaacagc gtggcctactctaacaatagcatcgccatcccaaccaacttcacaatctctgtgaccacagaga tcctgcccgtgtccatgaccaagacatctgtggactgcacaatgtatatctgtggcgattctac cgagtgcagcaacctgctgctccagtacggcagcttttgtacccagctgaatagagccctgaca ggcatcgccgtggagcaggataagaacacacaggaggtgttcgcccaggtgaagcaaatctaca agaccccccctatcaaggactttggcggcttcaatttttcccagatcctgcctgatccatccaa gccttctaagcggagctttatcgaggacctgctgttcaacaaggtgaccctggccgatgccggc ttcatcaagcagtatggcgattgcctgggcgacatcgcagccagggacctgatctgcgcccaga agtttaatggcctgaccgtgctgccacccctgctgacagatgagatgatcgcacagtacacaag cgccctgctggccggcaccatcacatccggatggaccttcggcgcaggagccgccctccagatc ccctttgccatgcagatggcctataggttcaacggcatcggcgtgacccagaatgtgctgtacg agaaccagaagctgatcgccaatcagtttaactccgccatcggcaagatccaggacagcctgtc ctctacagccagcgccctgggcaagctccaggatgtggtgaatcagaacgcccaggccctgaat accctggtgaagcagctgagcagcaacttcggcgccatctctagcgtgctgaatgacatcctga gccggctggacaaggtggaggcagaggtgcagatcgaccggctgatcaccggccggctccagag cctccagacctatgtgacacagcagctgatcagggccgccgagatcagggccagcgccaatctg gcagcaaccaagatgtccgagtgcgtgctgggccagtctaagagagtggacttttgtggcaagg gctatcacctgatgtccttccctcagtctgccccacacggcgtggtgtttctgcacgtgaccta cgtgcccgcccaggagaagaacttcaccacagcccctgccatctgccacgatggcaaggcccac tttccaagggagggcgtgttcgtgtccaacggcacccactggtttgtgacacagcgcaatttct acgagccccagatcatcaccacagacaacaccttcgtgagcggcaactgtgacgtggtcatcgg catcgtgaacaataccgtgtatgatccactccagcccgagctggacagctttaaggaggagctg gataagtatttcaagaatcacacctcccctgacgtggatctgggcgacatcagcggcatcaatg cctccgtggtgaacatccagaaggagatcgaccgcctgaacgaggtggctaagaatctgaacga gagcctgatcgacctccaggagctgggcaagtatgagcagtacatcaagtggccctggtacatc tggctgggcttcatcgccggcctgatcgccatcgtgatggtgaccatcatgctgtgctgtatga catcctgctgttcttgcctgaagggctgctgtagctgtggctcctgctgttaa AminoAcidSequenceofSARS-CoV-219CTVariant(SEQIDNO:44;Variant) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTW FHAISGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKV CEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVF KNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGW TAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQP TESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTK LNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN
(334) The claimed subject matter is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the claimed subject matter in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.
(335) All patents, applications, publications, test methods, literature, and other materials cited herein are hereby incorporated by reference in their entirety as if physically present in this specification.