EXPRESSION SYSTEM FOR PRODUCT MANUFACTURING

20260022391 ยท 2026-01-22

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure provides engineered bacterial cells having one or more genetic modifications that result in increased production of expression products, such as increased production of plasmids with reduced occurrence of plasmid concatemers or multimers. Also disclosed herein are expression systems for product manufacturing in media having reduced antibiotic concentration, as well as methods of making cells for use in the expression systems. The cells and expression systems increase the growth rate and production yields of biomolecules produced within the host bacterial host cells without the use of antibiotics, and can produce the product with little to no endotoxins present.

    Claims

    1. A method of replicating a template plasmid in a genetically-modified bacterial cell that is a species of genus Vibrio, the method comprising: (a) obtaining the genetically-modified bacterial cell, wherein the genetically-modified bacterial cell comprises a genetic modification to one or more genes with respect to a parent bacterial cell of the same species of genus Vibrio as the genetically-modified bacterial cell, wherein the one or more genes are selected from the group consisting of: a DAM gene, a DNS gene, a RecA gene, a KDO gene, a KdsD gene, an lpxL gene, an lpxM gene, and any combination thereof; and (b) transforming the template plasmid into the genetically-modified bacterial cell, thereby replicating the template plasmid in the genetically-modified bacterial cell; wherein the template plasmid is replicated in the genetically-modified bacterial cell with an increased production yield, as compared to a level of production yield in the parent bacterial cell lacking the genetic modification.

    2. The method of claim 1, wherein the genetic modification comprises a deletion of the one or more genes.

    3. The method of claim 1, wherein the genetic modification comprises replacing one or more endogenous genes with one or more catalase genes.

    4. The method of claim 1, wherein the genetically-modified bacterial cell comprises a genetic modification to a RecA gene.

    5. The method of claim 1, wherein the genetically-modified bacterial cell comprises a genetic modification to the DNS gene having a sequence of SEQ ID NO: 16.

    6. The method of claim 1, wherein the genetically-modified bacterial cell comprises a genetic modification to the DAM gene having a sequence of SEQ ID NO: 12.

    7. The method of claim 1, wherein the genetically-modified bacterial cell comprises a genetic modification to the KdsD gene, the lpxL gene, or the lpxM gene.

    8. The method of claim 1, wherein the species of the genetically-modified bacterial cell is Vibrio natriegens, Vibrio cholerae, Vibrio fischeri, Vibrio parahaemolyticus, Vibrio campbellii, or Vibrio vulnificus.

    9. The method of claim 7, wherein the species of the genetically-modified bacterial cell is Vibrio natriegens.

    10. The method of claim 1, wherein upon transformation of the template plasmid into the genetically-modified bacterial cell of the species, the genetically-modified bacterial cell expresses a transgene encoded by the template plasmid at an increased level, as compared to a level of transgene expression that is produced in a same amount of time upon transformation of the template plasmid into a bacterial cell of an E. coli K12 or B strain derivative lacking the genetic modification.

    11. The method of claim 1, wherein the template plasmid is replicated in the genetically-modified bacterial cell with reduced levels of plasmid multimers or concatemers, relative to an amount of plasmid multimers or concatemers produced in a same amount of time upon transformation of the template plasmid into the parent bacterial cell.

    12. The method of claim 11, wherein the genetically-modified bacterial cell produces at least: 70%, 80%, 90% or 99% less multimers or concatemers, as compared to a level of multimers or concatemers produced by the parent bacterial cell.

    13. The method of claim 11, wherein the genetically-modified bacterial cell produces at least: 70%, 80%, 90% or 99% increase in monomeric plasmid species, as compared to a level of monomeric plasmid species produced by the parent bacterial cell.

    14. The method of claim 11, wherein the genetically-modified bacterial cell produces at least: 70%, 80%, 90% or 99% increase in supercoiled plasmid DNA, as compared to a level of supercoiled plasmid DNA species produced by the parent bacterial cell.

    15. The method of claim 11, wherein plasmids produced by the genetically-modified bacterial cell exhibit an increased ratio of monomeric and supercoiled plasmid DNA to multimers and concatemers, relative to a ratio of monomeric and supercoiled plasmid DNA to multimers and concatemers observed in plasmids produced by the parent bacterial cell.

    16. The method of claim 1, wherein upon transformation of the template plasmid into the genetically-modified bacterial cell, the genetically-modified bacterial cell replicates the template plasmid at an increased level, relative to the level of template plasmid replication produced in a same amount of time upon transformation of the template plasmid into a bacterial cell of an E. coli K12 or B strain derivative lacking the genetic modification.

    17. The method of claim 1, wherein upon culturing the genetically-modified bacterial cell in a growth medium, the genetically-modified bacterial cell has a cellular replication rate that is at least 150% faster than a replication rate of a bacterial cell of an E. coli K12 or B strain derivative lacking the genetic modification that is replicated in the growth medium for a same amount of time, as measured by optical density at 600 nm.

    18. The method of claim 1, wherein upon culturing the genetically-modified bacterial cell in a growth medium, the genetically-modified bacterial cell has a growth rate of at least: 40%, 50%, 55%, 60%, 65%, 70%, 80%, 85%, or 90% more than the parent bacterial cell.

    19. The method of claim 1, wherein upon culturing the genetically-modified bacterial cell in a growth medium, the genetically-modified bacterial cell replicates with a doubling time of less than 30 minutes, as measured by optical density at 600 nm.

    20. The method of claim 1, wherein upon culturing the genetically-modified bacterial cell in a growth medium, the genetically-modified bacterial cell replicates with reduced secretion of endotoxin into the growth medium, as compared to an amount of endotoxin secreted by replicating an E. coli K12 or B strain derivative lacking the genetic modification in the growth medium for a same amount of time.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0027] The features of the present disclosure are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present disclosure can be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the disclosure are utilized, and the accompanying drawings described below.

    [0028] FIG. 1 provides a growth curve showing that V. natriegens growth rate is faster compared to E. coli. At 10 hours, AM2 showed the fastest growth rate, followed by AM3, AM1, AM4, AM5, and E. coli, respectively. V. natriegens (AM1-5) was grown under the following conditions: animal component free peptone (5 to 10 g/L), yeast Extract (5 to 10 g/L), sodium chloride (5 to 30 g/L), double distilled water to a total volume of 1000 ML, pH adjusted to be from 6.5 to 7.5, temperature was from 25 C. to 37 C., and with 100-300 rpm shaking. E. coli was grown in optimal growth media (LB broth) at 37 C. with 100-300 rpm shaking.

    [0029] FIG. 2 provides a growth curve showing that the growth rate of the exemplary bacterial cells (NB) of the present disclosure is significantly higher (1.9 times) compared to E. coli based systems grown under the same conditions using the same growth media.

    [0030] FIGS. 3A-3B provide a table and a bar graph showing that the exemplary bacterial cells of the present disclosure have a faster cell doubling time and greater plasmid yield compared to an E. coli system. FIG. 3A shows the estimated doubling time of the exemplary bacterial cells of the present disclosure compared to E. coli grown in the same media, based on two independent runs performed in triplicate. FIG. 3B shows that the exemplary bacterial cells of the present disclosure have a greater total plasmid yield (mg) for various plasmids ranging in size from 2,500 bp to 7,900 bp. Estimated based on E. coli growth time (12-14 hours).

    [0031] FIGS. 4A-4B provide example plasmid DNA preps isolated from the un-modified strain or the genetically-modified bacterial cell that comprises a genetic modification to a DNA strand exchange protein as described herein. FIG. 4A (labeled Plasmid Example 1) shows purified plasmid DNA isolated from two independent transformed colonies in either the un-modified strain or the genetically-modified bacterial cell described herein. FIG. 4B (labeled Plasmid Example 2) shows a similar result with a completely different plasmid DNA. In both cases it can be seen that the natural strain generates undesired multimeric species in addition to the desired plasmid (which results in a low-quality preparation).

    DETAILED DESCRIPTION

    [0032] It is to be understood that both the foregoing general description and the following detailed description are exemplary and explanatory only and are not to be construed as restrictive of the disclosure.

    [0033] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described. All documents, or portions of documents, cited in this application, including, but not limited to, patents, patent applications, articles, books, and treatises, are hereby expressly incorporated by reference in their entirety for any purpose.

    [0034] Disclosed herein are genetically-modified bacterial cells, expression systems containing the same, and methods of making expression systems containing the same, which increase the growth rate and production yields of biomolecules produced within the cells.

    [0035] Antibiotic resistance genes and the antibiotics themselves have become undesirable due to multiple antibiotic-resistant microorganisms that can potentially evolve in the natural environment. Furthermore, US-FDA guidance for Human somatic cell therapy and genetic therapy recommends avoiding penicillin and other -lactam antibiotics during manufacturing production due to severe hypersensitivity reactions in patients as these antibiotics can become contaminants post-production. Accordingly, disclosed herein are genetically-modified bacterial cells with one or more genetic modifications that results in the elimination or reduced expression of an expression product (e.g. a polypeptide or a gene) encoded by an essential gene, where the genetically-modified bacterial cell can be transformed with a template plasmid and replicates the template plasmid with reduced levels of plasmid multimers or concatemers, as compared to an otherwise comparable cell lacking the genetic modification, which can be supplemented through an exogenous polynucleotide (e.g. a plasmid) comprising a sequence encoding the expression product. By constructing the polynucleotide encoding the expression product of the essential gene to produce a biomolecule, the cell can produce the biomolecule through a plasmid selection that does not involve the use of antibiotics. Further genetic modifications to the cell to reduce or eliminate the secretion of endotoxin into the growth medium, as well as genetic modifications to improve the growth rate and plasmid/biomolecule yield are also contemplated herein.

    Definitions

    [0036] Unless otherwise indicated, all technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. Unless otherwise indicated or obvious from context, the following terms have the following meanings:

    [0037] As used in this specification and the appended claims, the singular forms a, an, and the include plural references unless the context clearly dictates otherwise. For example, the term a sample includes a plurality of samples, including mixtures thereof.

    [0038] Any reference to or herein is intended to encompass and/or unless otherwise stated. As used herein, the term and/or includes any and all combinations of one or more of the associated listed items.

    [0039] Use of the term including as well as other forms, such as includes and included, is not limiting.

    [0040] As used herein, the term comprise and its grammatical equivalents specifies the presence of stated features, integers, steps, operations, elements, and/or components, but does not preclude the presence or addition of one or more other features, integers, steps, operations, elements, components, and/or groups thereof.

    [0041] As used herein, the term about in reference to a number or range of numbers is understood to mean the stated number and numbers+/10% thereof, or 10% below the lower listed limit and 10% above the higher listed limit for the values listed for a range, as well as variations of 5%, 1%, 0.5%, or even 0.1%.

    [0042] The terms % identical, % identity, and percent identity, or grammatical equivalents thereof, refer to the extent to which two sequences (nucleotide or amino acid) have the same residue at the same positions in an alignment. For example, an amino acid sequence is X % identical to SEQ ID NO: Y can refer to % identity of the amino acid sequence to SEQ ID NO: Y and is elaborated as X % of residues in the amino acid sequence are identical to the residues of sequence disclosed in SEQ ID NO: Y. Generally, computer programs can be employed for such calculations.

    [0043] The terms essential gene and auxotroph, as used herein, refer to a gene that is necessary for cell growth and/or survival and the organism missing the necessary gene is referred to as an auxotroph. Bacterial essential genes can be identified by targeted gene deletion and/or random mutagenesis and screening (see, for example, Zhang and Lin, DEG 5.0, a database of essential genes in both prokaryotes and eukaryotes, Nucl Acids Res, 2009:37: D455-D458 and Gerdes et al., Essential Genes on metabolic maps, Curr Opin Biotechnol, 2006:17 (5): 448-456.

    [0044] The term enhance or increase refers to an increase in the specified parameter of at least about 1.25-fold, 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 8-fold, 10-fold, twelve-fold, fifteen-fold, etc.

    [0045] The term inhibit or reduce or grammatical variations thereof as used herein refers to a decrease or diminishment in the specified level or activity of at least about 15%, 25%, 35%, 40%, 50%, 60%, 75%, 80%, 90%, 95% or more. In particular embodiments, the inhibition or reduction results in little or essentially no detectable activity (at most, an insignificant amount, e.g., less than about 10%, 5%, 1%, 0.1% or even 0.005%).

    [0046] As used herein, a non-native and exogenous nucleic acid sequence or polynucleotide refer to a nucleic acid sequence not normally present in a bacterium, e.g., an extra copy of an endogenous sequence, or a heterologous sequence such as a sequence from a different species, strain, or substrain of bacteria, or a sequence that is modified and/or mutated as compared to the unmodified sequence from bacteria of the same subtype. In some embodiments, the non-native nucleic acid sequence is a synthetic, non-naturally occurring sequence (see, e.g., Purcell et al., 2013). The non-native nucleic acid sequence or polynucleotide may be a regulatory region, a promoter, a gene, and/or one or more genes in a gene cassette. In some embodiments, non-native refers to two or more nucleic acid sequences that are not found in the same relationship to each other in nature. The non-native nucleic acid sequence may be present on a plasmid or chromosome. In addition, multiple copies of any regulatory region, promoter, gene, and/or gene cassette may be present in the bacterium, wherein one or more copies of the regulatory region, promoter, gene, and/or gene cassette may be mutated or otherwise altered as described herein. In some embodiments, the genetically engineered bacteria are engineered to comprise multiple copies of the same regulatory region, promoter, gene, and/or gene cassette in order to enhance copy number or to comprise multiple different components of a gene cassette performing multiple different functions.

    [0047] The term protein, peptide and polypeptide are used interchangeably to refer to an oligomer of two or more linked amino acids or derivatives of the same. The term exogenously introduced polypeptide refers to a polypeptide encoded by an exogenous polynucleotide.

    [0048] As used herein, the term transform or transformation refers to the transfer of a nucleic acid fragment into a host bacterial cell, resulting in genetically-stable inheritance. Host bacterial cells comprising the transformed nucleic acid fragment are referred to as recombinant or transgenic or transformed organisms.

    [0049] The terms complementary and complementarity, as used herein, with reference to a nucleic acid molecule or nucleotide sequence, refer to the characteristic of a polynucleotide having nucleotides that base pair with their Watson-Crick counterparts (C with G; or A with T) in a reference nucleic acid. For example, when every nucleotide in a polynucleotide forms a base pair with a reference nucleic acid, that polynucleotide is said to be 100% complementary to the reference nucleic acid. In a double stranded DNA or RNA sequence, the upper (sense) strand sequence is in general, understood as going in the direction from its 5- to 3-end, and the complementary sequence is thus understood as the sequence of the lower (antisense) strand in the same direction as the upper strand. Following the same logic, the reverse sequence is understood as the sequence of the upper strand in the direction from its 3-to its 5-end, while the reverse complement sequence or the reverse complementary sequence is understood as the sequence of the lower strand in the direction of its 5-to its 3-end. Each nucleotide in a double stranded DNA or RNA molecule that is paired with its Watson-Crick counterpart called its complementary nucleotide.

    [0050] The term length as it applies to a nucleic acid (polynucleotide) or polypeptide may be expressed as kilobases (kb) or base pairs (bp), and may be used interchangeably with the term, linked nucleosides. Thus, a length of 1 kb refers to a length of 1000 linked nucleosides, and a length of 500 bp refers to a length of 500 linked nucleosides. Similarly, a protein having a length of 500 linked amino acids may also be simply described as having a length of 500 amino acids.

    [0051] The term guide nucleic acid, as used herein, refers to a nucleic acid that includes a nucleotide sequence that hybridizes to a target nucleic acid and that is capable of hybridizing to a portion of an additional nucleic acid that is bound by a nuclease.

    [0052] The term genetic modification, as used herein, refers to any genetic change. Exemplary genetic modifications include those that increase, decrease, or abolish the expression of a gene, including, for example, modifications of native chromosomal or extrachromosomal genetic material. Exemplary genetic modifications also include the introduction of at least one plasmid, modification, mutation, base deletion, base addition, base substitution, and/or codon modification of chromosomal or extrachromosomal genetic sequence(s), gene over-expression, gene amplification, gene suppression, promoter modification or substitution, gene addition (either single or multi-copy), antisense expression or suppression, or any other change to the genetic elements of a host cell, whether the change produces a change in phenotype or not.

    [0053] The terms non-naturally occurring. engineered. genetically modified. genetic modification, and grammatical equivalents as used herein, are used interchangeably and indicate the involvement of the hand of man. The terms, when referring to a cell or expression system, refer to a cell or expression system that is substantially free from at least one other feature with which it is naturally associated in nature, and/or contains a modification (e.g., gene edit, chemical modification, nucleotide sequence, or amino acid sequence) that is not present in the naturally occurring cell or expression system.

    [0054] The term biomolecule as used herein, refers to a polypeptide or polynucleotide that is expressed by a cell or expression system of the invention as described herein. The biomolecule, for example, can be a therapeutic polypeptide or polynucleotide used to alleviate or lessen a symptom of a disease or condition or used for a health, nutritional, or cosmetic benefit in a subject. Examples are, but not limited to, antibodies, messenger RNAs, antisense oligonucleotides, and short interfering RNAs.

    Engineered Bacterial Cells

    [0055] Disclosed herein are engineered, genetically modified cells having one or more genetic modifications. Such cells can be modified to impart or disable specific cellular traits. In some embodiments, the cells are bacterial cells. In some embodiments, the cells can be a gram-negative bacterium. For example, a non-limiting list of bacteria that may be useful to modify specific cellular traits include Escherichia spp., Shigella spp., Salmonella spp., Campylobacter spp., Neisseria spp., Haemophilus spp., Aeromonas spp., Francisella spp., Yersinia spp., Klebsiella spp., Bordetella spp., Legionella spp., Citrobacter spp., Chlamydia spp., Brucella spp., Pseudomonas spp., Helicobacter spp., Moraxella spp., Stenotrophomonas spp., Bdellovibrio spp., Acinetobacter spp., Enterobacter spp. and Vibrio spp.

    [0056] In some embodiments, the genetically-modified bacteria can be any organism of the genus Escherichia. Some examples of organisms in the Escherichia genus include, but are not limited to, Escherichia alberti, Escherichia coli, Escherichia fergusonii, Escherichia hermannii. Escherichia marmotae, and Escherichia vulneris, but the expression system can be applied to any Escherichia sp. organism, or to any combination or sub-combination of the Escherichia spp. In some embodiments, the genetically-modified bacterial cells are Escherichia coli. Examples of Escherichia coli include, but are not limited to, Escherichia coli K-12 strains such as W3110) strain (ATCC 27325) and MG1655 strain (ATCC 47076). Escherichia coli K5 strain (ATCC 23506) and Escherichia coli B.

    [0057] In some embodiments, the genetically-modified bacteria comprise one or more genetic modifications where the genetic modifications as described herein are with respect to a specific bacteria strain. An example of the specific bacteria strain is the strain deposited under accession number NCIMB 857 at National Collections of Industrial. Food and Marine Bacteria (NCIMB) at NCIMB Ltd. Wellheads Pl. Dyce. Aberdeen AB21 7 GB. United Kingdom, on Feb. 1, 1961, which is an International Depository Authority under Article 7 of the Budapest Treaty. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain deposited under accession number NCIMB 857. Another example of the specific bacteria strain is the strain deposited under accession number ATCC 14048 at American Type Culture Collection (ATCC) (address: P.O. Box 1549. Manassas. Va. 20108. United States of America), which is an International Depository Authority under Article 7 of the Budapest Treaty, with an earliest deposit date of Feb. 1, 1961. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain deposited under accession number ATCC 14048. Another example of the specific bacteria strain is the strain deposited under accession number NBRC 15636 at International Patent Organism Depositary (IPOD). National Institute of Technology and Evaluation (NITE) Biological Resource Center (NBRC) at NBCR 2-5-8 Kazusakamatari. Kisarazu-shi. Chiba 292-0818 Japan, on Jan. 26, 1994, which is an International Depository Authority under Article 7 of the Budapest Treaty. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain deposited under accession number NBRC 15636. Another example of the specific bacteria strain is the strain deposited under accession number DSM 759 at Leibniz Institute. DSMZ-German Collection of Microorganisms and Cell Cultures GmbH on or before Oct. 18, 1976, which is an International Depository Authority under Article 7 of the Budapest Treaty. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain deposited under accession number DSM 759. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain deposited under accession number CIP 75.07. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain deposited under accession number LMD 73.19. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain deposited under accession number LMG 10935. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain deposited under accession number CAIM 12. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain deposited under accession number CCUG 16371. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain deposited under accession number IFO 15636. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain deposited under accession number NCCB 73019. In some embodiments, the genetic modifications as described herein are with respect to the bacteria strain designated P. Baumann 111. In some embodiments, the bacterial strain is NCIMB 857. The Vibrio natriegens strains NCIMB 857. ATCC 14048. DSM 750, and NBRC 15636 are available from the respective depositories for the public to access the strains without restrictions during the pendency of this application and upon grant. Further, because the Vibrio natriegens strains NCIMB 857, ATCC 14048, DSM 750, and NBRC 15636 are deposited at International Depository Authorities under Article 7 of the Budapest Treaty, maintenance of viable cultures of each deposit is assured by the respective International Depository Authorities for 30 years from the date of the deposits.

    [0058] In some embodiments, the bacteria can be any organism of the Family Escherichia. In some embodiments, the bacteria can be any organism of the Family Vibrionaceae. The Vibrio sp. organisms can be any species of the genus Vibrio. Some examples of organisms in the Vibrio genus include, but are not limited to, Vibrio natriegens, Vibrio cholerae, Vibrio fischeri, Vibrio parahaemolyticus, Vibrio campbellii, and Vibrio vulnificus, but the expression system can be applied to any Vibrio sp. organism, or to any combination or sub-combination of the Vibrio sp. organisms listed herein. In one embodiment the engineered or genetically-modified organisms are Vibrio natriegens. In another embodiment the engineered or genetically-modified organisms are Vibrio cholerae. In another embodiment the engineered or genetically-modified organisms described herein are Vibrio fischeri. In another embodiment the engineered or genetically-modified organisms are Vibrio parahaemolyticus. In another embodiment the engineered or genetically-modified organisms described herein are Vibrio vulnificus. In some embodiments, the genetically-modified bacteria described herein are Vibrio natriegens deposited under accession number NCIMB 857.

    [0059] Vibrio spp. have several advantages as host cells over other bacteria for many molecular biology applications. One advantage is their rapid growth rate. One of the most time intensive steps in modern biotech workflows is waiting for the host cell to grow to a sufficient density before DNA/protein/product can be recovered or the phenotype can be assessed. E. coli is considered to have one of the quickest growth rates relative to other organisms used in the biotech sector, and this has been one of its strengths. Because Vibrio spp. have a growth rate 2-3 faster than commonly used E. coli strains, it is able to achieve a dramatic reduction in the time necessary for the host to grow, and will accelerate research efforts.

    [0060] An additional advantage is the compatibility of Vibrio spp. with standard lab protocols. Unlike organisms that require specialized techniques or methods. Vibrio spp. is compatible with many standard cloning vectors, growth media, workflows and commercially available kits developed for E. coli or recovering DNA.

    [0061] A further advantage is the nutritional versatility of Vibrio spp. allowing it to grow on a range of different growth media, including inexpensive, minimal media. Coupled with its rapid growth rate, this feature allows for industrial scale production in less time and at lower cost.

    [0062] In some embodiments, an altered Chromosome II can serve as a vector or plasmid or artificial chromosome having the exogenous or heterologous DNA and for the construction, cloning, maintenance, and/or recovery of large DNAs and for the expression, production, and secretion of proteins or peptides or other biomolecules. In some embodiments, a polynucleotide, a plasmid, vector, or artificial chromosome described herein comprising the DNA insert or essential genetic elements can be replicated and maintained in the host organism, which can be a Vibrio spp., an E. coli, or other gram-negative bacteria.

    [0063] While specific classes of modifications are provided below; the present disclosure encompasses bacterial cells having one or more of the classes of modifications described below (including any combination of the modifications provided below).

    Endotoxin-Free (or Reduced Endotoxin Levels)

    [0064] Disclosed herein are genetically-modified bacterial cells that replicate with reduced secretion of endotoxins. Also provided herein are non-toxic or reduced toxin (e.g., endotoxin free) cells (e.g. gram-negative bacterial cells such as E. coli). The present disclosure is not limited to a particular method of providing non-toxic cells. Lipopolysaccharides (LPS) are large molecules consisting of a lipid and a polysaccharide that are bacterial toxins. They are composed of an O-antigen, an outer core, and an inner core all joined by a covalent bond, and are found in the outer membrane of gram-negative bacteria. Lipopolysaccharides can have substantial impacts on human health, primarily through interactions with the immune system. LPS is a potent activator of the immune system and pyrogen (agent that causes fever). In severe embodiments. LPS can play a role in causing septic shock. In lower levels and over a longer time period, there is evidence LPS may play an important and harmful role in autoimmunity, obesity, depression, and cellular senescence. The term endotoxin is often used interchangeably with LPS. The LPS layer is essential to both the form and function of the OM of gram-negative bacteria, providing gram-negative pathogenesis and survival of the bacterium. LPS of various gram-negative bacteria is built generally to a common structural architecture including among others; the outer membrane embedded lipid A. Lipid A is the most conserved LPS domain amongst gram-negative bacterial, and is the structural component responsible for the biological activities within the host. Lipid A in LPS can be referred to as the endotoxin moiety. The majority of gram-negative bacteria has an inner core having at least one 2-keto 3-deoxy-D-manno-octulosonate (KDO) molecule. KDO is an essential component of LPS that is a conserved residue found in nearly all LPS structures. For example, the minimal LPS structure required for growth of E. coli is made of two KDO residues attached to lipid A (KD0.sub.2-lipidA), indicating the importance of KDO in maintaining the integrity and viability of the bacterial cell. The biosynthesis pathway of LPS structures is initiated by the enzyme d-arabinose 5-phosphate (A5P) isomerase (API/KdsD/yrbH), which converts the pentose pathway intermediate D-ribulose 5-phosphate into A5P. Subsequently. A5P is condensed with phosphoenolpyruvate to form KDO 8-phosphate (KD08P) by KDO 8-phosphate synthase, hydrolysed to KDO by KDO 8-phosphate phosphatase, activated as the sugar nucleotide CMP-KDO by a CMP-KDO synthase, before finally being transferred from CMP-KDO to the acceptor lipid IVA by a KDO synthase. The lauroyl and myristoyl-acyl carrier protein dependent acyltransferases transfer the fatty acids laurate and myristate, respectively, to KDO2-lipid IVA to form the characteristic acyloxyacyl units of hexaacylated KDO-lipid A.

    [0065] The disruption in a gene of the LPS biosynthetic pathway is performed by at least one genetic modification in a gene encoding a protein selected from the group consisting of D-arabinose 5-phosphate isomerase, KD08P synthase, CMP-KDO synthetase, KD08P phosphatase and KDO transferase. Such a modification can be a modification in the expression or the coding sequence of the genes encoding the listed proteins. Such modifications can provide a reduced expression or an abolished expression of one or more genes encoding such D-arabinose 5-phosphate isomerase, KD08P synthase, CMP-KDO synthetase, KD08P phosphatase and/or KDO transferase.

    [0066] The disruption in the outer membrane biosynthetic pathway can be due to at least one modification in a gene or expression of a gene encoding for the protein selected from the group consisting of gutQ, kdsD, kdsA, kdsB, kdsC and waaA, wherein gutQ and kdsD encode a D-arabinose 5-phosphate isomerase, kdsA encodes a KD08P synthase, kdsB encodes a CMP-KDO synthetase, kdsC encodes a KD08P phosphatase and waaA encodes a KDO transferase. In some embodiments, the at least one genetic modification reduces or inhibits the expression of the genes. In some embodiments, the viable host cell with modified outer membrane biosynthetic pathway leading to disruption of said pathway, comprises a mutation in the expression or the coding sequence of any one or more of the genes encoding for the proteins selected from the group of poly--1,6-N-acetyl-D-glucosamine outer membrane porin, poly--1,6-N-acetyl-D-glucosamine N-deacetylase, and/or poly-N-acetyl-D-glucosamine synthase and displays Lipid IVA in the outer membrane. Such a cell is additionally modified in at least one gene or the expression of at least one gene encoding for a protein selected from the group consisting of lauroyl acyltransferase and myristoyl-acyl carrier protein-dependent acyltransferase. The modification can be a modification in the expression or the coding sequence of the genes encoding the listed proteins. Such a modification provides a reduced expression or an abolished expression of one or more genes encoding such lauroyl acyltransferase and myristoyl-acyl carrier protein-dependent acyltransferase. lpxL and lpxM genes encode fatty acid transferases involved in membrane formation. In some embodiments, the host cell can be modified in at least one gene or the expression of at least one gene selected from the group consisting of lpxL and/or lpxM.

    [0067] Provided herein are non-toxic or reduced toxin (e.g., endotoxin free) cells (e.g. gram-negative bacterial cells such as E. coli). The present disclosure is not limited to a particular method of providing non-toxic cells. In some embodiments, non-toxic cells are provided through suppression of LPS expression. The present disclosure is not limited to a particular method of suppressing LPS expression. In some embodiments, LPS expression is suppressed through suppression of API/KdsD/yrbH protein expression. In some embodiments, API/KdsD/yrbH expression is suppressed through suppression of KDO protein expression. In some embodiments, KDO protein expression is suppressed through, for example, modification of the gutQ gene and the kdsD gene. In some embodiments, KDO protein expression at the outer membrane does not occur due to the KDO protein not associating with Lipid IVA, such that only Lipid IVA is transported to the outer membrane. For example, modifications in gutQ, kdsD, kdsA, kdsB, waaA msbA, and/or yhjD genes or mutations of any other biosynthetic, processing, or trafficking genes eliminate the formation of or membrane presentation of the (KDO)2-Lipid IVA complex, resulting in, for example, only the Lipid IVA molecule being transported to the outer membrane and no subsequent LPS formation.

    [0068] In some embodiments, non-toxic gram-negative bacteria are used as hosts for the production of endotoxin free biomolecules. The present disclosure is not limited to particular biomolecules. Traditionally, the production of biomolecules in Gram negative bacteria, whether it be outer membrane vesicles for vaccines. LPS type molecules (such as monophosphoryl lipid A (MPLA)) to be used as adjuvants, recombinant pharmaceutical proteins, macromolecules, or DNA for mammalian cell transfection/gene therapy, is plagued by the presence of endotoxin from the bacterial host. Contamination of the therapeutic molecule with endotoxin is a concern, as the immunogenic potential of LPS is well documented. Current production strategies to alleviate endotoxin contamination include various purification techniques, such as the kits marketed for endotoxin free DNA plasmid purification, followed by assays to measure endotoxin levels. As such, the non-toxic gram-negative bacterial cells of the present disclosure (e.g., the endotoxin-free cells) provide improved methods of isolating endotoxin free biomolecules. Accordingly, as some cells of the present disclosure do not produce endotoxin, such purification steps are not required. For example, the endotoxin-free cell of the present disclosure can be a host for the production of commercially important biomolecules in an endotoxin-free environment using Gram-negative bacteria. Additionally, cells comprising a modification in a gene encoding any one or more of a D-arabinose 5-phosphate isomerase, a KD08P synthase, a CMP-KDO synthetase, a KD08P phosphatase and/or a KDO transferase, an ATP-dependent translocator, an inner membrane protein (e.g., gutQ, kdsD, kdsA, kdsB, waaA msbA, yhjD genes), or modifications in any other biosynthetic, processing (e.g., lpxL or lpxM), or trafficking bacterial genes can be hosts for the production of commercially important biomolecules in an endotoxin-free environment using Gram-negative bacteria.

    [0069] In some embodiments, a gene implicated in endotoxin production as described herein is itself modified to eliminate or reduce endotoxin production. In some embodiments, a non-coding portion of a gene implicated in endotoxin production as described herein is modified to eliminate or reduce the endotoxin production, such as a promotor, a polyadenylation site, a 5 untranslated region, or a 3 untranslated region. In some embodiments, an upstream or downstream gene that affects endotoxin production as described herein is modified to eliminate or reduce endotoxin production.

    [0070] In some embodiments, a lauroyl and/or myristoyl acyltransferase polypeptide to be modified has at least 85% amino acid sequence identity to GenBank Accession No. ANQ15862 or a fragment thereof having lauroyl and/or myristoyl transferase activity. An exemplary lauroyl and/or myristoyl acyltransferase amino acid sequence follows:

    TABLE-US-00001 (SEQIDNO:3) 1mskdkqmqpefslsllhprnwgvwigfgllaiivnilpyrlllslgqsvgklgmrygkkr 61vhvakrnlelafpdksqediehivtenfkntgmalietgitwfwptwrfktllvekdvga 121lkekaqegkgvllccvhalnleitarafavmglagygafrphdnpaynfiqywgrthngn 181klidrkdvkkmirvlrsgerlfylpdhdygrnksvyvpffavedactttgtsilaytskc 241aivpgsgfrneqgkyeiiadkcieadypqkdevaaaaymnkyveevilrapeqwmwlhkr 301yktmqdenvpkgiryr

    [0071] In some embodiments, a lauroyl and/or myristoyl transferase polynucleotide encodes a lauroyl and/or myristoyl transferase polypeptide. An exemplary lauroyl and/or myristoyl transferase polynucleotide sequence to be modified is provided at GenBank Accession No. CP016347 (REGION: 198524 . . . 199474), which is reproduced below:

    TABLE-US-00002 (SEQIDNO:4) 1ttatctgtagcgaatgccttttggcacgttttcatcctgcatggttttgtagcgcttatg 61cagccacatccattgttcaggagcgcgtaagatgacttcttccacgtatttgttcatgta 121cgctgcggcggcaacttcgtctttttgcggataatcggcttcaatgcatttatctgcaat 181gatttcatacttgccctgctcattacggaagcctgaacccggaacaatggcacacttcga 241tgtataagccagaatgcttgtacctgtggtggtacacgcatcttctactgcgaagaatgg 301tacatacaccgatttgttgcgtccgtaatcgtggtcaggtaggtagaacagacgttcacc 361actacgcagcacgcgaatcatctttttcacgtctttacggtcaatcagtttgttgccgtt 421atgggtgcggccccagtactgaataaaattgtaagctgggttgtcatgtggacgaaacgc 481gccgtaacccgcaagtcccatgactgcaaaagcacgtgcggtaatttcaaggttcaatgc 541atgcacacagcagagtaggacgccttttccttcttgcgccttttctttcagagcaccaac 601atctttttccactagcagcgttttaaagcgccaagttggccagaaccaggtaatgccggt 661ttcgatcagtgccatgccggtgtttttgaagttttcggtaacgatatgttcgatgtcttc 721ttgagacttgtccggaaaagccaactcaaggttacgctttgcgacgtgtactcgtttttt 781accataacgcatgccgagcttacccaccgattggcccaacgacagaagcaagcggtaagg 841aagaatattaacgatgatcgccagtagaccaaaccctatccataccccccagttacgtgg 901atggagaagggaaagagaaaactctggctgcatttgtttgtctttactcat

    [0072] In some embodiments, a lauroyl and/or myristoyl acyltransferase polypeptide to be modified has at least 85% amino acid sequence identity to GenBank Accession No. ANQ17067 or a fragment thereof having lauroyl and/or myristoyl transferase activity. An exemplary lauroyl and/or myristoyl acyltransferase amino acid sequence follows:

    TABLE-US-00003 (SEQIDNO:5) 1mnkqkepvfearflmprywgtlliigvmyllsllpfkfqlflgrnigrlamrlmkkrqvt 61irrnlelcfpkmdeskreailkanidnsgialfetamawfwsdrrvnkhvtikgmehlea 121lerdgkgvlmlavhsmnlelgarafgiqksgmgvyrpnnnpcfdyfqykgrsrsnrtlid 181rknvrgmldaInsgnrvwyapdhdygtrrstfaplfavknactttgtsllvdatdcaivp 241ftmvrgddghytltirkpvdgfpkgdtrnaaifinkiveesimaspsqymwlhrrfktrp 301qgedclynpqlipams

    [0073] In some embodiments, a lauroyl and/or myristoyl transferase polynucleotide encodes a lauroyl and/or myristoyl transferase polypeptide. An exemplary lauroyl and/or myristoyl transferase polynucleotide sequence to be modified is provided at GenBank Accession No. CP016347 (REGION: 1624028 . . . 1624978), which is reproduced below:

    TABLE-US-00004 (SEQIDNO:6) 1atgaacaaacaaaaagagcctgttttcgaggctcggttcctaatgcctcggtactgggga 61actctactcatcatcggggtgatgtatttacttagtcttcttcctttcaaatttcagtta 121ttcctgggacgtaacattggccgtttggccatgcgattaatgaaaaagcgtcaggtcacc 181attcgtcgcaatttagagctctgtttcccgaagatggacgagagcaaacgagaagcgata 241ctgaaggccaacatcgataattctggcattgcactgtttgagacagcgatggcttggttc 301tggtcggatcgcagggttaataaacacgtaacgataaaagggatggaacacctagaagcg 361ttagaaagggacggtaaaggggtgctgatgcttgccgttcattccatgaacttagagctg 421ggtgcacgtgcatttggcattcaaaaatctggaatgggtgtttatcgaccgaataacaac 481ccttgttttgactattttcagtacaagggtcgttcgcgttccaatcgtactttgatcgat 541cgtaaaaatgttagaggaatgctggatgctttgaattcaggcaatcgcgtttggtatgcg 601cctgaccatgattatggaaccagaagatcgacctttgcgcctttgtttgctgtcaaaaac 661gcctgtaccacaacaggcaccagtttacttgtcgatgctacagattgtgccattgtgccg 721tttaccatggtaagaggggatgatggccattacacattaacgatcaggaagccagttgat 781ggatttcctaaaggtgatacccgaaacgcggcgatttttatcaataaaattgttgaagag 841tcgattatggccagccctagtcaatacatgtggttacaccgccggtttaaaaccagaccg 901caaggtgaagattgtttgtacaatcctcagttaatcccagcgatgagttag

    [0074] In some embodiments, a D-arabinose 5-phosphate isomerase (KdsD/yrbH) polypeptide to be modified has at least 85% amino acid sequence identity to GenBank Accession No. ANQ18079 or a fragment thereof having isomerase activity. An exemplary KdsD amino acid sequence follows:

    TABLE-US-00005 (SEQIDNO:7) 1msrqfdfraaakqvldievaalqeldkyfddqfegacemilsnsgkvvimgmgksghign 61kiaatlastgtsaffvhpgeashgdlgmisagdiviaisnsgesheilslfpvlkrlnik 121iismtgkpesnmaqlsdlhlqitvpqeacplglaptssttatlvmgdalavallqargfs 181aedfalshpggalgrklllklsdimhfgnalpkvspdslirdalleisekglgmtaivde 241hdamlgiftdgdlrrtldkridihttaigevmtqspttahpdmlaveglnlmqskninal 301ilcnngkvvgalnmhdllkagvm

    [0075] In some embodiments, a D-arabinose 5-phosphate isomerase (KdsD/yrbH) polynucleotide encodes a KdsD polypeptide. An exemplary KdsD polynucleotide sequence to be modified is provided at GenBank Accession No. CP016347 (REGION: 2865123 . . . 2866094), which is reproduced below:

    TABLE-US-00006 (SEQIDNO:8) 1atgtcccgtcaatttgattttcgcgctgctgcaaagcaagttcttgatattgaagttgcc 61gctctgcaagagctggataaatactttgatgaccaatttgaacaagcttgcgaaatgata 121ctttccaatagcggaaaagtggtcatcatgggcatgggcaaatcaggccacattggaaat 181aaaattgcggcgacgcttgcaagtacagggacttcggcgttttttgttcatccgggtgaa 241gcttcacatggtgacttaggtatgatcagcgccggagacattgtgattgccatttcaaac 301tctggcgaatcccatgagatcctgtcgctgttcccggtattgaaacgcttaaacatcaag 361atcatcagcatgacgggcaagccagaatcgaacatggcgcaactgtcagatttgcactta 421cagatcacggtaccacaagaagcctgccctcttggtttggcaccaaccagcagtacaaca 481gcaacgttagtcatgggcgatgccttggcggttgcgctgcttcaggctcgtggattctcc 541gctgaagatttcgcgctgtcacaccccggtggtgcactaggaagaaaactgctgcttaag 601ttgtctgatattatgcattttggaaatgctctgccgaaagtctctcctgattcgctgatt 661cgcgacgcacttctggagatttctgaaaaaggactggggatgaccgccattgtcgatgag 721cacgatgctatgcttggtatattcactgatggcgacttacgcagaactttagacaagcgt 781attgatattcatacaaccgccattggcgaagtgatgacgcaaagcccaacaactgcgcat 841ccagacatgcttgcagttgaaggtctcaacctaatgcaaagcaaaaatatcaatgcgctg 901attttatgtaataacggtaaagtggtcggtgcacttaatatgcatgatttactaaaagcg 961ggtgtgatgtaa

    [0076] Endotoxin refers to complex lipopolysaccharide (LPS) substances present in the outer membranes of gram-negative organisms such as E. coli. Vibrio spp., and others. These substances are collectively called endotoxin and are toxic to mammals and other vertebrates. Endotoxin can be released when cells are disrupted or otherwise disintegrate. Thus, when these organisms are used to clone nucleic acids, vectors, plasmids or produce proteins, polypeptides, or peptides or other biomolecules the products can be contaminated with unacceptable levels of endotoxin. The engineered or genetically-modified cells (e.g., bacterial cells such as Escherichia spp., Vibrio spp. organisms) described herein are substantially lower in an in vitro endotoxin assay compared to a natural, unmodified, or wild type organism under the same conditions, i.e. the recombinant organisms produce or contain substantially less endotoxin or LPS substances, or are substantially less endotoxic to humans and other mammals (e.g., canines, felines, equines, bovines, or porcines). By substantially less endotoxin or less endotoxic is meant that the organism can have less than 50% or less than 40% or less than 30% or less than 20% or less than 10% or less than 5% or less than 3% or less than 2% or less than 1% or less than 0.90% or less than 0.50% or less than 0.10% of the endotoxin content compared to a corresponding unmodified or wild type bacterial cells (e.g., Escherichia spp., Vibrio spp. organisms) (or one that does not have the genetic modification to API, lpxL, and/or lpxM) cultivated and measured under the same conditions. The endotoxin content or concentration, or the endotoxicity of the compared organisms can be measured using any generally accepted in vitro endotoxin assay, such as any of those accepted in the field as being a valid endotoxin assay, e.g., the HEKTm-Blue LPS assay, which can measure the activation of the TLR4 receptor to an endotoxin sample from an organism.

    [0077] The engineered or genetically modified cells described herein can also produce an endotoxin concentration of less than 50% or less than 40% or less than 30% or less than 20% or less than 10% or less than 5% or less than 1% or less than 0.50% or less than 0.10% of the endotoxin concentration produced by an unmodified or wild type E. coli organism (or one that does not have a genetic modification to an LPS biosynthesis gene such as API, lpxL, and/or lpxM) cultivated under corresponding conditions. In some embodiments BL21(DE3) can be used as the unmodified or wild type E. coli. The endotoxin concentration or level can be determined using any generally accepted LPS or endotoxin assay, such as an in vitro LPS or endotoxin assay accepted in the field.

    [0078] The engineered or genetically modified cells described herein can also produce an endotoxin-induced immune response of less than 50%, or less than 40%, or less than 30%, or less than 20%, or less than 10%, or less than 5%, or less than 1%, or less than 0.50%, or less than 0.10% of the response of an E. coli organism comprising a deletion of gutQ, kdsD, lpxL, lpxM, pagP, lpxP, and eptA, or any sub-combination of them produced under the same or corresponding conditions. The compared E. coli organism can also comprise a compensating mutation in the msbA gene (e.g., msbA148) (E. coli cells having all of the above deletions and the msbA mutation are commercially available under the trademark name ClearColi). The endotoxin-induced immune response (or endotoxicity) can be determined or measured using an in vitro LPS or endotoxin assay. The immune response or endotoxicity can be relative to, or with respect to, the immune response in a human or other mammalian cell, and can measure activation of the TLR4 receptor. [The engineered or genetically-modified cells described herein can also have or produce less endotoxin (in the lower amounts stated herein and above) than the aforementioned E. coli organisms (e.g., the ClearColi organism), which endotoxin amount can be measured using an endotoxin-induced immune response.]

    [0079] The engineered or genetically modified cells described herein can have an average endotoxin level for purified LPS molecules of less than 50 EU/ml, or less than 25 EU/ml, or less than 15 EU/ml, or less than 10 EU/ml, or less than 5 EU/ml, or less than 5 EU/ml, or less than 4 EU/ml, or less than 3 EU/ml, or less than 2 EU/ml, or less than 1 EU/ml, or less than 0.80 EU/ml, or less than 0.70 EU/ml, or less than 0.50 EU/ml, or less than 0.30 EU/ml, or less than 0.20 EU/ml, or less than 0.10 EU/ml, as measured in an in vitro endotoxin assay. The endotoxin level can be measured according to any generally accepted method. Any of the cells described herein can also have the stated endotoxin levels disclosed herein within plus or minus 10% of the stated value.

    Essential Genes

    [0080] Disclosed herein are cells comprising a genetic modification that results in elimination or reduced expression of a polypeptide encoded by an essential gene, the absence of which is detrimental to the growth of the cell, as compared to an otherwise comparable cell lacking the genetic modification that results in elimination or reduced expression of the polypeptide encoded by said essential gene. In some embodiments, the genetic modification comprises disabling, reducing, or knocking out one or more essential genes required for cell growth and/or survival. Any essential gene can be disabled, reduced, or knocked out. For example, enzymes that are required for metabolizing specific nutrients or synthesizing specific nutrients (e.g., an amino acid, sugar, or other nutrient) can be disabled and the resulting cells will only grow and/or survive if that nutrient is provided. Other essential genes include, but are not limited to, DNA synthesis genes (such as thy A), cell wall synthesis genes (such as dapA), and amino acid genes (such as serA and metA). In some embodiments, a reduction or elimination of polypeptide encoded by the essential gene can be cured by introduction of the polypeptide delivered exogenously, either directly or indirectly in order to reestablish cell survival in the presence of the polypeptide. For example, a plasmid encoding a copy of the essential gene or functional equivalent or functional variant thereof can be introduced in order to facilitate cell survival. The exogenous copy of the essential gene or functional equivalent or functional variant thereof can then be used as a marker for cell transformation.

    [0081] Examples of other essential genes that can be disabled, reduced, or knocked out in a genetically modified bacteria of the present disclosure include, but are not limited to yhbV, yagG, hemB, secD, secF, ribD, ribE, thiL, dxs, ispA, dnaX, adk, hemH, lpxH, cysS, fold, rplT, infC, thrS, nadE, gapA, yeaZ, aspS, argS, pgsA, yefM, metG, folE, vejM, gyrA, nrdA, nrdB, folC, accD, fabB, gltX, ligA, zipA, dapE, dapA, der, hisS, ispG, suhB, tadA, acpS, era, me, ftsB, eno, pyrG, chpR, lgt, fbaA, pgk, vqgD, metK, vqgF, plsC, ygiT, pare, ribB, cca, ygjD, tdcF, yraL, vihA, ftsN, murl, murB, birA, secE, nusG, rplJ, rplL, rpoB, rpoC, ubiA, plsB, lexA, dnaB, ssb, alsK, groS, psd, om, yjeE, rpsR, chpS, ppa, valS, yjgP, yjgQ, dnaC, ribF, IspA, ispH, dapB, folA, imp, yabQ, ftsL, ftsl, murE, murF, mraY, murD, ftsW, murG, murC, ftsQ, ftsA, ftsZ, lpxC, secM, secA, can, folK, hemL, yadR, dapD, map, rpsB, infB, nusA, ftsH, obgE, rpmA, rplU, ispB, murA, vrbB, yrbK, yhbN, rpsl, rplM, degS, mreD, mreC, mreB, accB, accC, yrdC, def, fmt, rplQ, rpoA, rpsD, rpsK, rpsM, entD, mrdB, mrdA, nadD, hlepB, rpoE, pssA, yfiO, rplS, trmD, rpsP, ffh, grpE, vfjB, csrA, ispF, ispD, rplW, rplD, rplC, rpsJ, fusA, rpsG, rpsL, trpS, yrfF, asd, rpoH, ftsX, ftsE, ftsY, frr, dxr, ispU, rfaK, kdtA, coaD, rpmB, dfp, dut, gmk, spot, gyrB, dnaN, dnaA, rpmH, mpA, vidC, tnaB, glmS, glmU, wzyE, hemD, hemC, vigP, ubiB, ubiD, hemG, secY, rplO, rpmD, rpsE, rplR, rplF, rpsH, rpsN, rplE, rplX, rplN, rpsQ, rpmC, rplP, rpsC, rplV, rpsS, rplB, cdsA, yaeL, yaeT, lpxD, fabZ, lpxA, lpxB, dnaE, accA, tilS, proS, yafF, tsf, pyrH, olA, rlpB, leuS, Int, glnS, fldA, cydA, infA, cydC, ftsK, lolA, serS, rpsA, msbA, lpxK, kdsB, mukF, mukE, mukB, asnS, fab A, mviN, me, yceQ, fabD, fabG, acpP, tmk, holB, lolC, lolD, lolE, purB, ymffC, minE, mind, pth, rsA, ispE, lolB, hemA, prfA, prmC, kdsA, topA, ribA, fabl, racR, dicA, ydfB, tyrS, ribC, ydiL, pheT, pheS, yhhQ, bcsB, glyQ, vibJ, and gpsA,

    [0082] In some embodiments, an essential gene as described herein is itself modified to eliminate or reduce the expression of the polypeptide encoded by an essential gene. In some embodiments, a non-coding portion of essential gene as described herein is modified to eliminate or reduce the expression of the polypeptide encoded by an essential gene, such as a promotor, a polyadenylation site, a 5 untranslated region, or a 3 untranslated region. In some embodiments, an upstream or downstream gene that affects expression of the polypeptide encoded by an essential gene as described herein is modified to eliminate or reduce the expression of the polypeptide encoded by an essential gene.

    [0083] In some embodiments, the genetically-modified bacterial cells having a genetic modification to an essential gene where the essential gene is an endogenous DNA strand exchange gene. In some embodiments, the endogenous DNA strand exchange gene has a polynucleotide sequence of:

    TABLE-US-00007 (SEQIDNO:1) atgaataaatcggagaaagtaatggacgagaacaaacagaaagcgctcgc cgctgcgctaggtcaaattgaaaaacaattcggtaaaggctcaatcatgc gccttggcgataaccgcgcaatggacgtagaaaccatctcaacgggttct ctttctcttgatatcgctttgggtgctggtggcttaccgatgggccgtat tgttgaagtatacggtccggaatcttcgggtaaaacgacactaactcttg aacttattgcagcagcacagcgtgaaggcaaaacttgtgcgtttatcgat gcggagcacgctctggatcctgtatacgcgaagaagcttggcgtagatat cgatgcacttttggtttctcagcctgatacgggtgagcaagcgctagaaa tctgtgacgcattagcgcgctctggtgctatcgacgtaatggttgtcgac tctgtggcagcactgactccaaaagcagaaatcgaaggcgaaatgggcga cagccacatgggtctccaagctcgtatgctttctcaagcgatgcgtaagc taacaggtaacctgaagcagtctaactgtatgtgtatcttcatcaaccaa atccgtatgaagattggtgtgatgttcggtaacccagaaacaacaactgg cggtaacgcacttaaattctacgcatcggttcgtcttgatatccgtcgta ctggcgcaatcaaagaaggcgacgaagttgtaggtaacgaaactcgcatc aaagtcgttaagaacaagattgcagcaccatttaaagaagcaaacacgca gatcatgtatggtcaaggctttaaccgcgaaggtgagctggtagacttag gcgtgaagcacaaactggttgaaaaagcaggtgcttggtacagctacaat ggcgacaagatcggtcagggcaaagcaaatgcttgtaattacctgcgtga acatacagaagttgctcagactatcgacaagaaacttcgtgagatgcttt tgtctccagctgtagctgagggacctgaagccggtgaaatgccagagaag aaagaagaagagttttaa

    [0084] In some embodiments, the genetically-modified bacterial cells having a genetic modification to an essential gene where the essential gene is an endogenous DNA strand exchange gene. In some embodiments, the endogenous DNA strand exchange gene has a polynucleotide sequence of:

    TABLE-US-00008 (SEQIDNO:2) atgaaatacctgttctctttattcattcttgcactatccagtgccgccgt ggccgcgccaccaagttcattttcagccgctaagcgcgaagcggtaaaaa tctatcaagatcatcccaccagcttttattgcggctgtgatattcaatgg caaggcaagaaaggcttacctgatctttcctcttgtggttaccaggttcg caaacaagaaaagcgtgcttcacgcatcgagtgggaacatgtcgttccag cttggcaatttgggcaccagctgcaatgctggcaaagcggtggtcgtaaa aactgctcgcgtaatgacaaaacattccgctcaatggaagccgatctgca caacctgactcctgcgattggtgaggtaaatggtgatcgctctaactaca atttcagtcagtggaatgggatcgatggcgcaacctatggtcgttgtgaa gtccaggtaaacttcaagcaacgcaaagtcatgccacccgatcgagcacg cggctccatcgctcgtacctatctttatatgagcaaggagtacggcttca aactgtccaagcaacaaactcagttaatgagtgcatggaacaaaacctac ccagccgataaatgggaatgcgaacgcgataagcgcattgccaaagtaca aggcaaccataatccattcgttcaagaggcctgtcgcgcactgtaa.

    [0085] One central biosynthesis pathway relates to nicotinamide adenine dinucleotide (NAD) biosynthesis. NAD is a coenzyme central to metabolism. Found in all living cells, NAD is called a dinucleotide because it consists of two nucleotides joined through their phosphate groups. One nucleotide contains an adenine nucleobase and the other nicotinamide. NAD exists in two forms: an oxidized and reduced form, abbreviated as NAD+ and NADH (H for hydrogen), respectively.

    [0086] In metabolism, nicotinamide adenine dinucleotide is involved in redox reactions, carrying electrons from one reaction to another. The cofactor is, therefore, found in two forms in cells; NAD+ is an oxidizing agent-it accepts electrons from other molecules and becomes reduced. This reaction, also with H+, forms NADH, which can then be used as a reducing agent to donate electrons. These electron transfer reactions are the main function of NAD. However, it is also used in other cellular processes, most notably as a substrate of enzymes in adding or removing chemical groups to or from, respectively, proteins, in posttranslational modifications.

    [0087] In organisms, NAD can be synthesized from simple building-blocks (de novo) from either tryptophan or aspartic acid. As a general rule, most prokaryotes utilize the aspartate de novo pathway, in which the nicotinate moiety of NAD is synthesized from aspartate. Briefly, aspartic acid is converted to iminoaspartic acid by nadB, which is then converted to Quinolinic acid by nadA. Quinolinic acid is then converted to nicotinic acid mononucleotide by nadC, which is then converted to nicotinic acid adenine dinucleotide by nadD. Lastly, nicotinic acid adenine dinucleotide is converted to nicotinamide adenine dinucleotide (NAD) by either nadE1 or nadE2 through either an amine dependent or glutamine dependent pathway.

    [0088] In some embodiments, a genetically-modified cell of the present disclosure can comprise a genetic modification that results elimination or reduction in expression of a polypeptide encoded by any one or more of the genes associated with the NAD biosynthesis pathway, including nadA, nadB, nadC, nadD, nadE1, and nadE2.

    [0089] In some embodiments, a nicotinamide adenine dinucleotide synthetase (NadE) polypeptide to be modified has at least 85% amino acid sequence identity to GenBank Accession No. UUI14161.1 or a fragment thereof having synthetase activity. An exemplary NadE amino acid sequence follows:

    TABLE-US-00009 (SEQIDNO:9) 1 mkklhisscslnqtpmdwsgnlhniqkaikiahqagaellitpelcisgygcedffhsph 61 vseralksvsdltqsipnsmavsvglpvminnrvyngvalvthegiqgislkrnlaangl 121 hyeqrwftpwtrdknatvvlkegtppvrvgnlvysvngvkvgfeicedawvadrtserff 181 nqgvevianpsashfsigksltrkrlveessrvysacyvysnlsgcesgraiydagvmia 241 vdgslvakgerfhmsdvevvtadidlsrsrigqinssqryyeehdfdteavvkvtlsksl 301 sspklhvpplnqpwedseyleheealraiaiglrdwirkthtggyalslsggadsalvas 361 avytsvilelwelvtktekddecslpdhlsqflsedqrskfkqagssnkleqfvrdtasa 421 imanmlttayqasansgsvtrtaaqkvaesfgakflnlsvaevvknyesmiskatnleln 481 wndhdialqniqarvrspsiwfianlenklllttsnmsegavgyctmdgdssgvlapisg 541 vtksrilkllvwleqkgfyctgnhimklealsyinnqrptaelrpeeqsdeedlmpydvl 601 drmvfltleagmsprdifdamteefervdnqtmatyivkffkllfrnqwkrdrqapgfhi 661 elnsldpktykrfpllssgyqeelafiedncwmkds

    [0090] In some embodiments, a nicotinamide adenine dinucleotide synthetase (NadE) polynucleotide encodes a NadE polypeptide. An exemplary NadE polynucleotide sequence to be modified is provided at GenBank Accession No. CP101906.1, which is reproduced below:

    TABLE-US-00010 (SEQIDNO:10) 1 gtgaagaaactgcatattagctcatgctcactaaaccagactccaatggattggagtgga 61 aacctgcataacattcaaaaagcaatcaagattgcacatcaagctggagccgaactgctt 121 attacgccagagttgtgtatttctggttatggctgtgaagattttttccatagtcctcat 181 gtctctgagcgcgcactgaaaagtgtctctgacctaacgcagtcgattcccaatagcatg 241 gcggtatctgttggcttacccgtgatgattaacaatcgggtttacaacggtgttgcgctg 301 gttacgcatgaaggaattcaaggcatctctctaaagcggaatttagctgcgaatggcctt 361 cattatgagcaacgttggtttacgccatggactcgagataaaaacgcgacggtggtactc 421 aaagaagggacaccacctgtgcgtgttggcaatctggtttacagcgttaacggtgtcaaa 481 gttggctttgaaatctgcgaggatgcctgggttgccgaccgcacttcagaacgtttcttc 541 aaccaaggtgttgaagtgattgctaacccaagtgctagtcacttttcgataggtaaatct 601 ctcactcgtaagcggctggtggaagagtcaagccgcgtatattcggcctgttatgtgtat 661 tccaatctatcagggtgtgaatctggccgggcaatttatgatgctggcgtgatgattgcg 721 gttgatggcagtttggttgccaaaggcgaacgttttcacatgagtgatgtggaggttgta 781 acggccgatatcgacttatcccgcagcaggattggccaaatcaatagtagtcaacgctat 841 tatgaggaacatgactttgatacagaggctgtcgtcaaagtaacgctcagtaaatctctt 901 agctctcccaagttgcatgtaccgccgctaaatcagccttgggaagatagtgaatatttg 961 gaacatgaagaagctttgcgtgcgatagcaataggtttacgtgattggcttcgaaaaacg 1021 cacactggtggctacgcgctttcattaagtggcggagcagactctgctttggtcgctagt 1081 gctgtttatacatccgttatcctggaactttgggagctggttaccaaaacagagaaagat 1141 gacgagtgttcactaccagaccatttgagtcaatttttgagcgaagatcaaaggagtaaa 1201 ttcaaacaggcggggtcctcaaacaaactagagcaattcgtcagggatacggcatcagca 1261 ataatggcgaacatgctgacaactgcgtatcaggccagcgcgaacagcggttccgttact 1321 cgtactgctgcgcaaaaagtagcggagtcatttggtgcgaaatttctaaacctcagtgtt 1381 gccgaggtggtgaagaattacgagtcgatgatatcaaaagcaaccaatctagagctcaat 1441 tggaatgatcatgatattgcgctgcaaaatattcaggcacgtgtgcgctctccaagtatt 1501 tggttcatcgctaatctggaaaataaactgctgctgacaacgagcaacatgtcggaaggg 1561 gcggtaggttactgcacaatggatggtgattcttccggagtcctcgcacctatttccggt 1621 gtcactaaaagccgaattctcaagttactggtatggctagagcaaaaagggttttattgc 1681 actggtaatcacatcatgaagctagaagcgctttcttatatcaataatcaacgtccaacg 1741 gcggagttgcgccccgaagaacaaagtgatgaagaggatttgatgccttatgatgtgctc 1801 gatcgtatggtttttttgaccttagaagccggtatgtcaccaagggatatttttgatgcg 1861 atgacggaagaatttgaacgcgtagacaaccaaaccatggccacatatatcgtcaaattt 1921 tttaagttgctgtttcgcaatcaatggaaacgcgatcgtcaggctccggggtttcatatc 1981 gaactcaatagcctggatccgaaaacctataaacgttttccgcttctaagctctggatac 2041 caagaggagctagccttcatcgaggataattgctggatgaaagacagctag

    Methylase Enzymes

    [0091] In some embodiments, a genetically-modified cell can comprise a genetic modification that results in reduced methylation of DNA. When DNA polymerase makes an error resulting in a mismatched base-pair or a small insertion or deletion during DNA synthesis, the cell will repair the DNA by a pathway called mismatch repair. However, the cell must be able to differentiate between the template strand and the newly synthesized strand. In some bacteria, DNA strands are methylated by Dam methylase, and therefore, immediately after replication, the DNA will be hemimethylated. A repair enzyme, MutS, binds to mismatches in DNA and recruits MutL, which subsequently activates the endonuclease MutH. MutH binds hemimethylated GATC sites and when activated will selectively cleave the unmethylated daughter strand, allowing helicase and exonucleases to excise the nascent strand in the region surrounding the mismatch. The strand is then re-synthesized by DNA polymerase III.

    [0092] Genetically-modified cells and expression systems containing the same are described herein that include a genetically modified methylase enzyme (e.g., with reduced or disabled activity), as well as uses thereof. In some embodiments, the engineered or genetically modified methylase enzyme is disabled, which thereby disables the mismatch repair pathway. The disabled methylase enzyme can allow for efficient gene editing compared to a comparable cell with a native methylase enzyme present. In other words, a gene edit in a cell with a disabled methylase may persist longer in the cell without being repaired by a mismatch repair pathway compared to a cell comprising a native methylase enzyme.

    [0093] In some embodiments, a gene encoding a methylase as described herein is itself modified to eliminate or reduce the expression of the methylase. In some embodiments, a non-coding portion of a gene encoding a methylase as described herein is modified to eliminate or reduce the expression of the methylase, such as a promotor, a polyadenylation site, a 5 untranslated region, or a 3 untranslated region. In some embodiments, an upstream or downstream gene that affects expression of the methylase as described herein is modified to eliminate or reduce the methylase.

    [0094] In some embodiments, a genetically modified methylase enzyme comprises a modified adenine methylase enzyme or modified cytosine methylase enzyme. In some embodiments, a modified methylase enzyme comprises a modified Class I methylase, or a modified class II methylase. In other embodiments, a modified methylase can comprise a modified histone methylase, a modified N-terminal methylase, a modified DNA adenine methylase (Dam), a modified RNA methylase, a modified natural product methylase, a modified non-S-adenosyl methionine (SAM) dependent methylase, or a modified radical SAM methylase. In some embodiments, the modified methylase is an RNA methylase.

    [0095] In some embodiments, a DNA adenine methylase (Dam) polypeptide to be modified has at least 85% amino acid sequence identity to GenBank Accession No. ANQ18149.1 or a fragment thereof having methylase activity. An exemplary DNA adenine methylase amino acid sequence follows:

    TABLE-US-00011 (SEQIDNO:11) 1 mkkqraflkwaggkyglvediqrhlpparklvepfvgagsvflntdydqylladinpdli 61 nlynlikarpeeyiseakrwfvaennrkeaylsiraefnktddvmyrslaflymnrfgfn 121 glcrynkkggfnvpfgsykkpyfpeaeleffaekakkatfvcegypetfrrarkgsvvyc 181 dppyaplsntanftsyagngftlddqaaladiaertatergipvlisnhdttltrrlyhg 241 adlsvvkvkrtisrngsgrnkvdellalfntpdsdsaas

    [0096] In some embodiments, a DNA adenine methylase (Dam) polynucleotide encodes a DNA adenine methylase polypeptide. An exemplary DNA adenine methylase polynucleotide sequence to be modified is provided at GenBank Accession No. CP016347.1, which is reproduced below:

    TABLE-US-00012 (SEQIDNO:12) 1 ctatgaagcagcgctgtctgaatcaggggtattaaaaagcgccagcagttcatcaacttt 61 atttcgaccactgccattacggctgatggtgcgcttcacttttaccacgctcaaatccgc 121 tccgtggtataaacgacgcgttaatgttgtatcgtggtttgaaatcagtaccggaatgcc 181 gcgttcagtggcggttctttccgcgatatcggccagtgccgcctgatcatcgagcgtaaa 241 cccatttcctgcataagaggtgaagtttgcggtatttgaaagcggcgcatacggtggatc 301 gcagtaaacaacactgcctttacgcgcacggcgaaacgtctcgggatagccttcacaaac 361 aaacgtggctttcttggctttttctgcaaagaactccagttcagcttcagggaaatacgg 421 tttcttgtatgacccaaacgggacattgaaaccgccttttttgttgtaacggcacaggcc 481 attaaaaccaaaacggttcatgtaaagaaaagcaagtgagcgatacatcacgtcgtcagt 541 cttgttgaactcagcgcgaatactcagataagcttctttgcggttattttcggccacgaa 601 ccagcgcttcgcctcagagatatattcctccggacgcgctttaataaggttatacagatt 661 gatcaaatccgggttgatatcagccagtaaatactgatcgtaatctgtattcaaaaaaac 721 agagccagcgccaacaaaaggttcaactagctttcgagccggtggtaaatgacgttggat 781 gtcttcaaccagtccgtattttcctcctgcccattttagaaaggctcgttgctttttcat

    Deoxyribonucleases

    [0097] In some embodiments, a genetically-modified bacteria cell can comprise a genetic modification that results in results in less phosphodiester cleavage of DNA, relative to an otherwise comparable cell that does not comprise said genetic modification that results in less phosphodiester cleavage of DNA. In some embodiments, the genetic modification that results in less phosphodiester cleavage of DNA comprises a modification to a Deoxyribonuclease (Dns) enzyme. DNS is an enzyme that catalyzes the hydrolytic cleavage of phosphodiester linkages in the DNA backbone, thus degrading DNA. A wide variety of deoxyribonucleases are known, which differ in their substrate specificities, chemical mechanisms, and biological functions.

    [0098] Some DNases cut, or cleave, only residues at the ends of DNA molecules (exodeoxyribonucleases, a type of exonuclease). Others cleave anywhere along the chain (endodeoxyribonucleases, a subset of endonucleases). Some Dnses are fairly indiscriminate about the DNA sequence at which they cut, while others, including restriction enzymes, are very sequence-specific. Some cleave only double-stranded DNA; others are specific for single-stranded molecules; and still others are active toward both.

    [0099] In some embodiments, a genetically-modified cell can comprise a genetic modification that results in reduction or elimination of a polypeptide encoded by one or more deoxyribonuclease genes. In some embodiments, the one or more disabled Dns genes are replaced by one or more catalase genes.

    [0100] In some embodiments, a gene encoding a methylase as described herein is itself modified to eliminate or reduce the expression of a deoxyribonuclease gene described herein. In some embodiments, a non-coding portion of the deoxyribonuclease gene as described herein is modified to eliminate or reduce the expression of the deoxyribonuclease gene as described herein, such as a promotor, a polyadenylation site, a 5 untranslated region, or a 3 untranslated region. In some embodiments, an upstream or downstream gene that affects expression of the deoxyribonuclease gene as described herein is modified to eliminate or reduce expression of the deoxyribonuclease gene.

    [0101] In some embodiments, a catalase polypeptide to be added has at least 85% amino acid sequence identity to GenBank Accession No. EPM39386.1 or a fragment thereof having catalase activity. An exemplary catalase amino acid sequence follows:

    TABLE-US-00013 (SEQIDNO:13) 1 mailqigaggvgwvvahkaaqnndvlgditiasrtvgkcekiiesiqkknnlkdstkkle 61 aravnaddvdslvalikevkpdlvinagppwvnmpimeacyqakvsyldtsvavdlcseg 121 qqvpqaydwqwgyrekfeeagitgilgagfdpgvvsvfaayavkhlfdeidtidvmdvna 181 gdhgkkfatnfdpetnmleiqgdsfywengewkqvpchsrmlefefpncgshkvysmahd 241 evrsmkefipakriefwmgfgdrylnyfnvmrdigllspdpltlhdgtvvqplhvlkall 301 pdptslapgytgltcigtwvqgkkdgkersvfiynnadhevayedvehqaisyttgvpai 361 taalqffrgewadkgvfnmeqlnpdpfletmpsigldwhvqeleagqglpvihelkk

    [0102] In some embodiments, a catalase polynucleotide encodes a catalase polypeptide. An exemplary catalase polynucleotide sequence to be added is provided at GenBank Accession No. ATFJ01000037.1, which is reproduced below:

    TABLE-US-00014 (SEQIDNO:14) 1 ttactttttaagttcgtggataactggaagtccctgacctgcttcaagctcttgaacatg 61 ccaatccagaccgatagaaggcatggtttccaggaacggatctgggtttagctgttccat 121 attgaacacacctttatccgcccactcgccacggaagaattgcagtgccgcagtgatcgc 181 tggtacacctgtggtgtaagagatcgcctggtgctctacgtcttcgtatgccacttcgtg 241 gtcagcattgttatagatgaagacactgcgctctttaccgtctttcttaccttgaaccca 301 agtaccgatacacgttagaccggtgtagcctggtgcaagagaagttggatctggtagtag 361 cgctttcaatacgtgcagaggctgtactactgtaccatcgtgcagcgttagtggatctgg 421 gctcaataggccgatatcacgcattacattgaagtagtttaggtaacggtcaccgaaacc 481 catccagaattcaatgcgttttgcagggatgaattccttcattgaacgaacttcatcgtg 541 cgccattgagtacactttgtgtgaaccacagttagggaattcaaactcaagcatacgaga 601 gtgacaaggtacttgtttccactcgccattttcccagtagaaagagtcgccttggatctc 661 tagcatgttggtttctgggtcgaagtttgtcgcaaacttcttaccgtggtcaccagcgtt 721 tacgtccattacgtcgatagtatcgatttcatcgaacagatgcttaactgcgtacgctgc 781 aaataccgatactacgcctggatcgaaaccagcacctaggatacctgtgatgcccgcttc 841 ttcgaacttctcacggtaaccccactgccaatcataagcctgaggtacttgctgaccttc 901 agaacacaggtcaactgccactgatgtatccaggtatgacactttcgcttggtaacatgc 961 ttccatgattggcatgtttacccatggaggaccagcgttgatcacaagatcaggcttcac 1021 ttctttaataagagcaacaagagaatctacgtcgtcagcattaactgctctagcttctaa 1081 tttcttagttgaatctttcaggttgtttttcttctgaatagattcgatgattttctcaca 1141 cttacctacggtacgtgatgcgattgtgatatcacccagaacgtcgttgttttgtgctgc 1201 tttgtgtgcaactacccagccaacgccgcctgcaccaatctgtagaattgccat

    [0103] In some embodiments, a deoxyribonuclease (Dns) polypeptide to be modified has at least 85% amino acid sequence identity to GenBank Accession No. ANQ17872.1 or a fragment thereof having nuclease activity. An exemplary deoxyribonuclease amino acid sequence follows:

    TABLE-US-00015 (SEQIDNO:15) 1 mklfdthchfdfdvfqddfehnlalaqeqgvsrilipsvgpsnwsriqtlaekyshlyya 61 lgfhpyfleenfeqhlaelehylkqkppqcvaigecgldfaidvdpqlqekvletqfela 121 rrfdlpvilhsrkahnrlvqmvkaaklpkggvvhafagsyqqamewvrlgffigvggtit 181 ypraqktrdaiqklalenllietdapdmpilgyqgqpnhpaklihvlnvlvelrrgekqs 241 iasqlwknsnfafsice

    [0104] In some embodiments, a deoxyribonuclease (Dns) polynucleotide encodes a deoxyribonuclease polypeptide. An exemplary deoxyribonuclease polynucleotide sequence to be modified is provided at GenBank Accession No. CP016347.1, which is reproduced below:

    TABLE-US-00016 (SEQIDNO:16) 1 ctattcacatattgagaaggcaaaattgctatttttccacagttgcgacgcaatcgattg 61 cttttctcctctacgcaactctacgagcacatttaatacatgaatgagtttcgccgggtg 121 gttgggctgcccctgatatccaagtataggcatatctggagcgtctgtttcgataagtag 181 gttttctagggctaatttttgaattgcgtcgcgggttttttgggctcgtgggtaggtaat 241 agtaccccctacaccgatgaaaaaacctaatctgacccactccatcgcttgctgatagct 301 accagcaaaagcatgtacgacaccgcctttaggtagcttcgccgctttgaccatttgaac 361 aagtcgattgtgtgcttttcggctatgtaaaataaccggaaggtcgaaacgtctggcgag 421 ctcaaattgagtttcaagcaccttttcttgcaattggggatcgacgtcaatagcaaaatc 481 taatccgcactcgcctattgcaacgcactgtggcggcttttgtttgagataatgctccag 541 ctcagcaaggtgctgctcaaagttctcttccagaaaatacggatggaacccgagcgcata 601 gtataagtgtgagtatttctcggctaaggtttgaatgcgtgaccagtttgaaggtccgac 661 tgagggtatcaggattcggctcaccccttgttcttgagcaagagccaggttgtgctcaaa 721 atcatcctgaaacacgtcaaaatcaaaatgacagtgcgtatcaaaaagcttcat

    RecA Recombinase

    [0105] In some embodiments, a genetically-modified bacteria cell can comprise a genetic modification that results in less DNA repair, relative to an otherwise comparable cell that does not comprise said genetic modification that results in less DNA repair. In some embodiments, the genetic modification is to a recombinase A (RecA) gene. RecA recombinase has multiple functions, all related to DNA repair. E. coli strains are often genetically modified to contain a mutant recA allele and thereby ensure the stability of extrachromosomal segments of DNA, known as plasmids. In a process called transformation, plasmid DNA is taken up by the bacteria under a variety of conditions (e.g., heat shock, electroporation). Bacteria containing exogenous plasmids are called transformants. Transformants retain the plasmid throughout cell divisions such that the plasmids can be recovered and used in other applications. Without a functional RecA polypeptide, the exogenous plasmid DNA is left unaltered by the bacteria.

    [0106] In some embodiments, a genetically-modified bacterial cell can comprise a genetic modification that results in RecA recombinase polypeptide being reduced or disabled, which can increase the stability of an unaltered plasmids. In other embodiments, a disabled RecA recombinase polypeptide can enable purification of the unaltered plasmid from bacterial cultures, which can then allow for use in other applications such as, for example, high-fidelity PCR amplification of the original plasmid sequence. In other embodiments, the one or more disabled RecA genes are replaced by one or more catalase genes, such as the exemplary catalase sequences provided herein.

    [0107] In some embodiments, a gene encoding RecA as described herein is itself modified to eliminate or reduce the expression of a polypeptide encoded by RecA. In some embodiments, a non-coding portion of the RecA gene as described herein is modified to eliminate or reduce the expression of the polypeptide encoded by RecA as described herein, such as a promotor, a polyadenylation site, a 5 untranslated region, or a 3 untranslated region. In some embodiments, an upstream or downstream gene that affects expression of the RecA gene as described herein is modified to eliminate or reduce the expression of the RecA polypeptide.

    [0108] In some embodiments, a RecA recombinase polypeptide to be modified has at least 85% amino acid sequence identity to GenBank Accession No. AAO18662.1 or a fragment thereof having DNA repair activity. An exemplary RecA recombinase amino acid sequence follows:

    TABLE-US-00017 (SEQIDNO:17) 1 mdenkqkalaaalgqiekqfgkgsimrlgdnramdvetistgslsldialgagglpmgri 61 vevygpessgkttltleliaaaqregktcafidaehaldpvyakklgvdidallvsqpdt 121 geqaleicdalarsgaidvmvvdsvaaltpkaeiegemgdshmglqarmlsqamrkltgn 181 lkqsncmcifikqirmkigvmfgnpetttggnalkfyasvrldirrtgaikegdevvgne 241 trikvvknkiaapfkeantqimygqgfnregelvdlgvkhklvekagawysyngdkigqg 301 kanacnylrehtevaqtidkklremllspavaegpeagempekkeeef

    [0109] In some embodiments, a RecA recombinase polynucleotide encodes a RecA recombinase polypeptide. An exemplary RecA recombinase polynucleotide sequence (promoter region and complete coding sequence) to be modified is provided at GenBank Accession No. AY198129.1, which is reproduced below:

    TABLE-US-00018 (SEQIDNO:18) 1 cgtgataagctctgcggcaaagttatacgtagatcagctaaagttttttctatacaggta 61 tagacactgtatgaatcaacagtataataactttcattgctgagcgattaactgctcaag 121 aaaagtttaatgactattcgtcgcccaaaaagatgaataaatcggagaaagtaatggacg 181 agaacaaacagaaagcgctcgccgctgcgctaggtcaaattgaaaaacaattcggtaaag 241 gctcaatcatgcgccttggcgataaccgcgcaatggacgtagaaaccatctcaacgggtt 301 ctctttctcttgatatcgctttgggtgctggtggcttaccgatgggccgtattgttgaag 361 tatacggtccggaatcttcgggtaaaacgacactaactctggaacttattgcagcagcac 421 agcgtgaaggcaaaacttgtgcgtttatcgatgcggagcacgctctggatcctgtatacg 481 cgaagaagcttggcgtagatatcgatgcacttttggtttctcagcctgatacgggtgagc 541 aagcgctagaaatctgtgacgcattagcgcgctctggtgctatcgacgtaatggttgtcg 601 actctgtggcagcactgactccaaaagcagaaatcgaaggcgaaatgggcgacagccaca 661 tgggtctccaagctcgtatgctttctcaagcgatgcgtaagctaacaggtaacctgaagc 721 agtctaactgtatgtgtatcttcatcaagcaaatccgtatgaagattggtgtgatgttcg 781 gtaacccagaaacaacaactggcggtaacgcacttaaattctacgcatcggttcgtcttg 841 atatccgtcgtactggcgcaatcaaagaaggcgacgaagttgtaggtaacgaaactcgca 901 tcaaagtcgttaagaacaagattgcagcaccatttaaagaagcaaacacgcagatcatgt 961 atggtcaaggctttaaccgcgaaggtgagctggtagacttaggcgtgaagcacaaactgg 1021 ttgaaaaagcaggtgcttggtacagctacaatggcgacaagatcggtcagggcaaagcaa 1081 atgcttgtaattacctgcgtgaacatacagaagttgctcagactatcgacaagaaacttc 1141 gtgagatgcttttgtctccagctgtagctgagggacctgaagccggtgaaatgccagaga 1201 agaaagaagaagagttttaa

    Polynucleotides, Plasmids, Vectors, and Replicons

    [0110] Disclosed herein are vectors for use with a genetically-modified cell as described herein, which can be any particle (e.g., plasmids, cosmids, Lambda phages) used as a vehicle to artificially carry a foreign nucleic sequence-usually DNA-into another cell, where it can be replicated and/or expressed. The four major types of vectors are plasmids, viral vectors, cosmids, and artificial chromosomes. In some embodiments, a vector, plasmid, or replicon comprising one or more essential genes and a biomolecule is used to transform a host cell.

    [0111] Extra-chromosomal DNA (e.g. a plasmid, vector, or replicon) can be transformed into a cell by any suitable method, for example by bacterial conjugation (e.g., E. coli to Vibrio spp.), electroporation of electro-competent cells, chemical transformation into chemically competent cells, biolistics, transduction, or via natural competence. Efficiencies of transformation can be, for example, at least 110.sup.5 or at least at least 110.sup.6 at least 110.sup.7 at least 110.sup.8 cfu/ug DNA using any of the methods above.

    [0112] A plasmid is a small, extrachromosomal DNA molecule within a cell that is physically separated from chromosomal DNA and can replicate independently. Plasmids are considered replicons, units of DNA capable of replicating autonomously within a suitable host.

    [0113] In some embodiments, a viral vector is used. In some of those embodiments, the viral vector is an AAV. In some embodiments, the viral vector corresponds to a virus of a specific serotype. In some examples, the serotype is selected from an AAV1 serotype, an AAV2 serotype, AAV3 serotype, an AAV4 serotype, AAV5 serotype, an AAV6 serotype, AAV7 serotype, an AAV8 serotype, an AAV9 serotype, an AAV10 serotype, an AAV11 serotype, an AAV12 serotype, avian AAV, bovine AAV, canine AAV, equine AAV, ovine AAV, and any other AAV now known or later discovered. See, e.g., BERNARD N. FIELDS et al., VIROLOGY, volume 2, chapter 69 (4th ed., Lippincott-Raven Publishers). A number of relatively new AAV serotypes and clades have been identified (see, e.g., Gao et al., (2004) 1 Virology 78:6381-6388; Mori et al., (2004) Virology 330:375-383; and Table 3). In some embodiments the AAV vector is a recombinant vector, a hybrid AAV vector, a chimeric AAV vector, a self-complementary AAV (scAAV) vector, a single-stranded AAV or any combination thereof, scAAV genomes contain both DNA strands which can anneal together to form double-stranded DNA.

    [0114] In some embodiments, methods of producing delivery vectors herein comprise packaging an engineered guide disclosed herein in an AAV vector. In some examples, methods of producing the delivery vectors described herein comprise, (a) introducing into a cell: (i) a polynucleotide encoding any engineered guide disclosed herein; and (ii) a viral genome comprising a Replication (Rep) gene and Capsid (Cap) gene that encodes a wild-type AAV capsid protein or modified version thereof; (b) expressing in the cell the wild-type AAV capsid protein or modified version thereof; (c) assembling an AAV particle; and (d) packaging the polynucleotide encoding the engineered polynucleotide in the AAV particle, thereby generating an AAV delivery vector. In some embodiments, an engineered guide disclosed herein, promoters, stuffer sequences, and any combination thereof may be packaged in the AAV vector. In some examples, the AAV vector can package 1, 2, 3, 4, or 5 copies of the engineered guide. In some embodiments, the recombinant vectors comprise one or more inverted terminal repeats and the inverted terminal repeats comprise a 5 inverted terminal repeat, a 3 inverted terminal repeat, and a mutated inverted terminal repeat. In some examples, the mutated terminal repeat lacks a terminal resolution site.

    [0115] In some embodiments, a hybrid AAV vector is produced by transcapsidation, e.g., packaging an inverted terminal repeat (ITR) from a first serotype into a capsid of a second serotype, wherein the first and second serotypes may be not the same. In some examples, the Rep gene and ITR from a first AAV serotype (e.g., AAV2) may be used in a capsid from a second AAV serotype (e.g., AAV9), wherein the first and second AAV serotypes may be not the same. As a non-limiting example, a hybrid AAV serotype comprising the AAV2 ITRs and AAV9 capsid protein may be indicated AAV2/9. In some examples, the hybrid AAV delivery vector comprises an AAV2/1, AAV2/2, AAV 2/4, AAV2/5, AAV2/8, or AAV2/9 vector.

    [0116] In some embodiments, the AAV vector may be a chimeric AAV vector. In some embodiments, the chimeric AAV vector comprises an exogenous amino acid or an amino acid substitution, or capsid proteins from two or more serotypes. In some examples, a chimeric AAV vector may be genetically engineered to increase transduction efficiency, selectivity, or a combination thereof.

    [0117] In some examples, the delivery vector may be a eukaryotic vector, a prokaryotic vector (e.g., a bacterial vector) a viral vector, or any combination thereof. In some embodiments, the delivery vehicle may be a non-viral vector. In some embodiments, the delivery vehicle may be a plasmid. In some embodiments, the plasmid comprises DNA. In some embodiments, the plasmid comprises RNA. In some examples, the plasmid comprises circular double-stranded DNA. In some examples, the plasmid may be linear. In some examples, the plasmid comprises one or more genes of interest (e.g., essential genes and biomolecules) and one or more regulatory elements. In some examples, the plasmid comprises a bacterial backbone containing an origin of replication and an antibiotic resistance gene or other selectable marker (e.g., essential gene) for plasmid amplification in bacteria. In some examples, the plasmid may be a minicircle plasmid. In some examples, the plasmid contains one or more genes that provide a selective marker to induce a target cell to retain the plasmid. In some examples, the plasmid may be formulated for delivery via electroporation or heat shock. In some examples, the plasmids may be engineered through synthetic or other suitable means. For example, in some embodiments, the genetic elements may be assembled by restriction digest of the desired genetic sequence from a donor plasmid or organism to produce ends of the DNA which may then be readily ligated to another genetic sequence.

    [0118] In some embodiments, the vector is a non-viral vector, and a physical method or a chemical method is employed for delivery into the bacterial cell. Exemplary physical methods include electroporation, heat shock, gene gun, sonoporation, magnetofection, or hydrodynamic delivery. Exemplary chemical methods include delivery of the recombinant polynucleotide via liposomes such as, cationic lipids or neutral lipids; dendrimers; nanoparticles; or cell-penetrating peptides. In some embodiments, a non-viral vector comprises a nanoparticle such as a lipid nanoparticle, a gold nanoparticle, or a combination thereof.

    [0119] In some embodiments, a fusion protein as described herein is inserted into a vector. In some embodiments, the vector optionally comprises one or more promoters, enhancers, operators, ribosome binding sites. RNA splice sites, polyadenylation sites, a replication origin, a multiple cloning site (MCS), cap binding sites, a LacZa fragment. M13 forward and reverse priming sites, and/or transcriptional terminator sequences.

    [0120] In general, plasmids and vectors described herein comprise at least one promoter. In some embodiments, the promoters are constitutive promoters. In other embodiments, the promoters are inducible promoters. In additional embodiments, the promoters are prokaryotic promoters (e.g., drive expression of a gene in a prokaryotic cell). In some embodiments, the promoters are eukaryotic promoters. (e.g., drive expression of a gene in a eukaryotic cell). Exemplary promoters include, but are not limited to, CMV, EF1a, SV40, PGK1, Ubc, human beta actin, CAG, TRE, UAS, Ac5, polyhedron, CaMKIIa, GAL1-10, TEF1, GDS, ADH1, CaMV35S, Ubi, H1, U6, CaMV35S, SV40, CMV, and HSV TK promoter. In some embodiments, the promoter is a lac promoter.

    [0121] In some embodiments, vectors are bicistronic or polycistronic vector (e.g., having or involving two or more loci responsible for generating a protein) having an internal ribosome entry site (IRES) is for translation initiation in a cap-independent manner.

    [0122] In some embodiments, vectors comprise an enhancer. Enhancers are nucleotide sequences that have the effect of enhancing promoter activity. In some embodiments, enhancers augment transcription regardless of the orientation of their sequence. In some embodiments, enhancers activate transcription from a distance of several kilo base pairs. Furthermore, enhancers are located optionally upstream or downstream of a gene region to be transcribed, and/or located within the gene, to activate the transcription. Exemplary enhancers include, but are not limited to, WPRE; CMV enhancers; the R-U5 segment in LTR of HTLV-I (Mol. Cell. Biol., Vol. 8(1), p. 466-472, 1988): SV40 enhancer; the intron sequence between exons 2 and 3 of rabbit -globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31, 1981); and the genome region of human growth hormone (J Immunol., Vol. 155(3), p. 1286-95, 1995).

    [0123] In some embodiments, vectors comprise an operator, which are nucleotide sequences that have the effect of repressing transcription upon binding of a repressor element. In some embodiments, the operator is a lac operator.

    Gene Editing

    [0124] The genes disclosed herein can be disabled by genetic modification of any organism (e.g., bacteria) by genome editing. Gene editing makes very specific targeted changes by insertion, deletion or substitution of genetic material in an organism's DNA to obtain the desired changes to the DNA. Examples of gene editing are CRISPR, zinc finger nuclease, transcription activator-like effector nuclease (TALEN), oligonucleotide directed mutagenesis, site specific nucleases, and meganucleases. The genes disclosed herein can also be disabled by using traditional gene knockout methods (e.g., homologous recombination such as natural selection (cotransformation of unlinked genetic markers) or chemical/radiological mutagenesis). Other examples of gene editing systems are transposases using signature-tagging mutagenesis or insertional inactivation (e.g., sleeping beauty) or argonaute proteins to edit genes of interest. In some embodiments, more than one type of editing system can be used to generate an expression system. For example, natural selection can be used to introduce a gene edit and then a CRISPR (e.g., CRISPR/Cas9) can target the wild type sequence, leading to cell death of unedited cells (Stukenberg, D., Hoff, J., Faber, A. et al. NT-CRISPR, combining natural transformation and CRISPR-Cas9 counterselection for markerless and scarless genome editing in Vibrio natriegens. Commun Biol 5, 265 (2022)).

    [0125] Engineered or genetically-modified bacterial cells edited herein can be screened using selection markers and can be utilized on the altered Chromosome II or on extrachromosomal DNA or any constructs described herein. In some embodiments, the selection marker is a resistance gene, for example a gene conferring resistance to tetracycline, chloramphenicol, ampicillin, bleomycin, carbenicillin, gentamycin, glyphosate, hygromycin, kanamycin, neomycin, nourseothricin, phleomycin, puromycin, spectinomycin, streptomycin, or another antibiotic agent. In some embodiments, the resistance gene is Ampicillin or Kanamycin. The resistance gene can also have an origin of replication from various sources.

    Guide Nucleic Acids

    [0126] The compositions, systems, and methods of the present disclosure may include a guide nucleic acid, also referred to herein as a guide RNA. In some embodiments, a guide nucleic acid can include a sequence that hybridizes to a target sequence of a double stranded DNA molecule. In some embodiments, the guide nucleic acid also binds to a nuclease. Such guide RNAs can be used in a CRISPR system described herein in order to perform site-specific genetic modifications to the genome of a bacterial cell (e.g. to disable or knock out a gene described herein).

    CRISPR Systems

    [0127] The modifications provided herein can be performed using gene editing. In some embodiments, gene editing can be performed using a clustered regularly interspaced short palindromic repeats (CRISPR) system. As disclosed herein, a CRISPR system can utilize a guide RNA that hybridizes to a target nucleic acid, as well as an endonuclease that cleaves the target nucleic acid. In some embodiments, an endonuclease can be a CRISPR-associated (Cas) protein such as a Cas9 or Cas12 protein. Examples of Cas9 proteins include Cas9 nickase and dead Cas9 (dCas9). Examples of Cas 12 proteins include Cas12 nickase and dead Cas12 (dCas12).

    Methods of Growing Gram-Negative Bacteria

    [0128] Growth conditions for gram-negative genetically-modified bacterial cell (e.g., Escherichia spp., Vibrio spp.) engineered or modified as described herein or for wild-type gram-negative bacteria, for purposes of measuring growth rates or comparing relative endotoxin concentrations or levels, can be any standardized or corresponding growth conditions accepted in the field as generally equivalent. In one embodiment, growth rates or other activities can be calculated or conducted in LBv2 media or LB (or LB-Miller) media or peptone, animal component free peptone, or yeast extract, at about 30 C. or another suitable temperature (e.g., 25 to 37 C.) with shaking (e.g., 100-300 rpm shaking). The growth conditions can be utilized to compare the growth rates between gram negative or other organisms, as is known and generally accepted in the field. In any of the embodiments a suitable media (including, but not limited to, any of those described herein) having from about 5 g NaCl/L to about or about 30 g NaCl/L or about 1% NaCl can be used. The media can optionally contain functional amounts glucose and/or magnesium, and can contain minimal or no calcium.

    [0129] Corresponding growth conditions are those accepted in the field as those suitable for providing comparative measurements. In some embodiments, the growth rate of a Vibrio spp. organism can be compared to an E. coli organism in corresponding conditions by growing Vibrio spp. in LBv2 media and the E. coli in LB (also called LB-Miller) media or peptone, animal component free peptone, or yeast extract, since the organisms prefer these respective media. The organisms can be grown at the same temperature, e.g., about 30 C. or about 37 C. or about 25 C., or Vibrio spp. can be grown at about 30 C. and E. coli can be grown at about 37 C. for corresponding conditions. In one embodiment, Vibrio spp. and E. coli organisms can also be compared by growing both of them in LBv2 media; in another embodiment for comparison Vibrio spp. can be grown in LBv2 media at about 30 C. and E. coli can be grown in LB (or LB-Miller) media at about 37 C. for corresponding conditions. Any of these various conditions can be used to compare any properties of the organisms, whether wild type or recombinant organisms.

    Growth Rate

    [0130] Genetic modification (e.g. deletion, inactivation, insertion, attenuation, inversion, disruption, or downregulation) of the API, lpxL, and/or lpxM genes in a gram-negative bacterial cell would be expected to result in an organism having a significantly lower growth rate than an unmodified wild type organism. However, in various embodiments the engineered or modified gram-negative bacterial cell described herein have a higher growth rate than a comparable Escherichia spp. and grows at 10% or more or 25% or more or 50% or more or 75% or more or 100% or more or 150% or more or 200% or more or 300% or more or 500% or more or 750% or more of the growth rate of the unmodified or wild type gram-negative bacterial cell, unless the gram-negative bacterial cell has a modified msbA mutation (or suppressor mutation) that permits Lipid IV (A) transport. There are various mutations of msbA that permit an increase in growth and they are known to persons of ordinary skill. Yet the present inventors discovered unexpectedly that the engineered Vibrio spp. gram-negative bacterial cell of the present disclosure can have a genetic modifications in one or more of the API, lpxL lpxM, Dns, Dam, and/or RecA genes and nevertheless remain culturable and retain a high growth rate making them useful for the production of biomolecules as described herein. These engineered or genetically-modified gram-negative bacterial cells also have the advantage of giving a substantially reduced or eliminated immune response (or are substantially less endotoxic) to humans and other mammals.

    [0131] A growing population of bacteria doubles at regular intervals of time. Bacterial growth occurs by geometric progression, e.g. 1, 2, 4, 8, etc. or 2.sup.0, 2.sup.1, 2.sup.2, 2.sup.3 . . . 2.sup.n where n is the number of generations. But only part of the bacterial life cycle involves exponential growth, and bacterial growth curves thus typically have an exponential portion and a stationary portion. Growth rate can be calculated during the exponential part of the life cycle. The exponential phase of growth involves balanced growth wherein the cells are dividing regularly and growing by geometric progression. The rate of exponential growth (or the growth rate) of a bacterial culture can be expressed as generation time, or doubling time of the bacterial population. Generation time (G) is defined as the time (t) per generation (n=number of generations). Thus, the equation G=time (t) divided by (n) expresses the doubling time or generation time. G can be expressed in minutes (or hours) or any suitable unit of time. For example, a generation time (G) of 10 minutes means that it will take 10 minutes for the population to double in size. In various embodiments, the generation time can be measured by the numbers of organisms, the biomass, the optical density of the cell culture measured at 600 nm optical density (O.D.), or other measurements that are convenient and accepted as scientifically valid. Another common method of describing growth kinetics is the specific growth rate (SGR). The specific growth rate has units of reciprocal hours (per hr or hr.sup.1). Specific growth rate (SGR) and generation time (G) are related through the following mathematical formula: G=ln(2)/SGR. Thus, a large SGR will correspond with a small G. and vice versa. SGR can also be converted into doublings/hr by the formula: doubling time=ln(2) divided by the specific growth rate.

    [0132] In some embodiments, the engineered Vibrio sp. of the present disclosure exhibits a specific growth rate of at least 0.30 hr.sup.1 (per hour) or at least 0.40 or at least 0.50 or at least 0.60 or at least 0.70 or at least 0.80 or at least 0.85 hr.sup.1 or 0.40-0.95 hr.sup.1 or 0.50-0.95 or 0.60-0.72 or 0.60-0.75 or 0.60-0.95, or 0.65-0.90, or 0.70-0.95, or 0.80-0.95, or 0.85-0.95, or 0.30-0.90, or 0.40-0.90, or 0.50-0.90, or 0.60-0.90, or 0.70-0.90, or 0.80-0.90 hr.sup.1 (per hour) which can be conveniently measured in any appropriate media and at any appropriate temperature (e.g., as described herein). Thus, growth rate can be expressed in doublings/hr or in minutes/doubling or simply generation time, or specific growth rate (SGR). In one embodiment, the doubling time of the organisms can be measured at 30 C. in LBv2 media. But any suitable media can be used, for example LB media (or LBMiller media) or peptone, animal component free peptone, or yeast extract. Growth can be assessed in any suitable container such as, for example, a fermentor or shake flask, but in one embodiment, the organisms can be assessed in a culture or assay plate (e.g., a 24, 48, 96, 384 well plate). The container can be flat bottomed microtiter plate, a round bottomed microtiter plate, or another appropriate vessel with wells of advantageous shape, for example flower shaped wells (e.g. FlowerPlate microtiter plates). Any suitable container and conditions can be used to measure the growth rate. The growth rate or specific growth rate can also be assessed at various temperatures, including but not limited to, growth at about 25 C. or at about 30 C.) or at about 37 C. or at about 40 C.) or at about 42 C. or about 25-30 C. or 25-32 C. or 25-37 C. or about 30-37 C. or about 37-42 C. or at any temperature between 16-42 C. The growth rates disclosed herein are achievable on the media indicated herein and without any further supplementation of the media (e.g., without supplementation by arabinose 5-phosphate or glucose 6 phosphate). In some embodiments, the gram-negative bacterial cells described herein can have all wild type genes and no deletions or genetic mutations to any gene except as otherwise described herein.

    [0133] In various embodiments, the engineered or genetically-modified gram-negative bacterial cells described herein have a doubling time of about 60) minutes, or 50-90 minutes, or 40-60) minutes, or 30-40 minutes, or less than 30 minutes at 30 C., or less than 22 minutes at 37 C., or less than 21 minutes at 42 C., all in LB or LBv2 media or peptone, animal component free peptone, or yeast extract.

    [0134] The engineered or genetically-modified Vibrio spp. bacterial cells described herein can grow more quickly than a corresponding or wild type bacterial cell. Thus, in various embodiments, the engineered or genetically-modified Vibrio spp. bacterial cells can have a growth rate of at least 40% more or at least 50% more, or at least 55% more, or at least 60% more at least 65% more or at least 70% more or at least 80% more or at least 85% more or at least 90% more or 50-70% more or 55-70% more or 55-65% more or 55-80% more or 55-90% more or 60-70% more or 60-65% more or 60-80% more or 60-90% more or 60-95% more or 65-90% more or 70-90% more or 75-90% more or 55-95% more or 65-95% more or 70-90% more or 70-95% more or 75-95% more of the growth rate (but also optionally more than 100% or more than 95% or more than 90% for any of them) of the corresponding or wild-type bacterial cells under the same or corresponding conditions. For example, if any bacterial cell has a doubling time of 10 minutes, 65% of its growth rate can be calculated as 10/0.65=15.4 minute doubling time. Growth rates can be measured over any convenient time period of cultivation during the exponential phase, such as over 4 hours or over 6 hours or 8 hours or 9 hours or 10 hours or 12 hours or 15 hours or 18 hours or 24 hours or only from 0-3 hours or 0-4 hours or 0-6 hours or 0-8 hours or 6-8 hours or from 8-10 hours or from 8-12 hours or from 10-12 hours. Thus, the engineered or genetically-modified Vibrio spp. bacterial cells described herein can have a doubling time or generation time or specific growth rate of 50% or greater or 55% or greater or 60% or greater, or 65% or greater, or 70% or greater or 75% or greater or 80% or greater or 85% or greater or 90% or greater, or 95% or greater (or 55-70% or 55-65% or 55-90% or 55-95% or 60-70% or 60-65% or 60-80% or 60-90% or 60-95% or 65-90% or 65-95% or 70-90% or 75-90% or 80-90% or 75-95% or 80-95%) than the doubling time or generation time of the wild-type organism, or an organism not having the genetic modification of RecA, Dam, KdsD, gutQ, kdsA, kdsB, waaA, msbA, yhiD, lpxL, and/or lpxM genes. Doubling time can be expressed as any suitable unit of time, but doublings/hr is convenient and commonly used.

    [0135] Any of the recombinant Vibrio spp. bacterial cells described herein can also have a growth rate of at least 100% greater, or at least 200% greater or at least 300% greater or at least 400% greater or at least 500% greater or at least 600% greater or at least 700% greater or at least 900% greater than an E. coli having a deletion of RecA, Dam, Dns, KdsD, gutQ, kdsA, kdsB, waaA, msbA, yhiD, lpxL1, lpxM genes, and a mutated msbA gene (a suppressor mutation). Such E. coli are commercially available under the trademark name ClearColi).

    [0136] Any of the engineered or genetically-modified Vibrio spp. bacterial cells described herein can exhibit sustained growth at higher temperatures, for example at about 40 C., or above 40 C., or at about 42 C., or above 42 C., or at about 37-42 C. or about 38-42 C., e.g. for time periods of at least 12 hours or at least 18 hours or at least 24 hours or at least 48 hours. In some embodiments, the cells can be re-cultured after being exposed to the stated conditions.

    Cold Tolerance

    [0137] Reactive oxygen species (ROS) such as singlet oxygen, superoxide anion, hydrogen peroxide, and hydroxyl radicals are a consequence of aerobic metabolism and can cause cellular damage through the oxidation of biological molecules. These oxygen species can be generated in an enhanced amount as a result of various types of cellular stress, including cold stress. In some embodiments, an engineered or modified bacterial cells (e.g., Escherichia spp., Vibrio spp.) comprises one or more nucleotide sequence(s) encoding one or more enzyme(s) from an ROS detoxification system. The one or more enzymes can be selected from one or more of a peroxidase, a dismutase, a reductase, and a transferase, or any combination of them, and which enzyme can be an algal, microalgal, bacterial, cyanobacterial or other type or source of enzyme. The enzyme can be selected from one or more of glutathione peroxidase (which can have reduced monomeric glutathione (GSH) as substrate), superoxide dismutase, guaiacol peroxidase (GPX), enzymes of ascorbate-glutathione (AsA-GSH) cycle ascorbate peroxidase (APX), monodehydroascorbate reductase (MDHAR), dehydroascorbate reductase (DHAR), glutathione reductase (GR), catalase peroxidase (e.g. katG and/or katE), alkyl hydroperoxide reductase, and glutathione S-transferase. The nucleotide sequence(s) can be exogenous or heterologous, and the one or more enzymes can be exogenous or heterologous enzymes.

    [0138] In some embodiments, engineered or modified bacterial cells (e.g., Escherichia spp., Vibrio spp.) have a heterologous or exogenous nucleic acid sequence encoding at least one enzyme from an ROS detoxification system, which can be present on a plasmid or other vector. The engineered or modified bacterial cells have a greater ability to tolerate cold stress than non-engineered or unmodified bacterial cells and can therefore remain viable and culturable after incubation at lower temperatures and for substantially greater periods of time than non-engineered bacterial cells. An ROS detoxification system can convert any of the reactive oxygen species into one or more of oxygen or water. The enzyme from an ROS system can be operably linked to or under the control of an exogenous or heterologous promoter and/or other regulatory sequences.

    [0139] In some embodiments, a vector, cell, expression system or biomolecule produced by said cell or expression system can be cryopreserved for long term storage. In some embodiments, the vector, cell, expression system or biomolecule produced by said cell or expression system is cryopreserved at a temperature less than 4 C., 20 C., 80 C., or 196 C. In other embodiments, the vector, cell, expression system or biomolecule produced by said cell or expression system is cryopreserved from 1 to 7 days, from 8 to 30 days, from 31 to 90 days, from 91 to 365 days, from 1 year to 5 years, or more than 5 years.

    Plasmid/Transgene production

    [0140] Disclosed herein are genetically-modified bacterial cells demonstrating increased plasmid or transgene production as compared to plasmid or transgene production in un-modified bacteria. In some embodiments, the genetically-modified bacterial cells demonstrate increased plasmid or transgene production as compared to plasmid or transgene production in a bacterial expression strain lacking the genetic modifications described herein. Also provided herein, are methods of expressing a plasmid in a genetically-modified cell.

    [0141] In some embodiments, the genetically-modified bacterial cells replicate a non-native plasmid with at least a 10%, 25%, 50%, 75%, 100%, 125%, 150%, 175%, 200%, 225%, 250%, 275%, or 300% increase in production yield of mg of plasmid as compared to a corresponding production yield of the non-native plasmid in a comparable expression system lacking the genetic modifications described herein. In some embodiments, the genetically-modified bacterial cells replicate a non-native plasmid with 10% or more, 25% or more, 50% or more, 75% or more, 100% or more, 125% or more, 150% or more, 175% or more, 200% or more, 225% or more, 250% or more, 275% or more, or 300% or more increase in production yield of mg of plasmid as compared to a corresponding production yield of the non-native plasmid in a comparable expression system lacking the genetic modifications described herein grown in the growth medium for the same amount of growth time. In some embodiments, the comparable expression system comprises wild-type K12 E. coli.

    [0142] In some embodiments, genetically-modified bacterial cells replicate a non-native plasmid to produce plasmids with reduced levels of plasmid multimers and/or concatemers. In some embodiments, the genetically-modified bacterial cells produce at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 99% less multimers an/or concatemers as compared to an un-modified bacterial cell. In some embodiments, the genetically-modified bacterial cells produce at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 99% increase in monomeric plasmid species as compared to an un-modified bacterial cell. In some embodiments, the genetically-modified bacterial cells produce at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 99% increase in supercoiled plasmid DNA as compared to an un-modified bacterial cell. In some embodiments, plasmids produced by the genetically-modified bacterial cells described herein can comprise an increased ratio of monomeric and supercoiled plasmid DNA to multimers and concatemers, as compared to an un-modified bacterial cell.

    [0143] In some embodiments, the non-native plasmid generated by the genetically-modified bacterial cells can be purified. The skilled artisan may look to known plasmid purification steps to provide for a scheme which results in an appropriate grade of DNA plasmid purity. For example, PCT International Application Nos. PCT/US95/09749 (WO96/02658) and PCT/US96/07083 (WO96/36706) give guidance as to alternative, chromatography-based downstream steps which may be utilized in combination with the core purification steps mentioned in this paragraph to provide an effective purification protocol.

    Method of Expressing Biomolecule

    [0144] In some embodiments, non-toxic gram-negative genetically-modified bacterial cells are used as hosts for the production of endotoxin free biomolecules. The present disclosure is not limited to particular biomolecules. Traditionally, the production of biomolecules in Gram negative bacteria, whether it be outer membrane vesicles for vaccines, LPS type molecules (such as monophosphoryl lipid A (MPLA)) to be used as adjuvants, recombinant pharmaceutical proteins, macromolecules, or DNA for mammalian cell transfection/gene therapy, is plagued by the presence of endotoxin from the bacterial host. Contamination of the therapeutic molecule with endotoxin is a concern, as the immunogenic potential of LPS is well documented. Current production strategies to alleviate endotoxin contamination include various purification techniques, such as the kits marketed for endotoxin free DNA plasmid purification, followed by assays to measure endotoxin levels. As such, the non-toxic gram-negative bacterial cells of the present disclosure (e.g., the endotoxin-free cells) provide improved methods of isolating endotoxin free biomolecules. Accordingly, as some cells of the present disclosure do not produce endotoxin, such purification steps are not required. For example, the endotoxin-free cell of the present disclosure can be a host for the production of commercially important biomolecules in an endotoxin-free environment using Gram-negative bacteria. Additionally, cells comprising a modification in a gene encoding any one or more of a D-arabinose 5-phosphate isomerase, a KD08P synthase, a CMP-KDO synthetase, a KD08P phosphatase and/or a KDO transferase, an ATP-dependent translocator, an inner membrane protein (e.g., gutQ, kdsD, kdsA, kdsB, waaA msbA, yhjD genes), or modifications in any other biosynthetic, processing (e.g., lpxL1 or lpxM), or trafficking bacterial genes can be hosts for the production of commercially important biomolecules in an endotoxin-free environment using Gram-negative bacteria.

    EXAMPLES

    [0145] The following examples are included for illustrative purposes only and are not intended to limit the scope of the disclosure. It will be understood by those of skill in the art that numerous and various modifications can be made to yield essentially similar results without departing from the spirit of the present disclosure.

    Example 1: Preparation of Engineered V. natriegens Strain for Antibiotic-Free Plasmid Production

    [0146] An engineered V. natriegens strain was prepared for endotoxin- and antibiotic-free plasmid production. Modifications to the bacterial chromosome were performed using a CRISPR-Cas9 system. The following bacterial chromosomal genes are edited (Knocked-out) in this strain: [0147] (a) Extracellular deoxyribonuclease (Dns) activity is very prominent in this organism. This activity causes degradation of the plasmid during the transformation and plasmid isolation stage. Also, the deoxyribonuclease activity impacts negatively on stability of the plasmid itself. The Dns gene was edited using a CRISPR/Cas9 gene editing system to produce a nonfunctional truncated Dns protein. Hence, the exonuclease activity of Dns was lost permanently, enabling better stability and less degradation during the isolation of the plasmids. [0148] (b) Arabinose 5-phosphate isomerase (KdsD) activity is one of the important steps in endotoxin production by this organism, which is a hard to remove contaminant during plasmid production and purification. The KdsD gene knockout inhibited the biosynthesis of lipopolysaccharide (LPS), contributing to a very low level of endotoxin in the isolated plasmid. [0149] (c) Lipid A biosynthesis lauroyltransferase (lpxL_1) activity is one of the important steps in endotoxin production by this organism, which is a hard to remove contaminant during plasmid production and purification. The lpxL_1 gene knockout inhibited the biosynthesis of lipopolysaccharide (LPS), contributing to a very low level of endotoxin in the isolated plasmid. [0150] (d) Lipid A biosynthesis myristoyltransferase (lpxM): activity is one of the important steps in endotoxin production by this organism, which is a hard to remove contaminant during plasmid production and purification. The lpxM gene knockout inhibited the biosynthesis of lipopolysaccharide (LPS), contributing to a very low level of endotoxin in the isolated plasmid. [0151] (e) DNA adenine methylase (Dam) can diminish gene expression by inhibiting the binding of transcription factors to the sensitive genes. Knock-out of this gene makes the organism dam/ and allows the synthesis and expression of dam sensitive plasmids. The Dam/ strain was made by a knockout of the DNA adenine methylase gene. [0152] (f) Glutamine-dependent NAD(+) synthetase (nadE_1) is one of the essential genes for survival of the organism. Knockout of this gene resulted in the death of the organism unless the enzyme is supplemented from a source other than the genomic DNA. In order to select only the plasmid containing transformed bacteria, this gene was inserted into the plasmid of interest and introduced into the Glutamine-dependent NAD(+) synthase knockout bacteria. This process allowed for antibiotic free selection of the transformed plasmid containing organism.

    [0153] Bacterial gene editing was performed using a modified CRISPR-Cas9 system which employs two proprietary plasmids. Plasmid named NB_Cas9 and NB_gRNA.

    [0154] NB_Cas9 plasmid consisted of gene sequences that correspond to PSCI01 Origin, Rep101, Lac Promotor, Lac Inhibitor, Lac operator, Lambda T3 terminator, Kanamycin Resistance gene, 5-3 double stranded exonuclease from lambda red system, single stranded DNA binding recombinase in the lambda red system, inhibitor of the host RecBCD nuclease in the lambda Red system, Shine-Dalgarno sequence, promoter of the L-arabinose operon of E. coli, L-arabinose regulatory protein, and a Kanamycin resistant gene.

    [0155] NB_gRNA plasmid consisted of Origin of replication, Ampicillin resistant gene, ampicillin resistant gene promotor, J23119 (SpeI) promotor, gRNA sequence, and a gRNA scaffold.

    [0156] A homologues recombinant DNA template, which was different for various gene knock-outs, was also a part of the gene editing system.

    [0157] Bacteria were transformed using a modified Cas9 plasmid, gRNA plasmid, and homologous repair template specific for each gene to be knocked out or knocked in. Transformation was performed using electroporation or a heat shock method. Transformed bacteria were selected using Kanamycin and/or Ampicillin resistance. Selected bacteria were screened for the changes in the genome using sequencing and the plasmid was curated by growing the organism at 37-42 C.

    [0158] The growth rate of the engineered V. natriegens strains were then compared to an E. coli control. V. natriegens was grown in media containing 1) Animal component free peptone (5 to 10 g/L), Yeast Extract (5 to 10 g/L), Sodium chloride (5 to 30 g/L), Double Distilled water to make up the volume to 1000 ML and pH is adjusted to 6.5 to 7.5. Bacterial host was grown at 25 C. to 37 C. with 100-300 rpm shaking. As shown in FIGS. 1-2, the V. natriegens strains exhibited a robust growth rate at O.D. 600 nm relative to the E. coli control. The cell doubling time was also much faster in the engineered V. natriegens (NB) compared to an E. coli cell line (FIG. 3A). This led to enhanced total plasmid yields (mg) for 6 different sized plasmids (FIG. 3B).

    Example 2: Preparation of Genetically Engineered E. coli for Low Endotoxin, Antibiotic Free Selection

    [0159] An engineered E. coli strain was prepared for antibiotic free selection with low endotoxin production. Modifications to the bacterial chromosome were performed using a CRISPR-Cas9 system. The following bacterial chromosomal genes are edited (knocked-out) in this strain: [0160] (a) Arabinose 5-phosphate isomerase (KdsD) activity is one of the important steps in endotoxin production by this organism, which is a hard to remove contaminant during plasmid production and purification. The KdsD gene knockout inhibited the biosynthesis of lipopolysaccharide (LPS), contributing to a very low level of endotoxin in the isolated plasmid. [0161] (b) Lipid A biosynthesis lauroyltransferase (lpxL_1) activity is one of the important steps in endotoxin production by this organism, which is a hard to remove contaminant during plasmid production and purification. The lpxL_1 gene knockout inhibited the biosynthesis of lipopolysaccharide (LPS), contributing to a very low level of endotoxin in the isolated plasmid. [0162] (c) Lipid A biosynthesis myristoy ltransferase (lpxM): activity is one of the important steps in endotoxin production by this organism, which is a hard to remove contaminant during plasmid production and purification. The lpxM gene knockout inhibited the biosynthesis of lipopolysaccharide (LPS), contributing to a very low level of endotoxin in the isolated plasmid. [0163] (d) DNA adenine methylase (Dam) can diminish gene expression by inhibiting the binding of transcription factors to the sensitive genes. Knock-out of this gene makes the organism dam/ and allows the synthesis and expression of dam sensitive plasmids. The Dam/ strain was made by a knockout of the DNA adenine methylase gene. [0164] (e) Glutamine-dependent NAD(+) synthetase (nadE_1) is one of the essential genes for survival of the organism. Knockout of this gene resulted in the death of the organism unless the enzyme is supplemented from a source other than the genomic DNA. In order to select only the plasmid containing transformed bacteria, this gene was inserted into the plasmid of interest and introduced into the Glutamine-dependent NAD(+) synthase knockout bacteria. This process allowed for antibiotic free selection of the transformed plasmid containing organism

    [0165] Bacterial gene editing was performed using a modified CRISPR-Cas9 system which employs two proprietary plasmids. Plasmid named NB_Cas9 and NB_gRNA.

    [0166] NB_Cas9 plasmid consisted of gene sequences that correspond to PSCI01 Origin, Rep101, Lac Promotor, Lac Inhibitor, Lac operator, Lambda T3 terminator, Kanamycin Resistance gene, 5-3 double stranded exonuclease from lambda red system, single stranded DNA binding recombinase in the lambda red system, inhibitor of the host RecBCD nuclease in the lambda Red system, Shine-Dalgarno sequence, promoter of the L-arabinose operon of E. coli, L-arabinose regulatory protein, and a Kanamycin resistant gene.

    [0167] NB_gRNA plasmid consisted of Origin of replication, Ampicillin resistant gene, ampicillin resistant gene promotor, J23119 (SpeI) promotor, gRNA sequence, and a gRNA scaffold.

    [0168] A homologues recombinant DNA template, which will be different for various gene knock-outs, was also a part of the gene editing system.

    [0169] Bacteria were transformed using a modified Cas9 plasmid, gRNA plasmid, and homologous repair template specific for each gene to be knocked out or knocked in. Transformation was performed using electroporation or a heat shock method. Transformed bacteria were selected using Kanamycin and/or Ampicillin resistance. Selected bacteria were screened for the changes in the genome using sequencing and plasmid was curated by growing the organism at 37-42 C.

    [0170] The CRISPR/Cas9 edits above were made by using the exemplary guide sequences below:

    TABLE-US-00019 TABLE1 gRNAsequencesfortheDnsmodification GC Self- con- com- tent ple- men- Ef- Target tar- fici- Rank sequence Strand (%) ity MM0 MM1 MM2 MM3 ency 1 TTGGTGTCA 50 0 0 0 0 0 83.13 CTATTACCG CGCGG (SEQID NO:19) 2 CAGCTGCAA + 55 0 1 0 0 0 72.69 TGCTGGCAA AGCGG (SEQID NO:20) 3 TCGAGCGGT + 50 0 0 0 0 0 71.02 AATAGTGAA CGCGG (SEQID NO:21) 7 TCCATTTCA 40 0 0 0 0 0 64.23 CTATTACCG AGCGG (SEQID NO:22)

    TABLE-US-00020 TABLE2 gRNAsequencesfortheDammodification GC Self- con- comple- tent mentar- Effic- Rank Targetsequence Strand (%) ity iency 4 GCGTCGTTTATACCACGGAG 55 2 72.49 (SEQIDNO:23) 5 CCACGCTCAAATCCGCTCCG + 65 3 70.57 (SEQIDNO:24) 6 GACGCGTTAATGTTGTATCG + 45 0 64.48 (SEQIDNO:25) 7 AAGTTTGCGGTATTTGAAAG 35 0 63.82 (SEQIDNO:26)

    Example 3: Removal of DNA Strand Exchange Protein to Improve Plasmid Stability

    [0171] A genetically-modified strain of Vibrio natriegens was prepared for endotoxin-free plasmid and/or transgene production, where the plasmids produced contained reduced levels of plasmid multimers or concatemers.

    [0172] The wildtype Vibrio natriegens strain, when transformed with plasmid DNA, generates plasmid species that have a higher molecular weight than the expected plasmid. These higher molecular weight species correspond to plasmid multimers and/or concatemers that have been generated by the endogenous machinery in the strain. These multimers and/or concatemers severely impact plasmid quality by contaminating the desired species (monomeric, supercoiled plasmid DNA) with additional species, reducing yield and complicating purification procedures.

    [0173] Therefore, modifications to the bacterial chromosomes were performed to remove an endogenous DNA strand exchange protein would diminish the strain's ability to generate these undesirable high-molecular weight species and therefore improve plasmid quality. The entire coding sequence for a predicted DNA strand exchange protein (SEQ ID NO:1) was replaced with an antibiotic resistance marker using natural competence-mediated homologous recombination, as previously described (ACS Synth. Biol. 2018, 7, 2245-2255).

    [0174] V. natriegens cells were rendered naturally competent via expression of the V. cholera tfoX protein from a plasmid, activating the cell's natural competence machinery. The naturally competent cells were transformed with DNA cassettes composed of a chloramphenicol resistance gene bounded by homology arms to the genetic loci of interest, which direct the DNA cassette to the appropriate locus and enable a recombination event. In this instance, the result is the replacement of the DNA strand exchange protein gene with a chloramphenicol resistance marker. The resulting chloramphenicol-resistant transformants were screened by colony PCR to confirm the desired knockout, and then passaged in the absence of antibiotics to cure the strain of the tfoX expression plasmid.

    [0175] Plasmid DNA was then introduced into the strain as previously described (Nature Methods. 2016, 13:849-851) and cultivated in liquid growth media supplemented with antibiotics to ensure plasmid maintenance. Plasmids were isolated from the cultures using commercially available DNA purification columns (Qiagen) following manufacturer's protocols. Isolated plasmid DNAs were run on TAE 1% agarose gels to visualize the plasmid topologies, confirming that the genome modification improved the quality of the plasmid DNA preps by reducing the presence of high-molecular-weight multimers/concatemers (FIGS. 4A-B).

    Example 4: Knockout of nadC in V. Natriegens Via Natural Competency Transformation

    [0176] Identification and context of the nadC that encodes for QAPRTase in V. natriegens was conducted using the blastn algorithm. To perform the knockout of nadC, a protocol for transformation via natural competency was employed as described elsewhere (Conley et al.). A DNA cassette encoding a chloramphenicol resistance marker flanked on either side by 3 kb homology arms to regions upstream and downstream of nadC in V. natriegens was constructed with the intention of swapping out the nadC gene with the chloramphenicol resistance cassette via homologous recombination.

    [0177] To perform the natural competency transformation, a 10 mL culture of V. natriegens/TfoX plasmid was grown in LBv2 media (LB: 10.0 g/L Tryptone, 5.0 g/L Yeast Extract, 10.0 g/L NaCl; 204 mM NaCl, 4.2 mM KCl, 23.14 mM MgCl.sub.2) with the addition of antibiotic (100 g/mL carbenicillin) and 1 M IPTG for 16 hours at 30 C. and 250 rpm. A transformation reaction was setup in a 2 mL Eppendorf tube with the following mixture: [0178] 350 L 2 Instant Ocean [0179] 150 ng knockout cassette DNA (10 L at 15 ng/L) [0180] 3.5 L 10 mM IPTG [0181] 3.5 L 16-hour grown culture

    [0182] The transformation reaction was then incubated for 5 hours at 30 C. using a heat block. The reaction tube was then transferred to a culture tube with 1 mL LBv2 added and grown for 2 hours at 30 C. and 250 rpm. 100 L of the culture was then spread onto plates of LB-Miller with chloramphenicol (5 g/mL) and grown overnight in an incubator at 30 C. Grown colonies were screened and successful transformants of V. natriegens nadC-were sequence confirmed using colony PCR.

    Example 5: Verification of NAD Auxotrophy of V. Natriegens nadC Knockout Strain and Recovery with Complementary Plasmid Via Growth Assay

    [0183] To build plasmids supplying the complement nadC, two different gene cassettes encoding for nadC sourced from V. natriegens were cloned via isothermal assembly into pUC19. To maximally ensure that the control elements were fully captured and functional for expression of nadC, one design (pNadC.sub.1) used a cassette that starts 142 bp prior to the upstream gene (ampD) of nadC, totaling 1,803 kb in size. Another design (pNadC.sub.2) used a cassette that starts 30 bp into the ampD CDS, totaling 1,445 kb in size. Chemical competent cells for V. natriegens nadCwere made and each plasmid was subsequently transformed to produce the strains V. natriegens nadC/pNadC.sub.1 and V. natriegens nadC/pNadC.sub.2.

    [0184] The four strains tested in the growth assay were V. natriegens (carrying a plasmid conferring ampicillin resistance, but no nadC gene on the plasmid), V. natriegens nadC (nadC replaced with chloramphenicol resistance marker using methodology discussed in prior section), V. natriegens nadC/pNadC.sub.1, and V. natriegens nadC/pNadC.sub.2. Tested strains were inoculated from glycerol stocks and grown in 5 mL cultures of LBv2 media (LB: 10.0 g/L Tryptone, 5.0 g/L Yeast Extract, 10.0 g/L NaCl; 204 mM NaCl, 4.2 mM KCl, 23.14 mM MgCl2) with addition of appropriate antibiotic (100 g/mL carbenicillin and/or 17 g/mL chloramphenicol) for 24 hours at 30 C. and 250 rpm. For the growth assay, each strain was grown in 2 mL of M9 media (250 mL 2 M9 salts (Thermofisher), 1 mL 1 M MgSO4, 50 L 1 M CaCl2, ddH2O added until 500 mL final volume), supplemented with 0.4% (w/v) glucose, 2% (w/v) NaCl, appropriate antibiotic (100 g/mL carbenicillin and/or 17 g/mL chloramphenicol), and in the presence or absence of 10 g/mL nicotinic acid (NA) for 24 hours at 30 C. and 250 rpm. After the growth period, the OD600 of each culture was measured using a cuvette and spectrophotometer (NanoDrop One).

    TABLE-US-00021 TABLE 3 Optical Density of V. natriegens Strains Grown in NAD-deficient Environment NA present NA present Strain (OD.sub.600) (OD.sub.600) V. Natriegens 1.37 0.11 1.37 0.10 V. Natriegens nadC- 1.31 0.22 0.02 0.02 V. Natriegens nadC-/pNadC.sub.1 1.33 0.20 1.27 0.13 V. Natriegens nadC-/pNadC.sub.2 1.48 0.06 1.42 0.12

    [0185] Table 3 above represents data from an experiment showing engineered V. natriegens strains grown in media that is auxotrophic for V. natriegens nadC-when nicotinic acid (NA) is absent, and tests degree of recovery with V. natriegens nadC-complemented with nadC on plasmid (pNadC.sub.1 and pNadC.sub.2). Growth of each strain culture is measured by optical density (OD.sub.600) of the grown cultures from a 24-hour growth period. Data shown is the mean and standard deviation of three technical replicate experiments.

    [0186] The results of the growth assay confirmed that V. natriegens with nadC knocked out, and thus with no QAPRTase enzyme present to undergo de novo synthesis of NAD, is unable to grow thus confirming NAD auxotrophy in M9 media without NA for the knockout strain. Once a plasmid that supplied nadC (pNadC.sub.1 or pNadC.sub.2) was present in the knockout strain, the strain could now resume growth in M9 without NA and thus the strain no longer exhibits auxotrophy of NAD. Under these conditions, the cell must maintain the plasmid in order to survive, resulting in maintenance of the plasmid in the strain in the absence of antibiotics. These results prove the baseline condition that a framework utilizing V. natriegens nadC- and a designed plasmid possessing expression of nadC can be used as a means for antibiotic-free plasmid selection.

    [0187] The nadC introduced above were made by using the exemplary cassette sequences below:

    TABLE-US-00022 TABLE4 CassettesequencesfornadCintroduction SEQ ID NO: Name Sequence 27 pNadC.sub.1 CGGCCACTTCCCTCGCTGTACACACAAAAAT cassette GTAGTTAATTTTCAACAAAAGTAATTATTTT TTGTATACAAAAAGGCATGGTTGAAACCATG CCTTATTGATTCTAGCTTTTATAATTTACAT ATTTATCACAACTTAATTTCAAATTAGTCGT CGATACTTGACCCAGTCAAAACTTAAGCCAG GGTCACTTTTTCTTAGCGGGGCGATGTACTG GTGGCCAGTAATTCGTTGAGGGGTAATGTTA GGGTATTGCGACATAATCGCTTGAGATAAAC CCGCAAGTGACTGATATTGCTCATCTGTGTA TGCGACAAACTCAGTCCCTTCCAGCTCAACA CCTATCGAATAGTCATTGCATCCAGCTCGTC CGGCAAAACTTGACTGGCCAGCATGCCATGC TCTATCGAGAAAGGACACAAACTGTACAATC TCGCCATTTCTCTTTATTAAGCAATGAGCCG AAACCCCCATTTTGTGAATTACTTCAAAAAA TGGATGTACTTTCGGGTCCAATTTCCCACAG AAAAAGTCCTCTATATAAGGACCGCCAAACT GGCCAGGCGGCAAACTGATGTTATGAACAAC AAGCAGAGAGATATCAGTGCTATCTGAACGA GCATCAAAAAAAGGCGACGGAACATGCTTTG CTTGCGTCAACCAGCCATTCTCGATTATTGG GGGCATATCAACCTCTATAGTTTGCAAATTA ACTGCTGAAATTATTGACACCGGAGAGTATC ATTCGTTGCCATCTCCCTTTCAAGACTAGAT TTGCGATGAAGAACACACACAACAGCCAAGA ACGCCTGGAATACCTGAAACAACAACTTCCT CTGGAGATCACTCGCTCCGTCGCCGATACCT TAAAAGAAGACCTCGGCGGCACAGTGGATAT CAACAACGATATCACCGCATCTCTTATCCCT GAAGATGCCGTTAACACTGCGACGATCATTA CACGTGAGCACGGTGTGTTCTGCGGTCAGGC TTGGGCAGATGAAGTATTTAAACAGCTGGGC GGTAAAGTGACTATCGAGTGGTATGTACAAG ACGGTGACAAGGTTGAACCAAACCAGACACT TTGTACCTTATCAGGCCCTGCTCGTGACCTG CTTACTGGCGAGCGTAACGCGATGAACTTTA TTCAGACGCTTTCTGGTTGTGCGACCACAAC GTCCGTGTACGCAGAAAAGATCGCGCACACC GAGTGCCGTCTGTTAGATACGCGCAAAACTA TTCCGGGTCTGCGCAGCGCTCTAAAATACGC CGTAGCTTGTGGCGGTGGCTTCAACCACCGT ATCGGCGTATTCGATGCATACCTCATTAAAG AAAACCACATCATTGCCTGCGGCGGCATCAC TCAAGCGATCACAACAGCAAAAGAGTTGAAC CCTGGCAAACCAGTCGAAGTGGAAACAGAAA GCTTAGACGAGTTAAAAGAAGCGATTGAAGC CGGTGCGGATATCATCATGCTGGATAACTTT ACTAAAGAGATGATGCGTGAAGCAGTAGAAA TCAACGCAGGTCGCGCAGCATTAGAAAACTC TGGCAACATCACCTTAGACACCATCGCAGAA TATGCAGAAACAGGCGTCGATTACATCTCTG TCGGCGCGCTAACCAAGCACCTGAAAGCGAT GGATCTTTCGATGCGCTTCAAATAACCAATT AACAAAATCCATATTAAACAAGAAAATTCAA CAACTTATAAAACAAACATTAAATAAAGGGC CCTTTGGCCCTTTGGCCCTTTATTTTTATCC GTAAAAAGCCAAATCAATCGCAATTCGTTGC ATATC 28 pNadC.sub.2 CAACCAGCCATTCTCGATTATTGGGGGCATA cassette TCAACCTCTATAGTTTGCAAATTAACTGCTG AAATTATTGACACCGGAGAGTATCATTCGTT GCCATCTCCCTTTCAAGACTAGATTTGCGAT GAAGAACACACACAACAGCCAAGAACGCCTG GAATACCTGAAACAACAACTTCCTCTGGAGA TCACTCGCTCCGTCGCCGATACCTTAAAAGA AGACCTCGGCGGCACAGTGGATATCAACAAC GATATCACCGCATCTCTTATCCCTGAAGATG CCGTTAACACTGCGACGATCATTACACGTGA GCACGGTGTGTTCTGCGGTCAGGCTTGGGCA GATGAAGTATTTAAACAGCTGGGCGGTAAAG TGACTATCGAGTGGTATGTACAAGACGGTGA CAAGGTTGAACCAAACCAGACACTTTGTACC TTATCAGGCCCTGCTCGTGACCTGCTTACTG GCGAGCGTAACGCGATGAACTTTATTCAGAC GCTTTCTGGTTGTGCGACCACAACGTCCGTG TACGCAGAAAAGATCGCGCACACCGAGTGCC GTCTGTTAGATACGCGCAAAACTATTCCGGG TCTGCGCAGCGCTCTAAAATACGCCGTAGCT TGTGGCGGTGGCTTCAACCACCGTATCGGCG TATTCGATGCATACCTCATTAAAGAAAACCA CATCATTGCCTGCGGCGGCATCACTCAAGCG ATCACAACAGCAAAAGAGTTGAACCCTGGCA AACCAGTCGAAGTGGAAACAGAAAGCTTAGA CGAGTTAAAAGAAGCGATTGAAGCCGGTGCG GATATCATCATGCTGGATAACTTTACTAAAG AGATGATGCGTGAAGCAGTAGAAATCAACGC AGGTCGCGCAGCATTAGAAAACTCTGGCAAC ATCACCTTAGACACCATCGCAGAATATGCAG AAACAGGCGTCGATTACATCTCTGTCGGCGC GCTAACCAAGCACCTGAAAGCGATGGATCTT TCGATGCGCTTCAAATAACCAATTAACAAAA TCCATATTAAACAAGAAAATTCAACAACTTA TAAAACAAACATTAAATAAAGGGCCCTTTGG CCCTTTGGCCCTTTATTTTTATCCGTAAAAA GCCAAATCAATCGCAATTCGTTGCATATC

    [0188] While preferred embodiments of the present disclosure have been shown and described herein, such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will occur without departing from the present disclosure. It should be understood that various alternatives to the embodiments described herein may be employed. It is intended that the following claims define the scope of the present disclosure and that methods and structures within the scope of these claims and their equivalents be covered thereby.