METHODS FOR GENERATING AND SCREENING COMPARTMENTALISED PEPTIDE LIBRARIES
20260056184 ยท 2026-02-26
Inventors
Cpc classification
G01N33/5008
PHYSICS
C40B40/10
CHEMISTRY; METALLURGY
C12N15/1075
CHEMISTRY; METALLURGY
C07K7/64
CHEMISTRY; METALLURGY
International classification
G01N33/50
PHYSICS
C07K7/64
CHEMISTRY; METALLURGY
C12N15/10
CHEMISTRY; METALLURGY
Abstract
A method for co-compartmentalising a cyclic polypeptide with a polynucleotide encoding the cyclic polypeptide, comprising the steps of a) forming a compartment containing a polynucleotide encoding the cyclic polypeptide, b) expressing a polypeptide from the polynucleotide, and c) cyclising the polypeptide. Co-compartmentalised cyclic polypeptides and encoding polynucleotides. Libraries of co-compartmentalised cyclic polypeptide and encoding polynucleotide. Methods for screening libraries of co-compartmentalised cyclic polypeptide and encoding polynucleotide. Incorporation of non-canonical nucleic acids into such libraries.
Claims
1.-17. (canceled)
18. A method for sorting cyclic polypeptides, comprising: i) producing at least three (3) million multicompartment systems that are monodisperse emulsion droplets that each co-compartmentalise a cyclic peptide and encoding nucleic acid in a hydrophilic microfluidic device, said producing comprising in order: a) forming a plurality of multicompartment systems that are monodisperse emulsion droplets on the hydrophilic microfluidic device, wherein each of the plurality of multicompartment systems comprises: 1) a first compartment comprising an aqueous droplet, comprising an in vitro transcription and translation (IVTT) system, and a gel forming agent, wherein the gel forming agent comprises a polynucleotide sequence that encodes a cyclic polypeptide, and wherein the polynucleotide sequence comprises, from 5 to 3: a sequence encoding an N-terminal intein fragment, a sequence encoding the polypeptide that is to be cyclised, and a sequence encoding a C-terminal intein fragment, wherein the IVTT system comprises a transfer RNA (tRNA) charged with natural or non-natural amino acids, an RNA polymerase, a ribosome, nucleotide phosphates, and translation factors; and 2) at least a second compartment surrounding the first compartment, such that the first compartment and the second compartment form a plurality of monodisperse emulsion droplets, and; b) amplifying the polynucleotide sequence that encodes a cyclic polypeptide within each first compartment to produce a plurality of amplicons; c) following amplification, solidifying the gel forming agent to form a gel matrix that traps the plurality of amplicons in the gel matrix of the monodisperse w/o emulsion droplet, and d) in vitro expressing a plurality of polypeptides from the plurality of amplicons within the gel matrix formed in c. to produce a plurality of expressed polypeptides, such that the plurality of amplicons encoding the plurality of polypeptides and the expressed polypeptides are contained in the gel matrix of the first compartment; wherein the plurality of expressed polypeptides in each of the plurality of first compartments self-cyclise to form a plurality of cyclic polypeptides within each of the plurality of monodisperse w/o emulsion droplets; ii) screening the cyclic polypeptide for a desired activity; and iii) selecting one or more cyclic polypeptides exhibiting the desired activity.
19. The method of claim 18 wherein the method comprises further step (iii) identifying the encoding nucleic acid(s) of the one or more selected polypeptide(s).
20. The method according to claim 18, wherein the compartment is a droplet of water-in-oil-in-water (w/o/w) emulsion, or a vesicle.
21. The method of claim 18 wherein the gel forming agent is an ultra-low gelling temperature agarose, wherein the ultra-low gelling temperature agarose is a fluid at 37 C. and has a transition gelling point between 8-17 C.
22. The method of claim 18 further comprising a third compartment comprising a discontinuous external aqueous phase comprising a surfactant, wherein the discontinuous external aqueous phase surrounds each of the plurality of monodisperse water-in-oil emulsion droplets to form a plurality of monodisperse water-in-oil-in-water emulsion droplets.
23. The method of claim 18 wherein each first compartment comprises a plurality polynucleotide sequences encoding the polypeptides that are to be cyclised such that during amplification an external source of heat is constantly and evenly applied to a reaction vessel and/or applied to a reaction container in which amplification is being carried out, wherein the constant and even application of heat to the reaction vessel and/or to the reaction container maintains the gel forming agent in a liquid phase for amplification of the polynucleotide sequence prior to in vitro polypeptide expression, such that more than three (3) million monodisperse w/o emulsion droplets are generated.
24. The method of claim 18, wherein following amplification the gel forming agent is solidified by lowering the temperature of the reaction vessel and/or the reaction container to form a gel matrix that traps the plurality of amplicons in the gel matrix of the monodisperse w/o emulsion droplet.
25. The method of claim 18 wherein the gel matrix is a gel bead.
26. The method of claim 25 wherein the plurality of w/o/w emulsion droplets are disrupted to release the gel bead from each of the plurality of multicompartment systems.
27. The method of claim 18 wherein the ultra-low gelling temperature agarose comprises 1% agarose.
28. The method of claim 18 wherein each aqueous droplet is substantially spherical in shape with a diameter of between 0.1 uM to 100 uM.
29. The method of claim 23 wherein the constant and even application of heat applied to the reaction vessel and/or applied to the reaction container is maintained at a temperature of about 40 C.
30. The method according to claim 18, wherein the aqueous droplet comprises detectable fluorescent reporters, optionally, wherein the detectable fluorescent reporters are selected from the group consisting of fluorescein, fluorescent proteins and fluorophores.
31. The method according to claim 18 wherein said screening comprises sorting the multicompartment systems in a high-throughput manner comprising a method selected from the group consisting of fluorescence activated cell sorting (FACS) and fluorescence activated droplet sorting (FADS).
32. The method according to claim 31 wherein the multicompartment systems are sorted based on the effect of the cyclic peptide on a pharmacological or biological activity.
33. The method according to claim 32 wherein determining the effect of the cyclic peptide on a pharmacological or biological activity is performed using a colorimetric assay or fluorometric assay.
34. The method according to claim 32 wherein the pharmacological or biological activity is selected from: binding affinity to a ligand, effect on enzyme catalysis, substrate specificity or selectivity, activation or inhibition of a biochemical process, and/or effect on protein-protein interaction(s).
35. The method of claim 18 wherein the multicompartment systems comprise one or more of: a) a ligand; b) an enzyme; c) a biochemical system; or d) at least two proteins that interact with one another.
36. The method of claim 18 wherein: (a) the compartment comprises an enzyme and a corresponding substrate; or (b) the encoding nucleic acid that encodes the cyclic peptide also encodes one or more of: a) a ligand; b) an enzyme; c) components of a biochemical system; or d) at least two proteins that interact with one another.
37. The method of claim 35 wherein: (a) the cyclic peptide is linked to the encoding nucleic acid in the compartment via a ligand; (b) only cyclic peptides with affinity for the ligand bind to the encoding nucleic acid, and only those nucleic acids bound by cyclic peptides via the ligand acquire changed optical properties enabling their selection; and/or (c) the multicompartment systems are sorted based on the effect on enzyme catalysis, the multicompartment systems comprise a substrate for the enzyme.
Description
4 BRIEF DESCRIPTION OF FIGURES
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
DETAILED DESCRIPTION OF PREFERRED EMBODIMENTS
[0101] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art, such as in the arts of peptide chemistry, microfluidics, nucleic acid chemistry, molecular genetics and cloning, and biochemistry. Standard techniques are used for molecular biology, genetic and biochemical methods (see Sambrook et al., Molecular Cloning: A Laboratory Manual, 3rd ed., 2001, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; Ausubel et al., Short Protocols in Molecular Biology (1999) 4th ed., John Wiley & Sons, Inc.), which are incorporated herein by reference.
[0102] A linear polypeptide is a peptide that is not in a circular form, and generally has both a carboxy-terminal amino acid with a free carboxy-terminus and an amino-terminal amino acid with a free amino terminus.
[0103] As used herein, the word intein means a naturally-occurring or artificially constructed polypeptide sequence embedded within a precursor protein that can catalyse a splicing reaction during post-translation processing of the protein. A list of some of the known inteins is published at http://www.inteins.com.
[0104] A split intein is an intein that has two or more separate components not fused to one another.
[0105] As used herein, the word interposed or intervening means placed in between. Thus, in a polypeptide having a first sequence interposed between a second and a third sequence (or a second and third sequence with an intervening first sequence), the chain of amino acids making up the first sequence is physically located in between the chain of amino acids making up the second sequence and the chain of amino acids making up the third sequence.
[0106] In comparison, a cyclic polypeptide is a polypeptide that has been cyclised. The term cyclic means having constituent atoms forming a ring. When referring to a peptide, the term cyclise means to make the peptide into a cyclic or cyclised form. Thus, for example, a linear peptide is cyclised when its free amino-terminus is covalently bonded to its free carboxy-terminus (i.e., in a head to tail format) such that no free carboxy- or amino terminus remains in the peptide.
[0107] As used herein, the word spontaneously means the action described occurs without the addition of an exogenous substance. For example, a precursor polypeptide spontaneously splices to yield a cyclic peptide when nothing is added to the host system other than the precursor polypeptide or a nucleic acid molecule encoding the precursor polypeptide. In comparison, a precursor polypeptide within a host system does not spontaneously splice in the host system if an agent extraneous to the host system is required to generate the cyclic peptide.
[0108] As used herein, the phrase expression vector means a vehicle that facilitates transcription and/or translation of a nucleic acid molecule in a suitable in vitro or in vivo system. An expression vector is inducible when adding an exogenous substance to a host system containing the expression vector causes the vector to be expressed (e.g., causes a nucleic acid molecule within the vector to be transcribed into mRNA).
[0109] As used herein, the phrase regulatory sequence means a nucleotide sequence which modulates expression (e.g., transcription) of a nucleic acid molecule. For example, promoters and enhancers are regulatory sequences.
[0110] The invention brings novel features and attendant advantages, which can be explained, in more detail in connection with the generation of polypeptidesin particular, cyclic polypeptidesidentifiably tagged (or labelled) by co-compartmentalisation with their encoding polypeptide. In particular, the invention provides novel means for performing functional assays on genetic libraries, which cannot be achieved by known genetic libraries. Prior art libraries, such as phage display libraries, are compatible with affinity-based assays, but do not effectively interface with functional assays. The majority of pharmaceutical assays are functional, in part because a functional assay provides a more accurate indication of biological (or physiological) activity than an affinity assay. Therefore, there is an unmet need for a technology that combines the diversity and high-throughput of a genetic library with the flexibility to be interfaced with a functional assay.
4.1 Compartments
[0111] In the first aspect, the invention relates to a method for expressing a cyclic polypeptide within a compartment, comprising the step of forming a compartment containing a polynucleotide, the polynucleotide comprising a sequence which encodes the cyclic polypeptide.
[0112] A compartment is comprised of a physical boundary which delineates an interior volume separate from an external environment. In embodiments, the compartment is substantially spherical. The compartment may be a particle in solution, for example a particle suspended in solution, such as a colloid, or a droplet in emulsion.
[0113] The interior volume of the compartment must be sufficient to contain at least one polynucleotide species, and moieties, including media, such as aqueous solutions, water, and oils, though still remaining capable of energy exchange with the external environment. Compartmentalisation is a process by which a compartment is formed. When an entity is described as being compartmentalised, this means that the entity is contained within a compartment.
[0114] As used herein, the term compartmentalisation is synonymous with encapsulation. Accordingly, the term compartment is synonymous with capsule.
[0115] The compartments of the present invention require appropriate physical properties to allow the working of the invention. The formation and the composition of the compartments advantageously does not abolish the function of the machinery for the expression of the polynucleotides or the activity of the polypeptides. The appropriate system(s) may vary depending on the precise nature of the requirements in each application of the invention, as will be apparent to the skilled person.
[0116] Suitable compartments and compartment-forming materials include droplets of emulsion, lipid vesicles, and microcapsules.
4.1.1 Compartment Sizes
[0117] The preferred compartment size will vary depending upon the precise requirements of any individual selection process that is to be performed according to the present invention. In all cases, there will be an optimal balance between gene library size, the required enrichment and the required concentration of components in the individual compartments to achieve efficient expression and reactivity of the polypeptides.
[0118] The processes of expression occurs within each individual compartment provided by the present invention. Both in vitro transcription and coupled transcription-translation become less efficient at sub-nanomolar DNA concentrations. Because of the requirement for only a limited number of DNA molecules to be present in each compartment, this therefore sets a practical upper limit on the possible compartment size. Preferably, the mean volume of the compartments is less than 5.210.sup.16 m.sup.3, (corresponding to a spherical compartment of diameter less than 10 m, more preferably less than 6.510.sup.17 m.sup.3 (5 m diameter), more preferably about 4.210.sup.18 m.sup.3 (2 m diameter) and ideally about 910.sup.18 m.sup.3 (2.6 m diameter).
[0119] The effective DNA or RNA concentration in the compartments may be artificially increased by various methods that will be well-known to those versed in the art. These include, for example, the addition of volume excluding chemicals such as polyethylene glycols (PEG) and a variety of gene amplification techniques, including transcription using RNA polymerases including those from bacteria such as E. coli (Roberts, 1969; Blattner and Dahlberg, 1972; Roberts et al., 1975; Rosenberg et al., 1975), eukaryotes e. g. (Weil et al; 1979; Manley et al., 1983) and bacteriophage such as T7, T3 and SP6 (Melton et al., 1984); the polymerase chain reaction (PCR) (Saiki et al., 1988); Qb replicase amplification (Miele et al., 1983; Cahill et al., 1991; Chetverin and Spirin, 1995; Katanaev et al., 1995); the ligase chain reaction (LCR) (Landegren et al., 1988; Barany, 1991); and self-sustained sequence replication system (Fahy et al., 1991) and strand displacement amplification (Walker et al., 1992). Gene amplification techniques requiring thermal cycling such as PCR and LCR may be used if the emulsions and the in vitro transcription or coupled transcription-translation systems are thermostable (for example, the coupled transcription-translation systems can be made from a thermostable organism such as Thermus aquaticus).
[0120] Increasing the effective local nucleic acid concentration enables larger compartments to be used effectively. This allows a preferred practical upper limit to the compartment volume of about 5.210.sup.16 m.sup.3(corresponding to a sphere of diameter 10 m).
[0121] The compartment size is preferably sufficiently large to accommodate all of the required components of the biochemical reactions that are needed to occur within the compartment. For example, in vitro, both transcription reactions and coupled transcription-translation reactions require a total nucleoside triphosphate concentration of about 2 mM. For example, in order to transcribe a gene to a single short RNA molecule of 500 bases in length, this would require a minimum of 500 molecules of nucleoside triphosphate per compartment (8.3310.sup.22 moles). In order to constitute a 2 mM solution, this number of molecules is contained within a compartment of volume 4.1710.sup.19 litres (4.1710.sup.22 m.sup.3 which if spherical would have a diameter of 93 nm).
[0122] Furthermore, particularly in the case of reactions involving translation, it is to be noted that the ribosomes necessary for the translation to occur are themselves approximately 20 nm in diameter. molecule and one cyclic polypeptide.
[0123] To ensure that the polynucleotide and polypeptides may not diffuse between compartments, the contents of each compartment are preferably isolated from the contents of the surrounding compartments, so that there is no or little exchange of the polynucleotide and polypeptide between the compartments over the timescale of the experiment. The physical boundary of the compartment may be formed from any material that can prevent egress of the enclosed polynucleotide, and any associated polypeptide, out of the compartment. The compartment may be semi-permeable, thus forming a barrier to the movement of one component, such as a polynucleotide, whilst permitting the movement of other components, such as buffer constituents or nucleotide phosphates (e.g. nucleotide triphosphates). Therefore, the interior of a semi-permeable compartment may be a thermodynamically open system, allowing both matter and energy to cross its boundary, albeit in a selective manner.
[0124] Alternatively, the compartment may be impermeable, forming a barrier to the movement of all components,
[0125] Hence, the preferred lower limit for compartments is a diameter of approximately 0.1 m (100 nm).
[0126] Therefore, the compartment volume is preferably of the order of between 5.210.sup.22 m.sup.3 and 5.210.sup.16 m.sup.3 corresponding to a sphere of diameter between 0.1 m and 10 m, more preferably of between about 5.210.sup.19 m.sup.3 and 6.510.sup.17 m.sup.3 (1 m and 5 m). Sphere diameters of about 2.6 m are most advantageous.
[0127] It is no coincidence that the preferred dimensions of the compartments (droplets of 2.6 m mean diameter) closely resemble those of bacteria, for example, Escherichia are 1.1-1.52.0-6.0 m rods and Azotobacter are 1.5-2.0 m diameter ovoid cells. In its simplest form, Darwinian evolution is based on a one genotype one phenotype mechanism. The concentration of a single compartmentalised gene, or genome, drops from 0.4 nM in a compartment of 2 m diameter, to 25 M in a compartment of 5 m diameter. The prokaryotic transcription/translation machinery has evolved to operate in compartments of 1-2 m diameter, where single genes are at approximately nanomolar concentrations. A single gene, in a compartment of 2.6 m diameter is at a concentration of 0.2 nM. This gene concentration is high enough for efficient translation. Compartmentalisation in such a volume also ensures that even if only a single molecule of the polypeptide is formed it is present at about 0.2 nM. The volume of the compartment is thus selected bearing in mind the requirements for transcription and translation of the polynucleotide.
[0128] The size of emulsion compartments may be varied simply by tailoring the emulsion conditions used to form the emulsion according to requirements of the selection system. The larger the compartment size, the larger is the volume that will be required to compartmentalise a given polynucleotide library, since the ultimately limiting factor will be the size of the compartment and thus the number of compartments possible per unit volume.
[0129] The size of the compartments is selected not only having regard to the requirements of the transcription/translation system, but also those of the selection system employed for the polynucleotide. Thus, the components of the selection system, such as a chemical modification system, may require reaction volumes and/or reagent concentrations which are not optimal for transcription/translation. Such requirements may be accommodated by a secondary re-encapsulation step. Empirical determination of optimal compartment volume and reagent concentration is preferred.
[0130] The compartment is preferably obtainable on a microfluidic scale. For example, the largest diameter of the compartment (e.g. the Outer Diameter (O.sub.d) of
[0131] A wide variety of compartmentalisation procedures are available (see Benita, 1996) and may be used to create the compartments used in accordance with the present invention. Indeed, more than 200 compartmentalisation methods have been identified in the literature (Finch, 1993). These include membrane enveloped aqueous vesicles such as lipid vesicles (liposomes) (New, 1990) and non-ionic surfactant vesicles (van Hal et al., 1996). These are closed-membranous capsules of single or multiple bilayers of non-covalently assembled molecules, with each bilayer separated from its neighbour by an aqueous compartment. In the case of liposomes the membrane is composed of lipid molecules; these are usually phospholipids but sterols such as cholesterol may also be incorporated into the membranes (New, 1990). A variety of enzyme-catalysed biochemical reactions, including RNA and DNA polymerisation, can be performed within liposomes (Chakrabarti et al., 1994; Oberholzer et al., 1995a; Oberholzer et al., 1995b; Walde et al., 1994; Wick & Luisi, 1996).
[0132] With a membrane-enveloped vesicle system much of the aqueous phase is outside the vesicles and is therefore non-compartmentalised. This continuous, aqueous phase is removed or the biological systems in it inhibited or destroyed (for example, by digestion of nucleic acids with DNase or RNase) in order that the reactions are limited to the compartments (Luisi et al., 1987).
[0133] Enzyme-catalysed biochemical reactions have also been demonstrated in compartments generated by a variety of other methods. Many enzymes are active in reverse micellar solutions (Bru & Walde, 1991; Bru & Walde, 1993; Creagh et al., 1993; Haber et al., 1993; Kumar et al., 1989; Luisi & B., 1987; Mao & Walde, 1991; Mao et al., 1992; Perez et al., 1992; Walde et al., 1994; Walde et al., 1993; Walde et al., 1988) such as the AOT-isooctane-water system (Menger & Yamada, 1979).
[0134] Compartments can also be generated by interfacial polymerisation and interfacial complexation (Whateley, 1996). Compartments of this sort can have rigid, nonpermeable membranes, or semipermeable membranes. Semipermeable compartments bordered by cellulose nitrate membranes, polyamide membranes and lipid-polyamide membranes can all support biochemical reactions, including multienzyme systems (Chang, 1987; Chang, 1992; Lim, 1984). Alginate/polylysine compartments (Lim & Sun, 1980), which can be formed under very mild conditions, have also proven to be very biocompatible, providing, for example, an effective method of encapsulating living cells and tissues (Chang, 1992; Sun et al., 1992).
4.1.2 Emulsions
[0135] Non-membranous compartmentalisation systems based on phase partitioning of an aqueous environment in a colloidal system, such as an emulsion, may also be used. Preferably, the compartments of the present invention are formed from emulsions; heterogeneous systems of two immiscible liquid phases with one of the phases dispersed in the other as droplets of microscopic or colloidal size (Becher, 1957; Sherman, 1968; Lissant, 1974; Lissant, 1984).
[0136] Emulsions may be produced from any suitable combination of immiscible liquids. Preferably the emulsion of the present invention has water (containing the biochemical components) as the phase present in the form of finely divided droplets (the disperse, internal or discontinuous phase) and a hydrophobic, immiscible liquid (an oil) as the matrix in which these droplets are suspended (the nondisperse, continuous or external phase). Such emulsions are termed water-in-oil (W/O). This has the advantage that the entire aqueous phase containing the biochemical components is compartmentalised in discreet droplets (the internal phase). The external phase, being a hydrophobic oil, generally contains none of the biochemical components and hence is inert.
[0137] The emulsion may be stabilised by addition of one or more surface-active agents (surfactants). These surfactants are termed emulsifying agents and act at the water/oil interface to prevent (or at least delay) separation of the phases. Many oils and many emulsifiers can be used for the generation of water-in-oil emulsions; a recent compilation listed over 16,000 surfactants, many of which are used as emulsifying agents (Ash and Ash, 1993). Suitable oils include light white mineral oil and non-ionic surfactants (Schick, 1966) such as sorbitan monooleate (Span80; ICI) and polyoxyethylenesorbitan monooleate (Tween80; ICI).
[0138] The use of anionic surfactants may also be beneficial. Suitable surfactants include sodium cholate and sodium taurocholate. Particularly preferred is sodium deoxycholate, preferably at a concentration of 0.5% w/v, or below. Inclusion of such surfactants can in some cases increase the expression of the polynucleotides and/or the activity of the polypeptides. Addition of some anionic surfactants to a non-emulsified reaction mixture completely abolishes translation. During emulsification, however, the surfactant is transferred from the aqueous phase into the interface and activity is restored. Addition of an anionic surfactant to the mixtures to be emulsified ensures that reactions proceed only after compartmentalisation.
[0139] Creation of an emulsion generally requires the application of mechanical energy to force the phases together. There are a variety of ways of doing this which utilise a variety of mechanical devices, including stirrers (such as magnetic stir-bars, propeller and turbine stirrers, paddle devices and whisks), homogenisers (including rotor-stator homogenisers, high-pressure valve homogenisers and jet homogenisers), colloid mills, ultrasound and membrane emulsification devices (Becher, 1957; Dickinson, 1994). In a preferred embodiment, emulsions are created by microfluidic processes. Most preferably, microfluidic emulsions are obtained on a droplet-by-droplet basis, one droplet being produced at a time.
[0140] Aqueous compartments formed in water-in-oil emulsions are generally stable with little if any exchange of polynucleotides or polypeptides between compartments. Additionally, biochemical reactions proceed in emulsion compartments. Moreover, complicated biochemical processes, notably gene transcription and translation are also active in emulsion compartments. The technology exists to create emulsions with volumes all the way up to industrial scales of thousands of litres (Becher, 1957; Sherman, 1968; Lissant, 1974; Lissant, 1984).
[0141] In embodiments, the compartment is a droplet of emulsion, such as a droplet of a primary emulsion (e.g. water-in-oil (w/o)). In embodiments involving emulsions, the interface between the outermost layer of dispersed (or discontinuous) phase and the continuous phase constitutes the surface of the boundary of the compartment. In embodiments, the droplet is a microfluidic droplet. Microfluidic droplets can be obtained using a microfluidic device, such as a microfluidic device on a chip. A microfluidic droplet of water in oil emulsion can be obtained on a microfluidic device, preferably a hydrophobic microfluidic device. This can be achieved by using an aqueous phase as the first phase (also referred to as the dispersed or internal phase) and a non-aqueous phase (e.g. lipophilic) as the second phase (also referred to as the continuous or external phase).
[0142] A droplet of a double emulsion can also be obtained on a microfluidic device. For example, a droplet of water-in-oil-in-water (w/o/w) emulsion can be obtained on a microfluidic device, preferably a hydrophilic microfluidic device. This can be achieved by using a water-in-oil emulsion as the discontinuous phase and an aqueous phase fluid as the continuous phase.
Thus, a double emulsion can be produced in two stages. First, a single emulsion is obtained (such as water-in-oil) and, secondly, the single emulsion is its self emulsified to obtain the double emulsion. The first and second stages can be carried out in tandem, for example by connecting an output from a first microfluidic device to an input of a second microfluidic device. This example is particularly advantageous because the microfluidic devices can be obtained commercially and therefore the process does not require any specialist equipment. Alternatively, the single emulsion can be collected and, optionally, stored after the first step and the second step carried out later. An arbitrary number of emulsion layers may be obtained using three, four, or more microfluidic devices operating in tandem in the manner described.
4.2 Polynucleotide
[0143] In the invention, it is desired that the compartment is formed around a polynucleotide, or that a polynucleotide is inserted into the compartment after it has been formed. The method of the present invention requires that there are only a limited number of polynucleotides per compartment. This ensures that the polypeptide of an individual polynucleotide will be isolated from other polypeptides. Thus, coupling between polynucleotide and polypeptide will be highly specific. The enrichment factor is greatest with on average one or fewer polynucleotides per compartment, the linkage between nucleic acid and the activity of the encoded polypeptide being as tight as is possible, since the polypeptide of an individual polynucleotide will be isolated from the products of all other polynucleotides. However, even if the theoretically optimal situation of, on average, a single polynucleotide or less per compartment is not used, a ratio of 5, 10, 50, 100 or 1000 or more polynucleotides per compartment may prove beneficial in sorting a large library. Subsequent rounds of sorting, including renewed encapsulation with differing polynucleotide distribution, will permit more stringent sorting of the polynucleotides. Preferably, there is a single polynucleotide, or fewer, per compartment.
[0144] The compartment may contain a single polynucleotide (i.e. a single molecule of polynucleotide). Alternatively, the compartment may contain a plurality of polynucleotides (i.e. more than one molecule of polynucleotide, e.g. two molecules of polynucleotide). Preferably, where the compartment contains a plurality of polynucleotides, all of those polynucleotides have identical, or substantially identical, polynucleotide sequence. Where a plurality of polynucleotides within a compartment have substantially identical sequence, this means that the sequence of one polynucleotide in a compartment does not differ from the sequence of another polynucleotide in the same compartment by more than is dictated by the accumulated error rate of the method used to synthesise the polynucleotides.
[0145] The number of polynucleotides in a compartment can be controlled statistically by a suitable dilution of the bulk medium containing the polynucleotide prior to the compartmentalisation step.
[0146] When the compartment is a droplet of emulsion, the polynucleotide is included in the discontinuous phase fluid prior to emulsification. The number of polynucleotides in a compartment is controlled statistically by a suitable dilution of the discontinuous phase fluid. For example, the discontinuous phase fluid may be diluted so that the average number of polynucleotides in a single droplet is not more than one. After emulsification, a discontinuous phase so diluted will form the internal volume of the emulsion droplet and each droplet thus produced will contain either 0 or 1 polynucleotides.
[0147] The polynucleotides of the invention encode a cyclic polypeptide. When expressed, a linear polypeptide may be produced from the polynucleotide. The linear polypeptide may then undergo a process of cyclisation to obtain the desired cyclic polypeptide. Cyclisation of the polypeptide may occur spontaneously, i.e. the polypeptide is self-cyclising. The sequence of amino acids in the final cyclic polypeptide may not be the same as the amino acid sequence of the linear peptide from which it is obtained. For example, the process of cyclisation may truncate one or more N-terminal residues from the linear peptide. Alternatively, the process of cyclisation may truncate one or more C-terminal residues from the linear polypeptide. In some embodiments, the process of cyclisation may truncate one or more residues from both of the N- and C-termini of the linear polypeptide. The linear polypeptide may also be referred to as the pre-cyclic polypeptide. The sequence of the cyclic polypeptide may refer to the sequence of amino acids which make up the cyclic polypeptide or the sequence of amino acids comprised within the linear polypeptide that will be included in the cyclic polypeptide after cyclisation. The sequence of the cyclic polypeptide starts with the amino acid residue which was the N-terminal residue of the cyclic polypeptide sequence comprised within the linear polypeptide. In some embodiments, the sequence of the cyclic polypeptide is the same as the sequence of the linear polypeptide.
[0148] The sequence encoding the cyclic polypeptide refers to the sequence of nucleotides in the polynucleotide that encode the portion of the linear polypeptide that will be included in the cyclic polypeptide after cyclisation.
[0149] A polynucleotide is a molecule or construct selected from the group consisting of a DNA molecule, an RNA molecule, a partially or wholly artificial nucleic acid molecule consisting of exclusively synthetic or a mixture of naturally-occurring and synthetic bases, any one of the foregoing linked to a polypeptide, and any one of the foregoing linked to any other molecular group or construct. Advantageously, the other molecular group or construct may be selected from the group consisting of nucleic acids, polymeric substances, particularly beads, for example polystyrene beads, and magnetic or paramagnetic substances such as magnetic or paramagnetic beads. A polynucleotide may also be referred to herein as a nucleic acid or a nucleic acid molecule.
[0150] The nucleic acid portion of the polynucleotide may comprise suitable regulatory sequences, such as those required for efficient expression of the polypeptide, for example promoters, enhancers, translational initiation sequences, polyadenylation sequences, splice sites and the like.
[0151] Nucleic acids molecules within the invention include those that encode a polypeptide having a first portion of a split intein, a second portion of a split intein, and a target peptide positioned in between the first portion of a split intein and the second portion of a split intein. In one embodiment of the invention, expression of the nucleic acid molecule results in a polypeptide that spontaneously splices to yield a cyclized form of the target peptide. In another embodiment of the invention, expression of the nucleic acid molecule results in a polypeptide that is a splicing intermediate of a cyclized form of the target peptide. The nucleic acids of the invention can be prepared according to the methods for preparing and manipulating nucleic acid molecules generally known in the art (See, e.g., Ausubel et al., Current Protocols in Molecular Biology, New York: John Wiley & Sons, 1997; Sambrook et al., Molecular Cloning: A laboratory Manual (2nd Edition), Cold Spring Harbor Press, 1989). For example, a nucleic acid molecule within the invention can be made by separately preparing a polynucleotide encoding the first portion of a split intein, a polynucleotide encoding the second portion of a split intein, and a polynucleotide encoding the target peptide. The three polynucleotides can be ligated together to form a nucleic acid molecule that encodes a polypeptide having the target peptide interposed between the first portion of a split intein and the second portion of a split intein
[0152] Inteins that are not split in their natural state (i.e., those that exist as one continuous chain of amino acids) can be artificially split using known techniques. For example, two or more nucleic acid molecules encoding different portions of such inteins can be made so that their expression yields two or more artificially split intein components. See, e.g., Evans et al, J. Biol. Chem. 274:18359, 1999; Mills et al, Proc. Natl. Acad. Sci. USA 95:3543, 1998. The nucleic acids that encode such non-naturally occurring intein components (portions) can be used in the invention. Those nucleic acid molecules that encode non-naturally occurring split intein portions which efficiently interact on the same precursor polypeptide to yield cyclic peptides or splicing intermediates are preferred.
[0153] Examples of non-naturally occurring split inteins from which such nucleic acid molecules can be derived include Psp Pol-1 (Southworth, M. W., et al, The EMBO J. 17:918, 1998), Mycobacterium tuberculosis RecA intein, (Lew, B. M., et al, J. Biol. Chem. 273:15887, 1998; Shingledecker, K., et al, Gene 207:187, 1998; Mills, K. V., et al, Proc. Natl. Acad. Sci. USA 95:3543, 1998), Ssp DnaB/Mxe GyrA (Evans, T. C. et al, J. Biol. Chem. 274:18359, 1999), and Pfu (Otomo et al, Biochemistry 38:16040, 1999; Yamazaki et al, J. Am. Chem. Soc.120:5591, 1998).
[0154] In embodiments, the polynucleotide may be associated with a polypeptide encoded by the polynucleotide by a bond, such as a covalent or a non-covalent bond. Examples of non-covalent bonds include ionic bonds, hydrogen bonds, and induced dipole interactions (also known as Van-der-Waals forces). In a preferred embodiment, the bond is covalent. This may be achieved by the method of mRNA display, described above. In this embodiment, the polynucleotide comprises a 3 peptidyl acceptor region, such as a puromycin moiety or an amino acid moiety. When such a polynucleotide is translated, the terminal aminoacyl transferase reaction results in a covalent bond between the nascent polypeptide and the 3 peptidyl acceptor region. In a preferred embodiment, a linker is provided comprising a 5 end that specifically hybridises to the 3 end of the polynucleotide and a 3 end that comprises a peptidyl acceptor region (or moiety).
[0155] The polynucleotide of the invention may also be modified or engineered to place specific codons in desired locations, either on the polynucleotide its self or in an mRNA encoded by the polynucleotide. This can be useful in embodiments wherein some tRNAs (those possessing the corresponding anticodon) have been loaded with non-natural, e.g. non-proteinogenic, residues, as described in more detail below (a re-assigned codon set). However, manipulation of the codons in the polynucleotide of the invention is not essential to the functioning of embodiments employing such non-canonical acyl-tRNAs.
4.3 Expression Vectors
[0156] The expression vectors of the present invention can be prepared by inserting polynucleotides encoding a target peptide into any suitable expression vector that can facilitate expression of the polynucleotide. Such suitable vectors include plasmids, bacteriophages, and viral vectors. A large number of these are known in the art, and many are commercially available or obtainable from the scientific community. Those of skill in the art can select suitable vectors for use in a particular application based upon, e.g., the type of system selected (e.g., in vitro systems, prokaryotic cells such as bacteria, and eukaryotic cells such as yeast or mammalian cells) and the expression conditions selected.
[0157] Expression vectors within the invention can include a stretch of nucleotides that encodes a target polypeptide and a stretch of nucleotides that operate as a regulatory domain that modulates or controls expression (e.g., transcription) of nucleotide sequences within the vector. For example, the regulatory domain can be a promoter or an enhancer.
[0158] Expression vectors within the invention can include nucleotide sequences that encode a peptide that facilitates screening of the cyclized form of the target peptide or splicing intermediate for a particular characteristic (e.g., a DNA-binding domain, an affinity tag such as a chitin-binding domain or a biotin tag; a coloured or light-emitting label; a radioactive tag; etc.), or purifying the cyclized form of the target peptide or splicing intermediate (e.g., an affinity tag such as a chitin-binding domain, a biotin tag, a coloured or light-emitting label; a radioactive tag; etc.).
[0159] In preferred embodiments, the expression vectors within the invention are produced with restriction sites both between and within the nucleic acid sequences that encode the split intein portions to enable the cloning of a wide variety of cyclization targets or splicing intermediates. In some embodiments, an expression vector of the invention can be an inducible expression vector, such as an arabinose inducible vector. The inducer may be capable of permeating the compartment material of the invention.
4.4 Polypeptide
[0160] Several methods of polypeptide cyclisation are known in the art. Polypeptide cyclisation can be carried out between two side chains, between a side chain and a terminal group (i.e. N- or C-terminal), or between two terminal groups (i.e. head to tail or backbone cyclisation). One such method of side chain to side chain cyclisation can be carried out enzymatically. There are many enzymes that would cyclize a peptide sequence. For example, transglutaminase can catalyse an aminotransferase reaction between a glutamine side chain and a lysine side chain resulting in a covalent isopeptide bond between the two side chains. If the glutamine and lysine are on the same polypeptide, that polypeptide is cyclised by this reaction. Backbone cyclisation can similarly be brought about enzymatically, for example by treatment with subtilisin. Other non-limiting examples are ProcM and PatG. Typically, these methods rely on the presence of a leader sequence of amino acids in the polypeptide. A leader sequence recruits and directs the action of its cognate enzyme by specifically interacting with the enzyme. Each enzyme may be specific for a particular leader sequence. A leader sequence for a particular enzyme may be added to a polypeptide of the invention through manipulation of its encoding polynucleotide, for example by conventional molecular cloning techniques, which are within the purview of the person skilled in the art.
[0161] Methods of macrocyclisation are discussed at length by Bashiruddin and Suga, Curr. Op. in Chem. Bio., vol. 24, pp. 131-138, in particular, in the context of mRNA display, though one skilled in the art will be familiar with the use of these methods outside of mRNA display technology. To synthesize macrocyclic peptides using the translation machinery, the most basic approach is through disulphide bonds between cysteine residues. However, their susceptibility to reduction in intracellular environments makes them undesirable for some applications. Therefore, methods of forming a non-reducible covalent bond for cyclization through simple chemical post-translational modifications have been devised. Methods of bridging two primary amines between the N-terminus and a lysine sidechain using disuccinimidyl glutarate or the sulfhydryl group of two cysteine residues using dibromoxylene have been used to successfully generate macrocyclic peptides. A similar method of producing bicyclic peptides via thioether-crosslinking of three cysteine residues has been also reported (Heinis & Winter, Nat Chem Biol, 5 (2009), pp. 502-507). An advantage of these methods is their applicability to the standard proteinogenic amino acids. However, when more than two reactive residues appear in the random regions of these libraries, the crosslinking patterns can become scrambled potentially causing difficulty in deconvoluting the outcome of selections based on such cyclization methods.
[0162] A technically more demanding method than the above, but far more reliable for the construction of macrocyclic peptides, is based on the concept of manipulating the genetic code, known as genetic code reprogramming, where designated codons are made vacant and then reassigned to nonproteinogenic amino acids. Two major methodologies have been reported to date, both of which utilize custom-made reconstituted translation systems.
[0163] One method takes advantage of the mischarging properties of aminoacyl-tRNA synthetases in the presence of excess amounts of nonproteinogenic amino acids, yielding the corresponding aminoacyl-tRNAs. Szostak et al. reported a method of generating peptides containing 4-selenalysine in the peptide chain followed by the selective oxidation and concomitant elimination of the seleno group to yield a dehydroalanine residue. Dehydroalanine then reacts with the sulfhydryl group of cysteine via Michael addition to form a thioether bond, giving rise to lanthionine-like macrocyclic peptides.
[0164] The other method involves flexible tRNA acylation ribozymes, known as flexizymes, developed by Suga et al., which facilitate the preparation of a wide array of nonproteinogenic aminoacyl tRNAs with nearly unlimited choice. The combination of a custom-made in vitro translation system with flexizymes, referred to as the FIT (Flexible In vitro Translation) system, allows the ribosomal synthesis of macrocyclic peptides using nonproteinogenic amino acids capable of crosslinking with other proteinogenic or nonproteinogenic residues. The FIT system allows for a wide variety of cyclization methods, for instance, methyllanthionine-like macrocyclic peptides can be synthesized through the incorporation of vinylglycine which is thermally isomerized to dehydrobutyrine which can then form a thioether bond with cysteine residues (Y. Goto, K. Iwasaki, K. Torikai, H. Murakami, H. Suga; Chem Commun (Camb), 23 (2009), pp. 3419-3421). Translation of peptides containing a benzylamine group designated by the N-terminal initiating amino acid and a downstream 5-hydroxytryptophan is a unique method of mild oxidative macrocyclisation forming a fluorogenic indole linkage (Y. Yamagishi, H. Ashigai, Y. Goto, H. Murakami, H. Suga; ChemBioChem, 10 (2009), pp. 1469-1472). Moreover, ribosomal synthesis of head-to-tail linked peptides can also be produced through the C-terminal Cys-Pro-HOG (glycolic acid) sequence or programmed peptidyl-tRNA drop-off containing the C-terminal Cys-Pro sequence (T. Kawakami, Nat Chem Biol, 5 (2009), pp. 888-890; Y Ohshiro, ChemBioChem, 12 (2011), pp. 1183-1187; T. J. Kang, Angew Chem Int Ed Engl, 50 (2011), pp. 2159-2161). In both cases, the C-terminal ester bond accelerates the self-rearrangement of N.fwdarw.S migration to form a C-terminal diketopiperadine-thioester, eventually yielding backbone-cyclized monocyclic or disulphide-bridged bicyclic peptides. The most convenient and reliable method of cyclization has been through the translation of peptides with an N-chloroacetyl-amino acid initiator that can react with a downstream cysteine (Y Goto, A. Ohta, Y Sako, Y Yamagishi, H. Murakami, H. Suga; ACS Chem Biol, 3 (2008), pp. 120-129). The advantage of this method is the spontaneous and selective thioether bond formation between the N-terminal chloroacetyl group and the sulfhydryl group of the closest cysteine residue. A single exception is that a cysteine residue adjacent to the N-chloroacetyl-amino acid cannot react with the chloroacetyl group due to ring constraint, thus leaving a free sulfhydryl group at this position. However, this selectivity turns out be a convenient way to translate fused-bicyclic peptides, having a thioether (sulphide) bond between the N-terminus and the second cysteine and a disulphide bond between the first and third cysteine residues. Importantly, it has been demonstrated that the FIT system facilitates the translation of peptides containing D-amino acids, N-methyl-amino acids, N-alkylglycines, and those with noncanonical sidechains.
[0165] In other methods, polypeptide cyclisation can be achieved spontaneously by intramolecular interactions within the polypeptide. Such can be achieved, for example, by the fusion of sequences derived from inteins to the desired cyclic polypeptide.
[0166] Numerous methods of making nucleic acids encoding peptides of a known or random sequence are known in art. For example, polynucleotides having a predetermined or a random sequence can be prepared chemically by solid phase synthesis using commercially available equipment and reagents. Polymerase chain reaction can also be used to prepare polynucleotides of known or random sequences. See, e.g., Ausubel et al, supra. As another example, restriction endonucleases can be used to enzymatically digest a larger nucleic acid molecule or even whole chromosomal DNA into a plurality of smaller polynucleotide fragments that can be used to prepare nucleic acid molecules of the invention.
[0167] Polynucleotides that encode peptide sequences to be cyclized are preferably prepared so that one terminus of the polynucleotide encodes an asparagine, serine, cysteine, or threonine residue to facilitate the cyclization reaction. For the same reason polynucleotides that encode peptide sequences for production of splicing intermediates are preferably prepared so that the terminus encodes an amino acid other than an asparagine, serine, cysteine, or threonine residue so that the cyclization reaction is prevented.
[0168] Once generated, conventional methods can be used to ligate nucleic acid molecules encoding intein portions to a nucleic acid molecule encoding a target peptide (or peptide within a splicing intermediate) to form a larger nucleic acid molecule encoding a polypeptide having the first intein portion-target peptide-second intein portion order. See, e.g., Ausubel et al, supra.
4.4.1 Siclopps
[0169] The trans-splicing ability of split inteins has been exploited to develop a general method of producing cyclic peptides and splicing intermediates displaying peptides in a looped conformation (PCT/US1999/030162). In this method, a target peptide is interposed between two portions of a split intein in a precursor polypeptide. The two portions of the split intein physically come together to form an active intein in a conformation that also forces the target peptide into a loop configuration. In this configuration, the ester isomer of the amino acid at the junction between one of the intein portions (e.g., I.sub.N) and the target peptide is stabilized such that heteroatom from the other portion of the intein (e.g., I.sub.C) can then react with the ester to form a cyclic ester intermediate. The active intein then catalyses the formation of an amino succinimide that liberates a cyclized form of the target peptide (i.e., a lactone form), which then spontaneously rearranges to form the thermodynamically favoured backbone cyclic peptide product (i.e., the lactam form).
[0170] By arresting the reaction at given points before liberation of the cyclic peptide, splicing intermediates bearing the target peptide in a loop configuration can be produced. To produce such peptides, nucleic acid molecules encoding a polypeptide having the target peptide sequence interposed between the two intein portions can be constructed. Introduction of these constructs into an expression vector provides a method for producing the polypeptide in an appropriate expression system, where the polypeptide can be spliced into a cyclic peptide or a splicing intermediate. Using this method, several different cyclic peptides or splicing intermediates can be prepared to generate a library of cyclized or partially-cyclized peptides that can be screened for particular characteristics.
[0171] An intein is a segment of a protein that is able to excise itself and join the remaining portions (the exteins) with a peptide bond in a process termed protein splicing. Intein-mediated protein splicing occurs after the intein-containing mRNA has been translated into a protein. This precursor protein contains three segments: an N-extein followed by the intein followed by a C-extein. After splicing has taken place, the resulting protein contains the N-extein linked to the C-extein. Sometimes, the intein of the precursor protein comes from two genes. In this case, the intein is said to be a split intein. The intein portion (or fragment) encoded by one gene interacts with the intein fragment encoded by the other gene to yield a catalytically active intein, which proceeds to excise its self and to splice together the exteins from the two genes.
[0172] If the two split intein fragments are instead positioned on opposite ends of an intervening polypeptide sequence, the process of splicing and excision produces a cyclic polypeptide with the sequence of the original intervening polypeptide. This can be achieved by conventional molecular genetics techniques, for example by cloning the sequences encoding two complementary split intein fragments into a vector with a sequence encoding the desired cyclic polypeptide. The three polynucleotide sequences are arranged in the vector so that upon expression a polypeptide is obtained having an N-terminal intein fragment, followed by the cyclic polypeptide sequence, followed by a C-terminal intein fragment, the N- and C-terminal intein fragments being capable of associating to form a functional intein that subsequently catalyses the splicing reaction that produces the cyclic polypeptide. In other words, the polynucleotide comprises a sequence encoding the N-terminal intein fragment, followed by a sequence encoding the cyclic polypeptide sequence, followed by a sequence encoding the C-terminal intein fragment. This process is known as Split-Intein Circular Ligation Of Peptides and Proteins (SICLOPPS).
[0173] Expression from a polynucleotide can be the expression of a polypeptide from a polynucleotide. Expression from a polynucleotide may also be the expression of a second polynucleotide from a first polynucleotide. For example, an RNA polynucleotide can be expressed from a DNA polynucleotide by the process of transcription by a suitable RNA polymerase. A polypeptide may be expressed from an RNA polynucleotide by the process of translation by a suitable ribosome. In some usages, expression from a polynucleotide refers to the ultimate expression of a polypeptide from its encoding genetic material, i.e. both the transcription to RNA and translation to polypeptide. The intended usage will be clear from the context.
[0174] One suitable split intein is the Npu split intein from dnaE. An example of a polypeptide according to the present invention comprising the Npu split intein may have the following sequence:
TABLE-US-00001 HHHHHHGENLYFKLQAMGMIKIATRKYLGKQNVYDIGVERYHNFALKNGFIAS NX~~~~~CLSYDTEILTVEYGILPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHDRGEQEV FEYCLEDGCLIRATKDHKFMTVDGQMMPIDEIFERELDLMRVDNLPNGTAANDENYALA A(Bolded=SEQIDNO:1)and(Italicized=SEQIDNO:4),
Wherein X is the cyclic peptide produced; X is C, S, T or any other amino acid, and denotes an amino acid of the cyclic peptide sequence. It will be apparent to one skilled in the art that any sequence may be inserted after X in the sequence above. The sequence may be one or more amino acids in length, in embodiments at least three or more amino acids in length, preferably at least six amino acids in length.
The Above Sequence Comprises the Following Constituents:
1:
HHHHHH (SEQ ID NO: 2); An optional hexahistidine tag to assist in purification, for example on a Nickle-NTA column. Other purification systems are envisaged, such as FLAG-TAG, in which case hexahistidine is replaced with the appropriate tag sequence.
TABLE-US-00002 2: (SEQIDNO:3) GENLYFKLQAMGMIKIATRKYLGKQNVYDIGVERYHNFALKNGFIASN; ContainingtheC-terminalinteinfragment. 3: X~~~~~;Thecyclicpolypeptidesequence. 4: (SEQIDNO:4) CLSYDTEILTVEYGILPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHD RGEQEVFEYCLEDGCLIRATKDHKFMTVDGQMMPIDEIFERELDLMRVD NLPNGTAANDENYALAA;containingtheN-terminal inteinfragment.
4.5 Modifying Compartment Contents
4.5.1 In Vitro Transcription and Translation
[0175] In order to co-compartmentalise the cyclic polypeptide with its encoding polynucleotide, means for expressing the polypeptide from the polynucleotide may also be enclosed within the compartment. Such means may include an in vitro transcription and translation (IVTT) system. An IVTT system may include, for example, an RNA polymerase, a ribosome, nucleotide phosphates, amino acid-loaded tRNAs, and translation factors, such as initiation and elongation factors. Suitable in vitro transcription/translation reagents are well known in the art (e.g. Isalan, M. et al (2005) PLoS Biol. 3 e64). Expression of the polynucleotide within the compartment therefore co-locates the polypeptide and polynucleotide. When the compartment is a droplet of emulsion, this can be achieved by including the IVTT components in the discontinuous (or dispersed, or internal) phase fluid prior to emulsification.
[0176] Further, acylated tRNAs preliminarily charged with a desired non-proteinogenic amino acid (or hydroxy acid) (i.e., having an activated amino acid attached thereto) can be added to a reconstituted cell-free translation (IVTT) system containing only limited natural amino acids. By correlating the codons for excluded natural amino acids with the anticodon of the tRNA acylated with a non-proteinogenic amino acid (or hydroxy acid), a peptide containing the non-proteinogenic amino acid (or hydroxy acid) can be synthesized by translation on a ribosome on the basis of genetic information of the mRNA encoded by or constituting the polynucleotide of the invention. Alternatively, a peptide containing no natural amino acid can also be synthesized by translation by adding only acylated tRNAs charged with non-proteinogenic amino acids (or hydroxy acid) to a reconstituted cell-free translation system containing no natural amino acid.
[0177] Acylated tRNAs charged with a non-proteinogenic amino acid (or hydroxy acid) can be prepared by using the artificial RNA catalysts flexizymes capable of catalysing aminoacyl-tRNA synthesis. As indicated above, these artificial RNA catalysts are capable of charging an amino acid having any side chain and also have the function of recognizing only a consensus sequence 5-RCC-3 (R=A or G) at the 3 end of tRNAs to acylate the 3 end of the tRNAs, and therefore, they can act on any tRNAs having different anticodons. Moreover, flexizymes can charge tRNAs with not only L-amino acids but also hydroxy acids (having a hydroxyl group at the -position), N-methylamino acids (having an N-methylamino acid at the -position), N-acylamino acids (having an N-acylamino group at the -position), D-amino acids and the like. Detailed description can be found in Y. Goto, H. Suga (2009) Translation initiation with initiator tRNA charged with exotic peptides Journal of the American Chemical Society, Vol. 131, No. 14, 5040-5041, WO2008/059823 entitled by TRANSLATION AND SYNTHESIS OF POLYPEPTIDE HAVING NONNATIVE STRUCTURE AT N-TERMINUS AND APPLICATION THEREOF, Goto et al., ACS Chem. Biol., 2008, 3, 120-129, WO2008/117833 entitled by PROCESS FOR SYNTHESIZING CYCLIC PEPTIDE COMPOUND, etc., the entire contents of which are incorporated herein by reference.
[0178] Other non-natural amino acids that can be ligated to a tRNA by flexizyme include amino acids having various side chains, (beta)-amino acids, (gamma)-amino acids and (delta)-amino acids, D-amino acids, and derivatives having a structure in which an amino group or a carboxyl group on the amino acid backbone is substituted. Further, unusual peptides obtained by incorporating non-natural amino acids may have a backbone structure other than normal amide bonds. For example, unusual peptides also include depsipeptides consisting of amino and hydroxy acids, polyesters produced by continuous condensation of hydroxy acids, peptides methylated at the nitrogen atom of the amide bond by introducing an N-methylamino acid, and peptides having various acyl groups (acetyl, pyroglutamic acid, fatty acids, etc.) at the N-terminus. Furthermore, cyclic peptides obtained by circularizing non-cyclic peptides consisting of an amino acid sequence bearing a pair of functional groups capable of forming a bond between them at opposite ends can also be synthesized (or cyclic N-methylpeptides can be obtained if N-methylpeptides are used). Circularization may occur under the conditions of cell-free translation (IVTT) systems with a pair of some functional groups, as exemplified by a cyclic peptide circularized via a thioether bond obtained by translation/synthesis of a peptide sequence bearing a chloroacetyl group and a cysteine group at opposite ends.
4.5.2 Polynucleotide Amplification
[0179] It can be difficult to produce enough polypeptide from a single polynucleotide to obtain a detectable signal in a subsequent assay. In embodiments, multiple copies of the polynucleotide are produced within the compartment. This can be achieved by a process of amplification, such as through the Polymerase Chain Reaction (PCR), or through the use of a Phi29 polymerase. If the components of the amplification process are contained within the compartment along with the polynucleotide, amplification can be carried out by subjecting the compartment to the necessary amplification conditions, such as thermal cycling or incubation under heating. The compartment therefore becomes a self-contained micro-reactor, in an analogous manner to that described above with respect to transcription and translation of the polynucleotide. Because the compartment forms a barrier to the movement of polynucleotides, all of the copies of the amplified polynucleotide are contained and isolated within this compartment. The compartment thus becomes a monoclonal unit, i.e. a co-localised unit of identical, or substantially identical, copies of the polynucleotide.
[0180] When the compartment is a droplet of emulsion, this is achieved by including the components of the amplification reaction in the discontinuous phase fluid prior to emulsification. The emulsion may then be subjected to the conditions necessary for amplification to the desired number of copies.
[0181] The primers for PCR can be selected or designed to amplify the whole of the desired sequence of the polynucleotide (the amplicon). For example, one primer can be designed to anneal to the beginning of the desired sequence on the template strand and a second primer can be designed to anneal to the beginning of the desired sequence on the coding strand.
[0182] When the polynucleotide encodes a SICLOPPS self-splicing polypeptide, for example, the first primer may anneal to the sequence encoding the N-terminal intein fragment on the template (or antisense) strand and the second primer may anneal to the sequence encoding the C-terminal intein fragment on the coding (or sense) strand.
[0183] Alternatively, the vector may be selected or designed to contain specific sequences for annealing primers. For example, a sequence complementary to the first primer may be inserted after the desired sequence on the template strand of the vector (i.e. after the 3 end of the desired sequence on the template strand) and a sequence complementary to the second primer may be inserted after the desired sequence on the coding strand of the vector (i.e. after the 3 end of the desired sequence on the coding strand). This option is particularly suitable when the desired sequence to be amplified is unknown, such as when inserting randomised polynucleotides into vectors for the construction of a genetic library. In this case, the primers can be selected or designed to produce polypeptide sequences, upon translation of the amplified polynucleotide, which have particular properties. For example, one primer could be designed to encode the N-terminal glutamine donor sequence Ala-Leu-Gln and the second primer could be designed to encode a C-terminal region lysine as a substrate for transglutaminase.
[0184] Preferably, the amplification reagents are isothermal amplification reagents. Techniques for isothermal amplification in agarose gels are well known in the art and include multiply-primed RCA with the Phi29 DNA polymerase, which produces a high molecular weight (>40 kb) and hyperbranched products containing amplified copies of the polynucleotide. (Michikawa, Y et al. (2008). Anal. Biochem., 383, 151-158). Amplified DNA, especially hyperbranched amplified DNA, is unable diffuse out of the bead matrix.
[0185] When the polynucleotide and the encoded product remain co-localised without compartmentalisation, the beads may be contacted with the aqueous expression solution without emulsification. The ability of the polynucleotide and the encoded product to remain co-localised depends on the concentrations and biophysical properties (e.g. size) of the encoded product.
[0186] In embodiments, the polynucleotide is amplified by the Phi29 DNA polymerase. In these embodiments, the primers may be random primers, such as polynucleotide hexamers with a random sequence of 6 nucleotides. Alternatively, the primers may be designed or selected in a similar manner as described for PCR above. An advantage of amplification by a Phi29 system is that thermal cycling is not necessary; amplification can be carried out by Phi29 by simple incubation of the reaction mixture.
[0187] In embodiments, Phi29 amplification is carried out by incubating the compartment for 1 hour or more. Preferably, amplification is carried out for 8 hours or more. Most preferably, amplification is carried out for 16 hours or more. Incubation of the Phi29 amplification reaction may also be carried out for 1, 2, or 3 days, or more.
[0188] In embodiments, incubation of Phi29 amplification may be carried out under ambient conditions. Alternatively, Phi29 amplification may be incubated under heating of from 20 C. to 50 C., most preferably from 30 C. to 40 C., for example at 37 C.
[0189] However, the conditions necessary to carry out the amplification reaction can be incompatible with IVTT. Therefore, in order to carry out IVTT on amplified polynucleotides within a compartment, it is sometimes necessary to manipulate the compartment to change the internal environment after amplification has been completed. Methods in the art, such as that of Brouzes et al. (PNAS, 2009, 106:34, pp. 14195-14200), change the conditions within a microfluidic droplet by the process of droplet merging. However, droplet merging is a technically challenging process, requiring specialist equipment and expertise to carry out with any degree of reliability.
4.5.3 Gel Transfer
[0190] In embodiments, the invention circumvents the drawbacks associated with droplet merging by employing a gel-forming material within the compartments, in the manner of WO 2012/156744 A2. The gel-forming material can be made to undergo a reversible transition from a liquid phase to a solid or gel phase to immobilise the amplified polynucleotide. When the gel solidifies in the compartment it may form a bead containing the immobilised polynucleotide. The compartment may then be disrupted without affecting the monoclonal integrity of the amplified polynucleotides trapped in the gel.
[0191] The process of disrupting the compartment will differ depending on the compartment material used. In some embodiments, a demulsification agent, for example a weak surfactant, may be added to the emulsion to separate the phases and the aqueous phase containing the beads removed. The demulsification agent competes with the surfactant at the oil/water interface and causes it to collapse; this is also known as breaking the emulsion. Suitable weak surfactants include perfluorooctanoyl (PFO) and other fluorous compounds with a small hydrophilic group, if fluorinated oil is used, or a buffer containing SDS and Triton and other compounds with a carbon chain on one side and a small hydrophilic group on the other, if mineral oil is used. The demulsification agent may be added to the emulsion and the mixture agitated, for example with a pipette.
[0192] In other embodiments, the emulsion may be centrifuged to separate the phases and the aqueous phase containing the beads removed. Suitable techniques for the re-emulsification of gel beads are known in the art (Abate, A. R. et al (2009) Lab Chip, 9, 2628-2631).
[0193] Following de-emulsification, the beads may be isolated and/or washed to remove buffers and other reagents. Beads may be isolated and/or washed by centrifugation or filtering using standard techniques.
[0194] Following washing, the beads may be immediately subjected to further steps in the methods described herein or may be stored, for example at room temperature or by refrigeration or freezing (preferably in the presence of glycerol). In embodiments, in which the beads contain viable cells, the beads may be treated with a preservative such as glycerol before freezing in accordance with known techniques.
[0195] The decompartmentalized gel bead is porous and the internal conditions of the gel can be changed by suspending it in different media. The bead may therefore be removed from conditions for carrying out PCR and transferred to conditions suitable for carrying out IVTT without loss of monoclonality. The environment within the bead will then be suitable for IVTT of the polynucleotide.
[0196] The gel forming agent is an agent, for example a polymer such as polysaccharide or polypeptide, which can be solidified from a liquid into a gel, for example by alteration of conditions, such as heating, cooling, or altering pH.
[0197] Suitable gel forming agents include alginate, gelatine, and agarose and other gels having a sol phase sufficiently fluid to move through the channels of a microfluidic device. Preferably agarose, which is a linear polymer made up of the repeating units of a disaccharide (D-galactose and 3,6-anhydro-L-galactopyranose), is employed. The gel-forming agent may be solidified into a bead by any convenient method, for example by changing the conditions. Preferably, the hydrogel-forming agent is solidified by altering the temperature, for example by cooling. Hyaluronic-acid is another gel-forming agent that may be used with the invention.
[0198] In a preferred embodiment, the gel may be induced to undergo a phase change from its liquid form to its solid form by cooling it to below its phase-change (or transition) temperature. For example, when the agent is agarose, it may be solidified by reducing the temperature, for example below 25 C., below 20 C. or below 15 C. The precise gelling temperature is dependent on the type of agarose and its concentration and may be easily determined by the skilled person. For example, 0.5% to 2% of ultra-low melting point agarose Type IX-A (Sigma) has a gelling point of about 17 C.
[0199] Solidification of the agent within the compartment moulds the solidified gel into a bead. The population of solidified beads may be monodisperse. The encoded product may be retained in the beads by any convenient method. For example, the product may be retained in the beads through entrapment within the gel matrix or through covalent or non-covalent binding to a retention agent or the gel matrix itself.
[0200] Molecules, such as polypeptides and polynucleotides, may be retained in the beads by virtue of their size. For example, molecules greater than a threshold size may be unable to diffuse out of the bead through pores in the gel and may therefore be trapped within the gel matrix of the bead. For example, polynucleotides, such as plasmids and amplified copies of a polynucleotide, may be retained in the bead. In some embodiments, the gel may retain particles having a diameter of 50 nm or more, although the precise threshold depends on multiple factors, including the type of gel and its concentration.
[0201] In some embodiments, an aqueous solution in which a gel bead is solidified following emulsification, for example a solution comprising a hydrogel-forming agent, such as the aqueous expression and/or amplification solution described above, may further comprise one or more retention agents to reduce or prevent the diffusion of polynucleotide or encoded products from the bead, for example by binding to polynucleotides or encoded products. In other embodiments, compartment components such as substrates and encoded product may be retained by direct binding the hydrogel scaffold. For example, the scaffold may be engineered to contain one or more binding sites which bind to the droplet components and retain them in the bead.
[0202] In other embodiments, polynucleotides and/or encoded products may be sufficiently retained in the bead without the need for binding to retention agents or the gel scaffold. The gel-forming agent may be incorporated into the compartment at any stage prior to disrupting the compartment.
4.6 Libraries
[0203] A library of genetically tagged cyclic peptides in compartments may be produced. Randomised polynucleotides of a desired length may be cloned into vectors for amplification and expression, before compartmentalisation of the vectors in single copy, for example by the methods described above. For example, the vector depicted in
[0204] The length of the randomised polynucleotide inserted into the vector will be dependent on various factors that may be determined by the skilled person. Of primary consideration is the size of the ultimate polypeptide expressed. In a preferred embodiment, the polypeptide is 6 amino acids in length. A suitable randomised polynucleotide would therefore be 18 nucleic acids in length. For cyclic peptide formation, consideration must be given to whether the length of the polypeptide is sufficient to allow the cyclisation reaction to proceed, i.e. whether the length allows a closed peptide cycle to form. In embodiments, the peptide is cyclised by a linker of any length. Therefore, cyclic polypeptides may be achieved by encoding just two amino acids, in which case the randomised polynucleotide will be at least 6 nucleic acids in length. Another consideration is the maximum insert size tolerated by the vector and corresponding replication system. In embodiments, the randomised sequence may be longer, for example, at least 9, 30, 60, 90, 180, 300, 600, 900, 1,800, 3,000, or more nucleic acids in length. In preferred embodiments, the randomised nucleotide sequence is 6, 9, 12, 15, 18, 21, 24, 27, or 30 nucleotides in length. Although the randomised sequence is intended to encode a polypeptide, its length may not necessarily be a multiple of 3. For example, it may be 7, 8, 10, 11, 13, 14, 16, 17, 19, 20, 22, 23, 25, 26, 28, or 29 nucleotides in length. The randomised polynucleotide sequence may also be referred to herein as the variable sequence. In embodiments, one or more positions of the random or variable sequence may actually be fixed. For example, in embodiments achieving cyclisation by the SICLOPPS method, the first position may be occupied by an invariant cysteine, serine, or threonine residue, followed by a variable or random amino acid sequence.
[0205] It will also be appreciated that a library of the present invention may contain members with randomised sequences of different lengths. For example, a proportion of library members may comprise a randomised sequence of 9 nucleotides in length, and another proportion of members of the same library may comprise a randomised sequence of 19 nucleotides in length. Any number of different lengths may be present in the same library.
[0206] Each individual compartment may then serve as a micro-reactor for amplification, e.g. by including the components for Phi29 amplification in the vector medium prior to compartmentalisation. In embodiments utilising a gel, the compartments are subjected to conditions which cause the gel to solidify, at which point the compartments may be disrupted and the media conditions changed for IVTT. The gel beads are optionally re-compartmentalised and each bead now serves as a micro-reactor for IVTT of their immobilised polynucleotide. The library is therefore obtained. At the same time as or following IVTT, some or all of the components required to carry out the selection protocol may be introduced to the bead and/or capsule.
[0207] The integrity of the association between polypeptide and encoding polynucleotide may be further strengthened by employing the mRNA display technology described above in the compartments and gel transfer protocols of the present invention. In this embodiment, the polynucleotide is structured so that it is linked to the resulting polypeptide by the process of translation. For example, the 3 end of the polynucleotide may comprise a peptidyl acceptor region, such as a puromycin moiety or an amino acid moiety.
[0208] It will be appreciated that the display technologies described herein (e.g. mRNA display, phage display, compartmentalised randomised polynucleotides) are not necessarily mutually exclusive and may be implemented together within the same embodiment. For example, a polynucleotide of the invention may encode a SICLOPPS polypeptide whilst also comprising a peptidyl acceptor region which forms a covalent bond to the nascent peptide at the termination of translation of the polynucleotide.
[0209] Furthermore, compartmentalisation of an mRNA library by any of the methods described herein allows functional assays to be performed on mRNA libraries, thus overcoming one of the major drawbacks of the mRNA display technology.
4.7 Selection
[0210] A library according to the present invention may be screened by subjecting it to the conditions of an assay, each bead or compartment thus taking on the properties of a positive or a negative result of the assay, as the case may be. Beads or compartments may then be selected based on this property. For example, a fluorescent signal can be selected for by FACS/FADS.
[0211] All reporters, labels, and tags disclosed herein may be used in any embodiment disclosed herein.
4.7.1 Affinity Selection
[0212] In the case of selection for a polypeptide with affinity for a specific ligand the polynucleotide may be linked to the polypeptide in the microcapsule via the ligand. For example, the ligand may be covalently linked to the polynucleotide, such as through a reaction between the ligand and the 3-OH or 5-phosphate of the polynucleotide. As used herein, ligand may refer to any entity which binds to another entity or may be bound by another entity. For example, the ligand may be another polypeptide comprising a receptor binding site. In this format, peptides of the invention are selected on the basis of the strength of their interaction with the ligand polypeptide, ideally via said receptor binding site. Alternatively, the ligand may be a small molecule, further polynucleotide (e.g. an aptamer), or a macro-scale physical structure such as a polystyrene bead or a magnetic bead. These examples are not intended to be limiting.
[0213] Only polypeptides with affinity for the ligand will bind to the polynucleotide and only those polynucleotides with polypeptide bound via the ligand will acquire the changed optical properties which enable them to be retained in the selection step. In this embodiment, the polynucleotide will thus comprise a nucleic acid encoding the polypeptide linked to a ligand for the polypeptide.
[0214] The change in optical properties of the polynucleotide after binding of the polypeptide to the ligand may be induced in a variety of ways, including: [0215] (1) the polypeptide itself may have distinctive optical properties, for example, it is fluorescent (e.g. green fluorescent protein, (Lorenz et al., 1991)). [0216] (2) the optical properties of the polypeptide may be modified on binding to the ligand, for example, the fluorescence of the polypeptide is quenched or enhanced on binding (Guixe et al., 1998; Qi and Grabowski, 1998) [0217] (3) the optical properties of the ligand may be modified on binding of the polypeptide, for example, the fluorescence of the ligand is quenched or enhanced on binding (Voss, 1993; Masui and Kuramitsu, 1998). [0218] (4) the optical properties of both ligand and polypeptide are modified on binding, for example, there can be a fluorescence resonance energy transfer (FRET) from ligand to polypeptide (or vice versa) resulting in emission at the acceptor emission wavelength when excitation is at the donor absorption wavelength (Heim & Tsien, 1996; Mahajan et al., 1998; Miyawaki et al., 1997).
[0219] In this embodiment, it is not necessary for binding of the polypeptide to the polynucleotide via the ligand to directly induce a change in optical properties. All the polypeptides to be selected can contain a putative binding domain, which is to be selected for, and a common featurea tag. The polynucleotide in each microcapsule is physically linked to the ligand. If the polypeptide produced from the polynucleotide has affinity for the ligand, it will bind to it and become physically linked to the same polynucleotide that encoded it, resulting in the polynucleotide being tagged.
[0220] At the end of the reaction, all of the microcapsules may be combined, and all polynucleotides and polypeptides pooled together in one environment. Polynucleotides encoding polypeptides exhibiting the desired binding can be selected by adding reagents which specifically bind to, or react specifically with, the tag and thereby induce a change in the optical properties of the polynucleotide allowing their sorting. For example, a fluorescently-labelled anti-tag antibody can be used, or an anti-tag antibody followed by a second fluorescently labelled antibody which binds the first.
[0221] In an alternative embodiment, polynucleotides may be sorted on the basis that the polypeptide, which binds to the ligand, merely hides the ligand from, for example, further binding partners which would otherwise modify the optical properties of the polynucleotide. In this case polynucleotides with unmodified optical properties would be selected.
[0222] In an alternative embodiment, the invention provides a method wherein the polypeptides bind to polynucleotides encoding them. The polypeptides together with the attached polynucleotides are then sorted as a result of binding of a ligand to polypeptides having the desired binding activity. For example, all polypeptides can contain an invariant region which binds covalently or non-covalently to the polynucleotide, and a second region which is diversified so as to generate the desired binding activity.
[0223] In an alternative embodiment, the ligand for the polypeptide is itself encoded by the polynucleotide and binds to the polynucleotide. Stated otherwise, the polynucleotide encodes two (or indeed more) polypeptides, at least one of which binds to the polynucleotide, and which can potentially bind each other. Only when the polypeptides interact in a compartment is the polynucleotide modified in a way that ultimately results in a change in its optical properties that enables it to be sorted. This embodiment, for example, is used to search gene libraries for pairs of genes encoding pairs of proteins which bind each other. Individual polypeptides may also be encoded by individual polynucleotides.
[0224] Fluorescence may be enhanced by the use of Tyramide Signal Amplification (TSA) amplification to make the polynucleotides fluorescent. This involves peroxidase (linked to another protein) binding to the polynucleotides and catalysing the conversion of fluorescein-tyramine in to a free radical form which then reacts (locally) with the polynucleotides. Methods for performing TSA are known in the art, and kits are available commercially from NEN.
[0225] TSA may be configured such that it results in a direct increase in the fluorescence of the polynucleotide, or such that a ligand is attached to the polynucleotide which is bound by a second fluorescent molecule, or a sequence of molecules, one or more of which is fluorescent.
4.7.2 Catalysis Selection
[0226] When selection is for catalysis, the polynucleotide in each microcapsule may comprise the substrate of the reaction. If the polynucleotide encodes a polypeptide capable of acting as a catalyst, the polypeptide will catalyse the conversion of the substrate into the product. Therefore, at the end of the reaction the polynucleotide is physically linked to the product of the catalysed reaction.
[0227] It may also be desirable, in some cases, for the substrate not to be a component of the polynucleotide. In this case the substrate would contain an inactive tag that requires a further step to activate it such as photoactivation (e.g. of a caged biotin analogue, (Sundberg et al., 1995; Pirrung and Huang, 1996)). The catalyst to be selected then converts the substrate to product. The tag is then activated and the tagged substrate and/or product bound by a tag-binding molecule (e.g. avidin or streptavidin) complexed with the nucleic acid. The ratio of substrate to product attached to the nucleic acid via the tag will therefore reflect the ratio of the substrate and product in solution.
[0228] The optical properties of polynucleotides with product attached and which encode polypeptides with the desired catalytic activity can be modified by either: [0229] (1) the product-polynucleotide complex having characteristic optical properties not found in the substrate-polynucleotide complex, due to, for example; [0230] (a) the substrate and product having different optical properties (many fluorogenic enzyme substrates are available commercially (see for example Haugland, 1996) including substrates for glycosidases, phosphatases, peptidases and proteases (Craig et al., 1995; Huang et al., 1992; Brynes et al., 1982; Jones et al., 1997; Matayoshi et al., 1990; Wang et al., 1990)), or [0231] (b) the substrate and product having similar optical properties, but only the product, and not the substrate binds to, or reacts with, the polynucleotide; [0232] (2) adding reagents which specifically bind to, or react with, the product and which thereby induce a change in the optical properties of the polynucleotides allowing their sorting (these reagents can be added before or after breaking the compartments and pooling the polynucleotides). The reagents: [0233] (a) bind specifically to, or react specifically with, the product, and not the substrate, if both substrate and product are attached to the polynucleotide, or [0234] (b) optionally bind both substrate and product if only the product, and not the substrate binds to, or reacts with, the polynucleotide.
[0235] The pooled polynucleotides encoding catalytic molecules can then be enriched by selecting for the polynucleotides with modified optical properties.
[0236] An alternative is to couple the nucleic acid to a product-specific antibody (or other product-specific molecule). In this mode, the substrate (or one of the substrates) is present in each compartment unlinked to the polynucleotide, but has a molecular tag (for example biotin, DIG or DNP or a fluorescent group). When the catalyst to be selected converts the substrate to product, the product retains the tag and is then captured in the microcapsule by the product-specific antibody. In this way the polynucleotide only becomes associated with the tag when it encodes or produces an enzyme capable of converting substrate to product. When all reactions are stopped, the polynucleotides encoding active enzymes will be tagged and may already have changed optical properties, for example, if the tag was a fluorescent group.
[0237] Alternatively, a change in optical properties of tagged genes can be induced by adding a fluorescently labelled ligand which binds the tag (for example fluorescently-labelled avidin/streptavidin, an anti-tag antibody which is fluorescent, or a non-fluorescent anti-tag antibody which can be detected by a second fluorescently-labelled antibody). Alternatively, selection may be performed indirectly by coupling a first reaction to subsequent reactions that takes place in the same compartment. There are two general ways in which this may be performed. In a first embodiment, the product of the first reaction is reacted with, or bound by, a molecule which does not react with the substrate of the first reaction. A second, coupled reaction will only proceed in the presence of the product of the first reaction. A polynucleotide encoding a polypeptide with a desired activity can then be purified by using the properties of the product of the second reaction to induce a change in the optical properties of the polynucleotide as above.
[0238] Alternatively, the product of the reaction being selected may be the substrate or cofactor for a second enzyme-catalysed reaction. The enzyme to catalyse the second reaction can either be translated in situ in the microcapsules or incorporated in the reaction mixture prior to compartmentalisation. Only when the first reaction proceeds will the coupled enzyme generate a product which can be used to induce a change in the optical properties of the polynucleotide as above.
[0239] This concept of coupling can be elaborated to incorporate multiple enzymes, each using as a substrate the product of the previous reaction. This allows for selection of enzymes that will not react with an immobilised substrate. It can also be designed to give increased sensitivity by signal amplification if a product of one reaction is a catalyst or a cofactor for a second reaction or series of reactions leading to a selectable product (for example, see Johannsson and Bates, 1988; Johannsson, 1991). Furthermore an enzyme cascade system can be based on the production of an activator for an enzyme or the destruction of an enzyme inhibitor (see Mize et al., 1989). Coupling also has the advantage that a common selection system can be used for a whole group of enzymes which generate the same product and allows for the selection of complicated chemical transformations that cannot be performed in a single step.
[0240] Such a method of coupling thus enables the evolution of novel metabolic pathways in vitro in a stepwise fashion, selecting and improving first one step and then the next. The selection strategy is based on the final product of the pathway, so that all earlier steps can be evolved independently or sequentially without setting up a new selection system for each step of the reaction.
[0241] Expressed in an alternative manner, there is provided a method of isolating one or more polynucleotides encoding a polypeptide having a desired catalytic activity, comprising the steps of: [0242] (1) expressing polynucleotides to give their respective polypeptides; [0243] (2) allowing the polypeptides to catalyse conversion of a substrate to a product, which may or may not be directly selectable, in accordance with the desired activity; [0244] (3) optionally coupling the first reaction to one or more subsequent reactions, each reaction being modulated by the product of the previous reactions, and leading to the creation of a final, selectable product; [0245] (4) linking the selectable product of catalysis to the polynucleotides by either: [0246] a) coupling a substrate to the polynucleotides in such a way that the product remains associated with the polynucleotides, or [0247] b) reacting or binding the selectable product to the polynucleotides by way of a suitable molecular tag attached to the substrate which remains on the product, or [0248] c) coupling the selectable product (but not the substrate) to the polynucleotides by means of a product-specific reaction or interaction with the product; and [0249] (5) selecting the product of catalysis, together with the polynucleotide to which it is bound, either by means of its characteristic optical properties, or by adding reagents which specifically bind to, or react specifically with, the product and which thereby induce a change in the optical properties of the polynucleotides wherein steps (1) to (4) each polynucleotide and respective polypeptide is contained within a microcapsule.
[0250] All of the catalytic modes described herein may also be performed with the roles of the polypeptide and the substrate/inhibitor/product/reagent reversed. For example, the library polypeptide of the invention may be screened for substrate or regulatory activity by providing an enzyme as a target. Selection by regulatory activity is also described below.
4.7.3 Substrate Specificity/Selectivity
[0251] Polynucleotides encoding enzymes with substrate specificity or selectivity can be specifically enriched by carrying out a positive selection for reaction with one substrate and a negative selection for reaction with another substrate. Such combined positive and negative selection pressure should be of great importance in isolating regio-selective and stereo-selective enzymes (for example, enzymes that can distinguish between two enantiomers of the same substrate). For example, two substrates (e.g. two different enantiomers) are each labelled with different tags (e.g. two different fluorophores) such that the tags become attached to the polynucleotide by the enzyme-catalysed reaction. If the two tags confer different optical properties on the polynucleotide the substrate specificity of the enzyme can be determined from the optical properties of the polynucleotide and those polynucleotides encoding polypeptides with the wrong (or no) specificity rejected. Tags conferring no change in optical activity can also be used if tag-specific ligands with different optical properties are added (e.g. tag-specific antibodies labelled with different fluorophores).
4.7.4 Regulation
[0252] A similar system can be used to select for regulatory properties of cyclic polypeptides. In the case of selection for a regulator molecule which acts as an activator or inhibitor of a biochemical process, the components of the biochemical process can either be translated in situ in each compartment or can be incorporated in the reaction mixture prior to compartmentalisation, with the exception that components capable of permeating the compartment material may be contacted with the compartment after compartmentalisation. If the polynucleotide being selected is to encode an activator, selection can be performed for the product of the regulated reaction, as described above in connection with catalysis. If an inhibitor is desired, selection can be for a chemical property specific to the substrate of the regulated reaction, or for the absence of a chemical property specific to the product of the regulated reaction.
[0253] There is therefore provided a method of sorting one or more polynucleotides coding for a polypeptide exhibiting a desired regulatory activity, comprising the steps of: [0254] (1) expressing polynucleotides to give their respective polypeptides; [0255] (2) allowing the polypeptides to activate or inhibit a biochemical reaction, or sequence of coupled reactions, in accordance with the desired activity, in such a way as to allow the generation or survival of a selectable molecule; [0256] (3) linking the selectable molecule to the polynucleotides either by [0257] a) having the selectable molecule, or the substrate from which it derives, attached to the polynucleotides, or [0258] b) reacting or binding the selectable product to the polynucleotides, by way of a suitable molecular tag attached to the substrate which remains on the product, or [0259] c) coupling the product of catalysis (but not the substrate) to the polynucleotides, by means of a product-specific reaction or interaction with the product; or [0260] d) immobilising the components of the reaction and any products in a gel. In this mode, a gel forming agent or agents must be included with the encapsulated reaction components at the start of the process. The gel may form for example by cooling the reaction to the phase-change temperature of the gel; or [0261] e) maintaining the reaction components and any products within the microcapsule; [0262] (4) selecting the selectable product, together with the polynucleotide to which it is bound, either by means of its characteristic optical properties, or by adding reagents which specifically bind to, or react specifically with, the product and which thereby induce a change in the optical properties of the polynucleotides wherein steps (1) to (3) each polynucleotide and respective polypeptide is contained within a compartment.
[0263] In modes involving option (e) in step (3), and the addition of reagents in step (4), a semi-permeable compartment material should be chosen that allows the permeation of any such reagents. In embodiments, the compartment is not disrupted before sorting.
[0264] In general, when selecting for a regulator or modulator of a biochemical activity, for example an activator or an inhibitor of an enzyme, the candidate regulatorin this case, the cyclic polypeptideis contacted with the target of regulation. The target and candidate are also contacted with all other reaction conditions and components normally necessary for the activity to take place (i.e. absent any regulators that might interfere with the assay). The mixture is incubated for a period of time, before activity of the target, or absence thereof, is assessed.
[0265] A reporter may be included in the reaction to facilitate the detection of any activity. A detectable reporter is a molecule, atom, ion or group which is detectable by standard detection methodologies. For example, the reporter may be capable of producing a detectable signal in response to a stimulus, such as a contact with a chromogenic substrate or light at an appropriate excitation wavelength.
[0266] The presence or amount of detectable reporter may be determined by detecting or measuring the signal produced by the reporter. Suitable detectable labels may include fluorescent reporters, chromogenic reporters, Raman-active reporters, such as mercaptopyridine, thiophenol (TP), mercaptobenzoic acid (MBA), and dithiobis succinimidyl nitrobenzoate (DNBA), mass-spectrometry reporters, and particles that can be identified by their shape by image analysis.
[0267] Suitable fluorescence reporters include fluorescein and fluorescein derivatives such as O-methyl-fluorescein or fluorescein isothiocyanate (FITC), phycoerythrin, Europium, TruRed, Allophycocyanin (APC), PerCP, Lissamine, Rhodamine, B X-Rhodamine, TRITC, BODIPY-FL, FluorX, Red 613, R-Phycoerythrin (PE), NBD, Lucifer yellow, Cascade Blue, Methoxycoumarin, Aminocoumarin, Texas Red, Hydroxycoumarin, Alexa Fluor-dyes (Molecular Probes) such as Alexa Fluor-350, Alexa Fluor-488, Alexa Fluor-546, Alexa Fluor-568, Alexa Fluor-633, Alexa Fluor-647, Alexa Fluor-660, and Alexa Fluor-700, sulfonate cyanine dyes (AP Biotech), such as Cy2, Cy3, Cy3.5, Cy5, Cy5.5 and Cy7, IRD41 IRD700 (Li-Cor, Inc.), NIR-1 (Dejindom, Japan), La Jolla Blue (Diatron), DyLight 405, 488, 549, 633, 649, 680 and 800 Reactive Dyes (Pierce/Thermo Fisher Scientific Inc) or LI-COR dyes, such as IRDye (LI-COR Biosciences).
[0268] The reporter may be a substrate, product, or intermediate of the biochemical process. It may be the direct substrate or product of the target of regulation. In other embodiments, the reporter may not be the direct substrate or product of the target of regulation. For example, the reporter may be acted upon or produced in an earlier step of the biochemical activity. Alternatively, the reporter may be acted upon or produced in a later step of the biochemical activity. In a simple enzyme cascade, Accumulation of the reporter (in comparison to a control lacking the cyclic polypeptide) indicates the activation of any steps preceding the production of the reporter (up-stream steps) and/or inhibition of any steps following production of the reporter (down-stream steps). Conversely, absence of the reporter indicates inhibition of any steps preceding production of the reporter and/or activation of any steps following production of the reporter. Alternatively, the reporter is the substrate or product of a separate biochemical process that has been coupled to the biochemical process involving the target of regulation.
[0269] Suitable reporter substrates which may be converted into detectable reporters by the action of a specific enzyme are well known in the art. For example, the reporter substrate fluorescein disulphate may be converted by an arylsulfatase into the detectable reporter fluorescein. Similarly, fluorescein phosphate, and fluorescein acetate may be used with phosphatases and acetylases respectively.
[0270] Numerous reporter substrates are commercially available (for example, Molecular Probes Inc) or may be synthesised by standard procedures. Preferably the detectable reporter is retained in the beads.
[0271] In other embodiments, the reporter may be a ligand that binds to a component of the biochemical process. The candidate regulator may then modulate the binding activity of the reporter. In this case, suitable reporters will undergo a detectable physicochemical change when bound. The reporter may bind directly to the target of regulation. In other embodiments, the reporter may not bind directly to the target of regulation but to another component up-stream or down-stream from the target of regulation in the biochemical activity. However, in any case, the binding of the reporter must be dependent on the activity of the target of regulation, be it directly or indirectly. If the candidate regulator inhibits binding of the reporter, the signal associated with the unbound reporter will be prevalent (i.e. increased with respect to a positive control). Conversely, if the candidate regulator promotes binding, the signal associated with bound reporter will be prevalent (i.e. increased with respect to a negative control).
[0272] Other formats will be readily considered by the skilled person. For example, the target of regulation may be an enzyme that catalyses a reaction which produces an inhibitor preventing another component of the biochemical activity from binding to the reporter. In any case, the relationship between the presence of a regulatory component and its effect on the reporter will be readily ascertained by the skilled person.
[0273] In embodiments, the components of the reporter assay are incorporated into the compartment at the same time as the IVTT system. Some components of the reporter assay may be transcribed from additional polynucleotides by the IVTT system in the capsule, concomitant with expression of the cyclic polypeptide.
[0274] In some embodiments, the compartment decompartmentalised gel bead comprising co-immobilised polynucleotide and cyclic peptide may be contacted with media comprising the components of the reporter assay.
[0275] In some embodiments, some components of the reporter assay, and/or polynucleotides encoding components of the reporter assay, are incorporated into the compartment at the same time IVTT system. In this embodiment, the remaining components of the reporter assay are contacted with the compartment or decompartmentalised gel bead at a later stage.
[0276] In embodiments where reporter assay components are contacted with a compartment, the compartment material should be selected in order that reporter assay components initially present only in the environment external to the compartment are able to permeate across the compartment boundary into the internal volume of the compartment.
4.7.5 Protein-Protein Interaction
[0277] Protein-protein interactions (PPIs) may be monitored by an assay (for example, FRET assay or HTRF assay) which may be encapsulated with the library, or later merged using droplet merging, or incorporated by reconstituting decompartmentalised gel beads in the assay medium.
[0278] To perform the assay, a FRET donor moiety may be attached to one protein of an interacting pair and a FRET acceptor moiety may be attached to the other protein in an interacting pair. Positioning of the donor/acceptor moieties to ensure sufficient proximity for resonance energy transfer when the two proteins are interacting is within the purview of one skilled in the art. The FRET functionalised proteins are then contacted with the polypeptides in the library.
[0279] Presence of a polypeptide according to the invention which inhibits the interaction between the two proteins would not FRET, whereas those containing inactive molecules will still display a FRET signal. These two species can be easily separated with FACS.
[0280] The assay may also be performed in the opposite direction to identify polypeptides that create or enhance an interaction between two proteins, in which case the presence of or an increase in FRET indicates a polypeptide promoting the interaction.
4.7.6 Optical Properties of the Polypeptide
[0281] It is possible to select for inherent optical properties of polypeptides if, in the compartments, the polypeptide binds back to the polynucleotide, for example through a common element of the polypeptide which binds to a ligand which is part of the polynucleotide. The polynucleotides can then be sorted using the optical properties of the bound polypeptides. This embodiment can be used, for example, to select variants of green fluorescent protein (GFP) (Cormack et al., 1996; Delagrave et al., 1995; Ehrig et al., 1995), with improved fluorescence and/or novel absorption and emission spectra. as the Flow sorting of polynucleotide/polypeptide
[0282] In a preferred embodiment of the invention, the beads, capsules, polynucleotides, and/or polypeptides will be sorted by flow cytometry. A variety of optical properties can be used to trigger sorting, including light scattering (Kerker, 1983) and fluorescence polarisation (Rolland et al., 1985). In a highly preferred embodiment the difference in optical properties of the beads, capsules, polynucleotides, and/or polypeptides will be a difference in fluorescence and the beads, capsules, polynucleotides, and/or polypeptides will be sorted using a fluorescence activated cell sorter (Norman, 1980; Mackenzie and Pinder, 1986), or similar device. In an especially preferred embodiment the beads, capsules, polynucleotides, and/or polypeptides comprises a nonfluorescent nonmagnetic (e.g. polystyrene) or paramagnetic microbead (see Fomusek and Vetvicka, 1986), optimally 0.6 to 1.0 m diameter, to which are attached both the gene and the groups involved in generating a fluorescent signal: [0283] (1) commercially available fluorescence activated cell sorting equipment from established manufacturers (e.g. Becton-Dickinson, Coulter) allows the sorting of up to 108 beads, capsules, polynucleotides, and/or polypeptides (events) per hour; [0284] (2) the fluorescence signal from each bead corresponds tightly to the number of fluorescent molecules attached to the bead. At present as little as few hundred fluorescent molecules per particle can be quantitatively detected; [0285] (3) the wide dynamic range of the fluorescence detectors (typically 4 log units) allows easy setting of the stringency of the sorting procedure, thus allowing the recovery of the optimal number of beads, capsules, polynucleotides, and/or polypeptides from the starting pool (the gates can be set to separate beads with small differences in fluorescence or to only separate out beads with large differences in fluorescence, dependent on the selection being performed; [0286] (4) commercially available fluorescence-activated cell sorting equipment can perform simultaneous excitation at up to two different wavelengths and detect fluorescence at up to four different wavelengths (Shapiro, 1983) allowing positive and negative selections to be performed simultaneously by monitoring the labelling of the beads, capsules, polynucleotides, and/or polypeptides with two (or more) different fluorescent markers, for example, if two alternative substrates for an enzyme (e.g. two different enantiomers) are labelled with different fluorescent tags the beads, capsules, polynucleotides, and/or polypeptides can labelled with different fluorophores dependent on the substrate used and only genes encoding enzymes with enantioselectivity selected. [0287] (5) highly uniform derivatised and non-derivatised nonmagnetic and paramagnetic microparticles (beads) are commercially available from many sources (e.g. Sigma, and Molecular Probes) (Fornusek and Vetvicka, 1986).
4.8 Isolation of Polynucleotide
[0288] Polynucleotide from the one or more beads may be isolated, amplified, cloned, sequenced or otherwise manipulated.
[0289] A method described herein may further comprise identifying and/or isolating the polynucleotide from one or more compartments or beads identified as containing a candidate cyclic polypeptide.
[0290] The polynucleotide from the one or more beads may be isolated, amplified, sequenced cloned and/or otherwise investigated. For example, the polynucleotide may be extracted using conventional techniques such as gel-extraction columns or agarose, and/or amplified isothermally (e.g. multiple-primed RCA) or by PCR or both consecutively.
[0291] The methods described herein can also be applied by analogy to systems wherein the compartment is, for example, a vesicle or an alginate microcapsule. These systems can also be manipulated to provide micro-reactors for PCR, agarose gelification, and IVTT, followed by assays and high-throughput sorting.
5 EXAMPLES
5.1 Preface to the Examples
[0292] In one embodiment, the present invention overcomes the limitations in the art by porting SICLOPPS into microfluidic droplets. Not only can we express individual SICLOPPS library members in each droplet, as this is achieved by in vitro transcription/translation, the DNA code for each cyclic peptide is also contained in the same droplet, making identification of hits very simple via PCR amplification and DNA sequencing. This library can be interfaced with any pharmaceutical assay with a fluorescent or colorimetric output (e.g. FRET, HTRF). This method further allows generation of libraries of hundreds of millions of cyclic peptides, and can include non-natural amino acids.
[0293] To overcome the limitations of droplet merging we utilize an agarose-in-oil droplet based methodology for highly parallel and efficient single molecule DNA amplification prior to in vitro protein expression. This method capitalizes on the thermo-responsive sol-gel switching properties of agarose for the capture of single DNA molecules prior to amplification by Phi29 DNA polymerase. Following DNA amplification, the agarose droplets are gelated (or solidified) to form agarose beads, thereby trapping all amplicons in each micro-reactor to preserve the monoclonality of each droplet.
[0294] The use of monodisperse agarose-in-oil microdroplets has previously been used to monitor biochemical reactions within gelified microbeads. As noted, the transition from an agarose droplet to a solidified agarose particle provides additional stability and facilitated manipulation. Once solidified, we demonstrate the isolation of isothermally amplified DNA to only within the agarose bead (i.e., the pre-amplified DNA does not diffuse out). The resulting particles can therefore be recovered by breaking the emulsion and washed to permit re-suspension in an IVTT compatible buffer to effectively bypass the constraints associated with droplet merging. After re-suspension in IVTT compatible buffer, the other components of the IVTT system may be added and, in embodiments, the IVTT-competent agarose bead may be re-emulsified to form IVTT micro-reactors.
[0295] The methodology developed enables the high-throughput generation of uniform droplets with efficient single molecule DNA amplification, thereby delivering a promising platform for many single copy genetics based studies.
[0296] Overall, we describe a novel ultra-high throughput screening platform that can be used for the rapid selection of protein-protein interaction inhibitors via the in vitro compartmentalization of SICLOPPS derived cyclic peptide libraries in femtolitre-sized aqueous compartments, using FACS to selectively recover droplets displaying the desired phenotypic trait.
[0297] We demonstrate successful single molecule DNA amplification in monodisperse agarose droplets through the solidification and subsequent breaking of emulsion (via the addition of PFO) to permit the isolation of DNA enriched agarose particles. Amplified DNA is detected by staining with a fluorescent dsDNA intercalating dye, which simultaneously permits detection via flow cytometry. A single distinct agarose particle population on side versus forward scatterplots is observed, with a prominent increase in green fluorescence intensity when compared to controls comprising no Phi29 DNA polymerase.
[0298] Prior to the introduction of agarose particles into an IVTT containing droplet, the agarose beads are washed to remove any unbound DNA alongside the removal of incompatible DNA amplification buffer; in the absence of washing, IVTT is inhibited and no GFP expression is observed.
[0299] For agarose-in-IVTT-in-oil (double emulsion) formation, agarose particles are re-introduced into a hydrophobic microfluidic device along with the components for IVTT. Following incubation at 37 C., protein expression is stopped through placing the emulsion on ice. For triple emulsion formation (agarose-in-IVTT-in-oil-in-water), double emulsion droplets are injected into a third and final hydrophilic microfluidic device for re-emulsification into a flow cytometry compatible configuration.
[0300] Finally, triple emulsions comprising in vitro expressed GFP from a GFP encoding plasmid are successfully sorted using FACS. Droplets are injected and sorted at rates exceeding 1,000 events per second, therefore equating to 60,000 events per minute or 3.2 million per hour. Overall, we demonstrate the successful implementation of agarose particles in IVTT for the in vitro expression of polypeptide in microfluidically generated droplets.
Example 1: The Generation of Monodisperse Single Water-In-Oil Emulsion Droplets at the Femto-Litre Scale
[0301] The generation of aqueous femtodroplets using a 105 m (widthdepth) flow-focusing microfluidic device on chip with the capacity to achieve droplets 5-50 fL in volume is demonstrated in
[0302] To demonstrate the well-controlled production of monodisperse water-in-oil (w/o) femtodroplets for SICLOPPS library encapsulation, droplets comprising 100 M fluorescein (FITC dye) in 1TAE (pH7.5, since the emission of FITC fluorescence is strongly dependent upon the surrounding pH) were formed in hydrofluoroether HFE-7500 previously mixed with 5% Krytox 157 FSL Jeffamine ED-600 disalt surfactant (JUS, not commercially available) to decrease the interfacial tension at the oil-water interface. To investigate the frequency of femtodroplet formation and therefore determine the theoretical number of encapsulated SICLOPPS library variants achievable over time (assuming single molecule encapsulation), the influence of volumetric flow speeds on droplet diameter (as dictated by the oil/water flow rate ratio, R.sub.1/R.sub.2) was examined by increasing the oil phase flow rate in a step-wise manner (10-60 l/h) whilst maintaining a constant aqueous flow of 10 l/h. The frequency of droplet formation, which is expected to increase with a decrease in droplet size, was theoretically calculated as follows f=Q.sub.aq/D.sub.v, where f is the frequency of production (Hz), Q.sub.aq the aqueous phase flow rate (l/s) and V.sub.d the final droplet volume (l).
[0303] To determine the diameter of microfluidically generated emulsion droplets, samples were pipetted into disposable Fast-Read Counting Slides and imaged using an Olympus CKX41 inverted microscope or Zeiss Axio II; a QIClick CCD camera was fitted for image capture and controlled using open source microscopy software (Micro-Manager). For analysis, brightfield and fluorescent photographs were saved as 16-bit files and processed with ImageJ software to yield statistics on droplet diameter and volume via the Analyse Particles function. Accordingly, the circularity above a user-defined threshold for all objects larger than a specified minimum cut-off (0.8) was measured and tabulated for data processing. Resultantly, the droplet diameter distribution under each flow rate condition is presented in
[0304] An increase in the oil/surfactant flow rate is followed by a decrease in the overall droplet diameter. Likewise, a decrease in the droplet volume is matched by an increase in its production frequency, as demonstrated in
Example 2: The Generation of Water-In-Oil-In-Water Double Emulsion Droplets for Flow Cytometry Analysis
[0305] For flow cytometric analysis of SICLOPPS enclosed emulsion samples, a double emulsion water-in-oil-in-water configuration, generated via two-step re-emulsification, is required to ensure compatibility. Accordingly, primary FITC containing water-in-oil emulsions generated via a 105 m microfluidic device were transformed into double emulsion droplets using a second, hydrophilic flow-focusing chip with microchannel dimensions measuring 1516 m.
[0306] To permit re-emulsification, the primary emulsion was stored upright within a glass syringe, flaked by fluorinated and mineral oil solutions. During encapsulation, the addition of a second, FC-40 filled syringe was used to facilitate the controlled manipulation and encapsulation of a single primary droplet per double emulsion. Alongside, a 1% tris/tween80 surfactant containing continuous phase was used for interface stabilization. The process of on-chip two-step emulsification is illustrated in
[0307] In addition, the workflow for single and double emulsion droplet generation using a flow-focusing microfluidic geometry is illustrated in
[0308] Subsequently, the double emulsion droplets from
[0309] Background fluorescence levels were confirmed by preparing simple oil in water droplets with reagents and conditions entirely identical as to those previously used. A single fluorescence peak and droplet population are observed from the resulting fluorescence histogram and SSC vs FSC plots, respectively, which correspond directly with those from
Example 3. Production of a Library of 3.2 Million Cyclic Peptides in Droplets
[0310] In order to facilitate identification of droplets containing cyclic peptides, we designed an expression system that encodes both the SICLOIPPS inteins and a fluorescent protein (GFP). The droplets containing a SICLOPPS plasmid may be readily identified and sorted/separated based on their fluorescence using FACS. A pETDuet-based plasmid encoding Npu split inteins in SICLOPPS format (I.sub.C-extein-I.sub.N) was built for CX.sub.5 SICLOPPS library construction from vector pARNpuHisSsrA-CX5 (Townend and Tavassoli, 2016, ACS Chemical Biology, 1624-1630). The region encoding the C- and N-inteins together with the hexamer encoding peptide were PCR amplified using forward and reverse primers encoding Eco RI and Hind III restriction enzymes, respectively, in which the reverse primer was designed to omit the SsrA degradation tag. This amplified product was next digested and subsequently cloned into the first multiple cloning site (MCS1) of vector pETDuet-1. GFP was PCR amplified from an encoding geneblock using forward and reverse primers encoding Nde I and Eco RV restriction enzyme sites, respectively; this construct was likewise cloned into MCS2 of vector pETDuet-1 to generate a vector encoding both SICLOPPS and GFP proteins. The resulting plasmid was hereafter utilized as templates in SICLOPPS cyclic peptide library construction.
[0311] A hexamer library comprising five variable amino acids and thus 3.210.sup.6 library members (where X=any amino acid residue) was constructed as previously described (Tavassoli and Benkovic, 2007, Nature Protocols, 1126-1133). The library was designed to encode cyclic peptide hexamers within the first multiple cloning site (MCS) of pETDuet-1 with an initial cysteine residue followed by five randomized residues as a nucleophile at the first position is required for the transesterification step of intein processing (Other residues suitable for providing a nucleophile at the first position include Serine (S) and Threonine (T)). The second MCS was constructed to express GFP and therefore allow for the simultaneous expression of both cyclic peptide and fluorescent protein to allow for the rapid and systematic identification of cyclic peptide containing droplets.
[0312] The resulting plasmid is depicted in
[0313] As previously detailed (Tavassoli and Benkovic, 2007, Nature Protocols, 1126-1133), a two-step PCR-based technique was used in which the random oligonucleotides of the library are incorporated into the forward primer between the region that binds the 3 end of I.sub.C and the 5 end of I.sub.N. The variable segment was encoded in the form NNS, where N represents any of the four DNA bases (A, C, G or T) and S represents C or G. The NNS sequence generated 32 codons and encodes all 20 natural occurring amino acids whilst eliminating the ochre (UAA) and opal (UGA) stop codons from the library. It should be noted that there are no limits upon the number of amino acids within the target peptide, allowing cyclic peptides of various sizes to be generated.
[0314] The generation of the initial linear PCR product yields mismatches in the random nucleotide region, owing to the sequence complexity of the library. A second PCR using a zipper primer corresponding to the 3 end of C-intein was therefore used to ensure the annealing of all DNA sequences to their complimentary strand. The resulting DNA library was incorporated into the SICLOPPS plasmid using standard molecular biology techniques to generate the desired CX.sub.5 library within vector pDuetNpuHis-GFP.
[0315] Following ligation, SICLOPPS CX.sub.5 peptide libraries were transformed into electro-competent DH5 E. coli cells and plated onto LB agar medium and grown overnight at 37 C. Once grown, the resulting colonies were harvested via the scraping of colonies and miniprepped to yield a plasmid library ready for encapsulation and Phi29 mediated pre-amplification in agarose-in-oil droplets as detailed above.
Example 4: The Miniaturization of Biochemical Operations Using Agarose-Based Droplet Microfluidics
[0316] The above plasmid library (generated in example 3) was used in the following experiments. The application of agarose-in-oil emulsion droplets for amplicon trapping and DNA amplification in gelated agarose beads has materialized into a powerful approach for tackling the challenges of conventional PCR and primer functionalized microbead methods. Here, we capitalize upon the unique thermo-responsive sol-gel switching properties of agarose to describe a highly parallel Phi29 DNA polymerase mediated protocol for the amplification of single DNA plasmid molecules in femtolitre-sized agarose beads ranging 6-7 m in diameter. We utilize a two-aqueous-inlet emulsion droplet generator with co-encapsulated isothermal amplification reagents along with agarose as a capturing matrix. The monoclonal nature of each product is resultantly preserved within the robust and inert biochemical environment of reach reservoir/bead. Solidified beads enclosing trapped amplicons are subsequently co-encapsulated in an in vitro transcription translation (IVTT) system in the absence of droplet merging to study protein expression in a defined reaction volume, illustrated in
[0317]
[0318] For droplet generation the resulting plasmid library was statistically diluted according to Poisson statistics to ensure the encapsulation of on average (k) either (i) 0.1, representing single molecule encapsulation, or (ii) 100 library copies on average (as proof of principle), into 110 fL agarose-in-oil droplets. The resulting plasmid library was injected alongside Phi29 DNA polymerase mediated isothermal amplification reagents into a JUS device and encapsulated using an aqueous flow rate of 10 l/h for each aqueous phase, and 30 l/h for oil/surfactant mixture QX200 (droplet generation oil). To generate uniform agarose emulsions droplets, agarose was loaded alongside 1X TAE buffer into a microfluidic device with QX200 oil/surfactant as the continuous phase. To ensure the maintenance of agarose in a liquid state for droplet generation, the agarose containing syringe was preheated with a commercially purchased microwavable heating pack both prior to filling with agarose as well as during device operation (
[0319] Following collection (
[0320] Since the buffer system used for DNA amplification is known to be incompatible with droplet based IVTT, agarose beads comprising monoclonal amplified plasmid DNA were solidified and subsequently washed via centrifugation to permit their re-suspension in a solution now compatible with IVTT. To further investigate the compatibility of IVTT using the PURExpress system with our plasmid-containing agarose beads, washed agarose beads were resuspended in an IVTT solution with QX200 oil/surfactant and vortexed to rapidly generate bulk polydisperse droplets, the brightfield and fluorescence photographs for which are presented in
[0321] To demonstrate the in vitro mediated protein expression of GFP in microfluidically generated monodisperse droplets using the PURExpress system, agarose droplets containing approximately 100 starting plasmid DNA copies was pre-amplification using Phi29 DNA amplification (
Example 5: Formation and Sorting of a Cyclic Peptide
[0322] We have demonstrated by mass spectrometry the formation of a cyclic peptide via intein splicing within an emulsion. The cyclic peptide continues to be present after FACS sorting of the emulsion droplets.
[0323] The vectors of example 3 were used to encode an intein-bounded hexapeptide, CLLFVY (SEQ ID NO: 5). This vector was used to produce cyclic CLLFVY (SEQ ID NO: 5) as follows.
[0324] A standard PURExpress IVTT reaction was assembled in the presence of vector CSpDuetNpuHisCLLFVY (SEQ ID NO: 6). Reactions were incubated at 37 C., 2 h prior to mass spectrometric analysis. The results are shown in
[0325] In a second experiment, vector CSpDuetNpuHisCLLFVY (SEQ ID NO: 6) was pre-amplified in highly monodisperse 6 m 1% agarose beads overnight via the TempliPhi amplification system at 30 C. Following enzyme heat inactivation, beads were broken from emulsion and washed via centrifugation at 6,000 rpm 3 in diH2O to permit efficient amplification buffer removal (which would inadvertently interfere with subsequent IVTT manipulations). Washed agarose beads comprising monoclonally amplification DNA were then re-encapsulated together with IVTT to permit CLLFVY (SEQ ID NO: 5) expression and incubated at 37 C., 2 h, prior to a third emulsification step to yield double emulsion FACS compatible droplets.
[0326] Double emulsion populations exhibiting increased GFP fluorescence above background (MCS2 cloned GFP) were selected for sorting. Sorted samples were broken from emulsion and submitted for mass spectrometric analysis. See
Example 6. In Vitro Expression in Microfluidic Droplets of AB42-GFP Fusion with Cyclo-TAFDR
[0327] The cyclic peptide TAFDR (SEQ ID NO: 7) is a cyclopeptide that has been shown to inhibit aggregation of Alzheimer's protein A42 fused to GFP. When GFP is produced as an aggregating fusion, its fluorescence is lost; however, when the aggregation is disrupted by TAFDR (SEQ ID NO: 7), the GFP can fluoresce. See Mathis et al., Nature Biomedical Engineering volume 1, pages 838-852 (2017).
[0328] We have used the A42 aggregation assay to assess the performance of the system of the invention. This assay has previously been combined with a SICLOPPS screen (Mathis et al.), so cyclo-TAFDR (SEQ ID NO: 7) is a validated positive cyclic peptide control.
[0329] Vector CSpDuetNpuHisAB42-GFP was utilised for the cloning of TAFDR (SEQ ID NO: 7) into MCS1. Thereafter, plasmid DNA was encapsulated into highly monodisperse 1% agarose droplets alongside isothermal DNA amplification reaction components and incubated overnight at 30 C. Agarose beads were prepped as previously stated and re-encapsulated together with IVTT prior to 2 h incubation at 37 C. A final emulsification step was performed to yield FACS compatible double emulsions. A negative control vector in the presence of CA5 was likewise constructed to verify cyclo-TAFDR (SEQ ID NO: 7) AB42-GFP aggregation inhibition. A positive shift in green fluorescence upon cyclo-TAFDR (SEQ ID NO: 7) expression was observed relative to buffer alone, IVTT alone, and cyclo-CA5 data.
Example 7. In Vitro Compartmentalisation and FACS Screening of a TX4 SICLOPPS Library in Double Emulsion Droplets
[0330] Using the method of example 6, a full screen has been carried out with a TX4 library.
[0331] All publications mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described aspects and embodiments of the present invention will be apparent to those skilled in the art without departing from the scope of the present invention. Although the present invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are apparent to those skilled in the art are intended to be within the scope of the following claims.