Claudin-6-specific immunoreceptors and T cell epitopes

12559531 · 2026-02-24

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides Claudin-6-specific immunoreceptors (T cell receptors and artificial T cell receptors (chimeric antigen receptors; CARs)) and T cell epitopes which are useful for immunotherapy.

Claims

1. An artificial T cell receptor comprising: a binding domain for claudin-6 (CLDN6) comprising the amino acid sequence of SEQ ID NO: 40; a costimulatory domain selected from the group consisting of: CD28, CD137 (4-1BB), CD134 (OX40), and CD278 (COS); and a T cell signaling domain that activates cytotoxic lymphocytes upon binding to CLDN6.

2. The artificial T cell receptor of claim 1, wherein the costimulatory domain is CD137 (4-1BB).

3. The artificial T cell receptor of claim 1, further comprising a transmembrane domain.

4. The artificial T cell receptor of claim 3, further comprising a spacer region which links the binding domain for CLDN6 to the transmembrane domain.

5. The artificial T cell receptor of claim 1, wherein the T cell signaling domain comprises the endodomain of CD3-zeta or a functional fragment thereof.

6. The artificial T cell receptor of claim 1 which comprises a signal peptide which directs the nascent protein into the endoplasmic reticulum.

7. The artificial T cell receptor of claim 6, which comprises the structure: NH2-signal peptide-binding domain for CLDN6-spacer region-transmembrane domain-T cell signaling domain-COOH.

Description

FIGURES

(1) FIG. 1: Representation of the TCR-CD3 complex. The intracytoplasmic CD3 immunoreceptor tyrosine-based activation motifs (ITAMs) are indicated as cylinders (adapted from The T cell receptor facts book, MP Lefranc, G Lefranc, 2001).

(2) FIG. 2: The design of successive generations of CARs. Schematic representation of the different generations of CARs (1G, first generation, 2G, second generation, 3G, third generation). The first generation contains extracellular scFvs and the cytoplasmic CD3 chain/ZAP70 mediating cytotoxicity, the second generation additionally CD28/PI3K promoting proliferation and the third generation furthermore 4-1BB or OX40/TRAF sustaining cell survival (Casucci, M. et al. (2011) 2: 378-382).

(3) FIG. 3: Schematic representation of the different receptor formats for the redirection of T cells against CLDN6. Left: a second generation CAR consisting of a CLDN6-specific scFv fragment, a IgG1-derived spacer domain, a CD28 costimulatory and a CD3 signaling domain (CAR-28); middle: a novel CAR format based on the linkage of the scFv with the constant domain of the murine TCR chain and coexpression of the constant domain of the murine TCR chain (CAR/C); right: a murine TCR composed of TCR / chains (mu, murine TCR);

(4) FIG. 4: Claudin-6 expression in normal tissues and different cancers. The CLDN6 mRNA expression was analyzed by qRT-PCR in different normal tissue and 47 ovarian carcinoma specimens.

(5) FIG. 5. Technology platform for TCR isolation and validation. The approach integrates all steps from isolation of antigen-specific T cells (top) to TCR cloning (middle) and TCR validation (bottom). HLA-A2/DR1-transgenic mice are immunized with tumor antigen encoding mRNA. Spleen cells of these mice are analyzed for ex vivo reactivity against the respective antigen by IFN-ELISPOT and antigen-specific murine CD8+ T cells are isolated after in vitro restimulation based on activation-induced expression of CD137 by flow cytometry (top). Single cells are harvested in multiwell-plates and subjected to first-strand cDNA synthesis and enrichment by a global PCR amplification step. TCR / variable regions are cloned into vectors for in vitro transcription (IVT) containing the constant region cassettes (middle). TCR / chain RNAs are transferred into human CD8+ T cells, cocultured with APCs expressing the appropriate antigen and HLA molecules and tested for functional reprogramming of engineered T cells (bottom).

(6) FIG. 6: Ex vivo reactivity of spleen cells from immunized HLA-A*02-transgenic mice against CLDN6-derived peptides analyzed by IFN-ELISPOT assay. HLA-A*02 CLDN6-specific binding peptides were predicted applying a specific algorithm (Rammensee H. et al. (1999) Immunogenetics 50, 213-9). Spleen cells were analyzed for reactivity against CLDN6 peptide pool or predicted HLA-A*02-binding CLDN6-derived peptides A2-1-6. Positive control: PMA-treated spleen cells; negative control: an irrelevant peptide pool (HIV-gag), irrelevant nonamer peptide (PLAC1-31-39).

(7) FIG. 7: Flow cytometry sorting of CLDN6-specific murine CD8+ T cells from HLA-A*02-transgenic mice after in-vitro restimulation. Single CD8+/CD137+ T cells were isolated by flow cytometry and harvested in multiwell plates for TCR cloning after restimulation of spleen cells with CLDN6 overlapping peptide pool. Control: spleen cells restimulated with irrelevant peptide pool.

(8) FIG. 8: Specificity testing of TCRs isolated from CD8+ T cells of CLDN6-immunized mice. CD8+ T cells of a HLA-A*02-positive healthy donor were transfected with TCR-/ chain RNAs and tested for recognition of K562-A2 cells transfected with CLDN6 RNA or pulsed with CLDN6 overlapping 15mer peptides (=Cl6 pool) or CLDN6 HLA-A*02 binding peptides (Cl6-A2-1, Cl6-A2-2) by IFN-ELISPOT. Negative controls: irrelevant peptide pool, irrelevant 9mer peptide; Positive control: SEB

(9) FIG. 9: Surface expression of CLDN6-specific murine TCRs on human preactivated CD8+ T cells. CD8+ T cells were preactivated with OKT3 and transfected with 20 g TCR / RNA. 20 h after electroporation cells were stained with a PE-conjugated anti-CD8 antibody and APC-conjugated antibody recognizing the murine constant domain of the TCR 13 chain. Cells were gated on single lymphocytes.

(10) FIG. 10: Tumor cell lysis mediated by CLDN6-specific TCRs. Preactivated CD8+ T cells were transfected with 20 g TCR / RNAs and cocultured 20 h later together with HLA-A*02-expressing CLDN6-positive (PA1-Luc; NIH-OvCar3) or -negative (SK-Mel-37) tumor cell lines with an E:T (effector cell: target cell) ratio of 30:1. Specific lysis was analyzed by luciferase-based cytotoxicity assay after 4 h coculture.

(11) FIG. 11: Dose-dependent proliferation mediated by CLDN6-specific TCRs in response to CLDN6-expressing target cells. CD8+ T cells were transfected with 20 g TCR RNA, labeled with CFSE and cocultured with autologous monocytes transfected with titrated amounts of CLDN6 RNA. After 4 days of coculture cells were stained with an APC-Cy7-labeled anti-CD8 antibody. A) Specific proliferation was analyzed by flowcytometry based on the dilution of the CFSE proliferation dye. Dotplots show living CD8+T lymphocytes after coculture with monocytes transfected with 1 g CLDN6-RNA. B) Bars show the percentage of proliferating CD8+ T cells.

(12) FIG. 12: Surface expression of CLDN6-specific CAR constructs on resting human CD4+ and CD8+ T cells. PBMCs were transfected with 10 g CAR RNA. 20 h after electroporation cells were stained with a PE-conjugated anti-CD8, a FITC-conjugated anti-CD4 and an idiotype-specific antibody labeled with Dylight-650. Cells were gated on single CD4+ or CD8+ T cells.

(13) FIG. 13: Tumor cell lysis mediated by different CLDN-6 targeting receptor formats. Preactivated CD8+ T cells were transfected with CAR or TCR RNAs and cocultured 20 h later together with CLDN6-positive or CLDN6-negative tumor cell lines PA1 and MDA-MB-231-Luc at different E:T ratios. Specific lysis was analyzed by luciferase-based cytotoxicity assay after 4 h coculture.

(14) FIG. 14: Antigen-specific proliferation mediated by CLDN6-specific CAR in response to CLDN6-expressing target cells. CD8+ T cells were transfected with 20 g TCR or CAR RNA, labeled with CFSE and cocultured with autologous iDC transfected with CLDN6 or control RNA for 4 days. A) TCR/CAR surface expression was analyzed by flow cytometry after staining with a murine APC-conjugated TCR-specific or a Dylight650-conjugated idiotype-specific antibody. Specific proliferation was analyzed by flow cytometry based on the dilution of the CFSE proliferation dye.

(15) FIG. 15: Surface expression of different mutants of CLDN6-CAR-28 constructs with mutated cysteine 46 on preactivated CD8+ T cells. CD8+ T cells were preactivated with OKT3 and transfected with 20 g CAR RNA. 20 h after electroporation cells were stained with a PE-conjugated anti-CD8 antibody and an idiotype-specific antibody labeled with Dylight650. Cells were gated on singlets and lymphocytes.

(16) FIG. 16: Surface expression of different mutants of CAR-28 constructs with mutated cysteine 46 on preactivated CD8+ T cells of three different donors. CD8+ T cells were preactivated with OKT3 and transfected with 20 g CAR RNA. 20 h after electroporation cells were stained with an idiotype-specific antibody labeled with Dylight650. Cells were gated on CAR-expressing CD8+T lymphocytes. The results of three independent experiments are shown. Top: the percentage of CAR+/CD8+ T cells is shown; bottom: the mean fluorescence intensity of CAR-positive CD8+ T cells is shown;

(17) FIG. 17: Specific tumor cell lysis mediated by different mutants of CLDN6-CAR-28 constructs with mutated cysteine 46. A) The CLDN6 surface expression on target cell lines was analyzed after staining with a Alexa647-conjugated CLDN6-specific antibody by flow cytometry. B) Preactivated CD8+ T cells were transfected with 20 g CAR RNA and cocultured 20 h later together with CLDN6-positive (PA1) or CLDN6-negative (MDA-MB-231-Luc-Tomato) tumor cell lines at different E:T ratios. Specific lysis was analyzed by luciferase-based cytotoxicity assay after 4 h coculture. C) CAR surface expression on T cells was analyzed after staining with a fluorochrome-conjugated CD8-specific and an idiotype-specific antibody by flow cytometry.

(18) FIG. 18: Dose-dependent lysis of target cells mediated by different mutants of CLDN6-CAR-28 constructs with mutated cysteine 46. A) Preactivated CD8+ T cells were transfected with 20 g CAR RNA and cocultured 20 h later together with autologous iDC transfected with titrated amounts of CLDN6-RNA (E:T=30:1). B) The CLDN6 surface expression on transfected iDCs was analyzed after staining with a Alexa647-conjugated CLDN6-specific antibody by flowcytometry.

(19) FIG. 19: Schematic representation of the retroviral SIN construct used for stable CAR expression. The plasmid pES12.6-CLDN6-CAR-C46S was used for transient generation of GALV-enveloped SIN-vector using HEK293T cells.

(20) FIG. 20: Detection of CLDN6-CAR and CAR against an unrelated tumor antigen on transduced human T cells used for adoptive transfer into NSG mice. Cells were stained with fluorochrome-conjugated antibodies (BD Biosciences) directed against CD8 and CD4 as well as with idiotype-specific antibodies directed against the respective scFv part of the CLDN6-CAR (anti-IMAB206, Ganymed Pharmaceuticals AG) and the CAR against an unrelated tumor antigen, respectively. Cells were gated on single CD8.sup.+ or CD4.sup.+ lymphocytes. Transduced T cells were used for adoptive cell transfer in OV90-SC12-engrafted NSG mice. The transduction rate for the CLDN6-CAR and the CAR against an unrelated tumor antigen was about 37% of CD4.sup.+ and 20% of CD8.sup.+ as well as 36% of CD4.sup.+ and 24 of CD8.sup.+ cells, respectively. Graphs are displayed in logarithmic scale.

(21) FIG. 21: Anti-tumoral activity of CLDN6-CAR transduced T cells in an ovarian carcinoma model. 110.sup.7 human OV90-SC12 tumor cells (ATCC CRL11732) were injected subcutaneously into NSG mice (10 mice/group). After 4 days, the mice were treated with a single intravenous injection of 110.sup.7 CD3/CD28 bead stimulated, retrovirally transduced human T cells (about 37% of CD4 and 20% of CD8 were CLDN6-CAR positive). A) Scheme of the experimental set up. B) Delay of tumor growth in CLDN6-CAR treated mice compared to control groups (no T cells, untransduced T cells, and T cells transduced with CAR against an unrelated tumor antigen). Tumor monitoring by volume measurements and analysis of peripheral blood was performed weekly. Results are expressed as mean tumor volumeSEM with n=10 mice for all groups. Tumor volume was calculated using the following formula: V=*(length*square width). The plot for the CLDN6-CAR treated mice is significantly different from the control treatment group for t=31 days (*ANOVA, P<0.05). C) Tumor-growth curves of the individual mice of each group are shown. Please note, 2 mice in the unrelated tumor antigen group had to be sacrificed on day 24 due to high tumor burden (marked with +).

(22) FIG. 22. Proliferation of CAR T cells after co-culture with CLND6 expressing iDCs. CD8.sup.+ T cells were transfected with IVT-RNA encoding a CAR directed against A) CLDN6 or B) an unrelated tumor antigen as negative control, labeled with CFSE (carboxyfluorescein succinimidyl ester) and cocultured with CLDN6-transfected autologous iDCs for 4 days. Proliferation of CAR T cells was analyzed based on the dilution of CFSE by flowcytometry. Cells were gated on single living CD8.sup.+ T lymphocytes.

EXAMPLES

(23) The techniques and methods used herein are described herein or carried out in a manner known per se and as described, for example, in Sambrook et al., Molecular Cloning: A Laboratory Manual, 2.sup.nd Edition (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. All methods including the use of kits and reagents are carried out according to the manufacturers' information unless specifically indicated.

Example 1: Materials and Methods

(24) Cell Lines and Reagents

(25) The human chronic myeloid leukemia cell line K562 (Lozzio, C. B. & Lozzio, B. B (1975), Blood 45, 321-334) was cultured under standard conditions. K562 cells stably transfected with HLA-A*0201 (Britten, C. M. et al. (2002), J. Immunol. Methods 259, 95-110) (referred to e.g. as K562-A*0201) were used for validation assays. The primary human newborn foreskin fibroblast cell line CCD-1079Sk (ATCC No. CRL-2097) was cultured according to the manufacturers' instructions.

(26) The human CLDN6 expressing ovarian carcinoma cell line OV-90-SC12 was used for in vivo validation of the CLDN6-CAR.

(27) The culture medium for PA-1-SC12_A0201 luc_gfp_F7 is composed of 86% RPMI 1640+ Glutamax (Co. Gibco, Cat-No. 61870), 10% FCS (Co. Biochrome, Cat-No. S0615), 1% Sodium Pyruvate (100 mM) (Co. Gibco, Cat-No. 11360), 1% MEM Non-Essential Amino Acids Solution (100) (Co. Gibco, Cat-No. 11140), 2% Sodium Bicarbonate 7.5% solution (Co. Gibco, Cat-No. 25080).

(28) The culture medium for OV-90-SC12 is composed of 41.5% MCDB 105 (Co. Sigma Aldrich, Cat-No. M6395-1L), 41.5% Medium 199 (Co. Sigma Aldrich, Cat-No. M2154-500 mL), 15% FCS (Co. Biochrome, Cat-No. S0615), 2% Sodium Bicarbonate 7.5% solution (Co. Gibco, Cat-No. 25080).

(29) The culture medium for SK-MEL-37 is composed of 90% DMEM+ Glutamax (Co. Gibco, Cat-No. 31966), 10% FCS (Co. Biochrome, Cat-No. 50615). The culture medium for MDA-MB-231_luc_tom is composed of 88% RPMI 1640+ Glutamax (Co. Gibco, Cat-No. 61870), 10% FCS (Co. Biochrome, Cat-No. S0615), 1% Sodium Pyruvate (100 mM) (Co. Gibco, Cat-No. 11360), 1% MEM Non-Essential Amino Acids Solution (100) (Co. Gibco, Cat-No. 11140). Feeding and/or splitting of the cell lines was done every 2 to 3 days.

(30) Peripheral Blood Mononuclear Cells (PBMCs), Monocytes and Dendritic Cells (DCs)

(31) PBMCs were isolated by Ficoll-Hypaque (Amersham Biosciences, Uppsala, Sweden) density gradient centrifugation from buffy coats. HLA allelotypes were determined by PCR standard methods. Monocytes were enriched with anti-CD14 microbeads (Miltenyi Biotech, Bergisch-Gladbach, Germany). Immature DCs (iDCs) were obtained by differentiating monocytes for 5 days in cytokine-supplemented culture medium as described in Kreiter et al. (2007), Cancer Immunol. Immunother., CII, 56, 1577-87.

(32) Peptides and Peptide Pulsing of Stimulator Cells

(33) Pools of N- and C-terminally free 15-mer peptides with 11 amino acid overlaps corresponding to sequences of Claudin-6 or HIV-gag (referred to as antigen peptide pool) were synthesized by standard solid phase chemistry (JPT GmbH, Berlin, Germany) and dissolved in DMSO to a final concentration of 0.5 mg/ml. Nonamer peptides were reconstituted in PBS 10% DMSO. For pulsing stimulator cells were incubated for 1 h at 37 C. in culture medium using different peptide concentrations.

(34) Vectors for In Vitro Transcription (IVT) of RNA

(35) All constructs are variants of the previously described pST1-sec-insert-2gUTR-A(120)-Sap1 plasmid (Holtkamp, S. et al. (2006), Blood 108, 4009-4017). To obtain plasmids encoding human TCR chains, cDNA coding for TCR- or TCR-.sub.1 and TCR-.sub.2 constant regions were amplified from human CD8+ T cells and cloned into this backbone. For generation of plasmids encoding murine TCR chains, cDNAs coding for TCR-, -.sub.1 and -.sub.2 constant regions were ordered from a commercial provider and cloned analogously (GenBank accession numbers M14506, M64239 and X67127, respectively). Specific V(D)J PCR products were introduced into such cassettes to yield full-length TCR chains (referred to as pST1-human/murineTCR-2gUTR-A(120)).

(36) Analogously, individual HLA class I and II alleles cloned from PBMCs of donors and beta-2-microglobulin (B2M) cDNA from human DCs were inserted into this backbone (referred to as pST1-HLA class I/II-2gUTR-A(120) and pST1-B2M-2gUTR-A(120)).

(37) Plasmids coding for pp65 antigen of CMV (pST1-sec-pp65-MITD-2gUTR-A(120)) and NY-ESO-I (pST1-sec-NY-ESO-1-MITD-2gUTR-A(120)) linked to a secretion signal (sec) and the MHC class I trafficking signal (MITD) were described previously (Kreiter, S. et al. (2008), J. Immunol. 180, 309-318). PLAC1 encoding plasmid pST1-sec-PLAC1-MITD-2gUTR-A(120) was generated by cloning a cDNA obtained from a commercial provider (GenBank accession number NM_021796) into the Kreiter et al. backbone. TPTE encoding plasmids pST1-gUTR-TPTE-2gUTR-A(120) and pST1-gUTR-TPTE-MITD-2gUTR-A(120) were generated by cloning a cDNA obtained from a commercial provider (GenBank accession number AF007118) into a variant of the Holtkamp et al. vector featuring an additional alpha-globin 5-untranslated region.

(38) Primers were purchased from Operon Biotechnologies, Cologne, Germany.

(39) Generation of In Vitro Transcribed (IVT) RNA and Transfer into Cells

(40) Generation of IVT RNA was performed as described previously (Holtkamp, S. et al. (2006), Blood 108, 4009-4017) and added to cells suspended in X-VIVO 15 medium (Lonza, Basel, Switzerland) in a pre-cooled 4-mm gap sterile electroporation cuvette (Bio-Rad Laboratories GmbH, Munich, Germany) Electroporation was performed with a Gene-Pulser-II apparatus (Bio-Rad Laboratories GmbH, Munich, Germany) (T cells: 450 V/250 F; IVSB T cells: 350 V/200 F; SupT1 (ATCC No. CRL-1942): 300 V/200 F; human DC: 300 V/150 F; K562: 200 V/300 F).

(41) In Vivo Priming of T Cells by Intranodal Immunization of HLA A2.1/DR1 Mice with IVT RNA

(42) T cells of A2/DR1 mice (Pajot A. et al. (2004), Eur. J. Immunol. 34, 3060-69) were primed in vivo against the antigen of interest by repetitive intranodal immunization using antigen-encoding IVT RNA (Kreiter S. et al. (2010), Cancer Research 70, 9031-40). For intranodal immunizations, mice were anesthetized with xylazine/ketamine The inguinal lymph node was surgically exposed, 10 L RNA (20 g) diluted in Ringer's solution and Rnase-free water were injected slowly using a single-use 0.3-ml syringe with an ultrafine needle (31G, BD Biosciences), and the wound was closed. After six immunization cycles the mice were sacrificed and spleen cells were isolated.

(43) Harvest of Spleen Cells

(44) Following their dissection under sterile conditions, the spleens were transferred to PBS containing falcon tubes. The spleens were mechanically disrupted with forceps and the cell suspensions were obtained with a cell strainer (40 m). The splenocytes were washed with PBS centrifuged and resuspended in a hypotonic buffer for lysis of the erythrocytes. After 5 min incubation at RT, the reaction was stopped by adding 20-30 ml medium or PBS. The spleen cells were centrifuged and washed twice with PBS.

(45) Single-Cell Sorting of Antigen-Specific CD8+ T Cells after CD137 Staining

(46) For antigen-specific restimulation 2.510{circumflex over ()}6/well spleen cells from immunized A2/DR1 mice were seeded in a 24-well plate and pulsed with a pool of overlapping peptides encoding the antigen of interest or a control antigen. After 24 h incubation cells were harvested, stained with a FITC-conjugated anti-CD3 antibody, a PE-conjugated anti-CD4 antibody, a PerCP-Cy5.5-conjugated anti-CD8 antibody and a Dylight-649-conjugated anti-CD137 antibody. Sorting was conducted on a BD FACS Aria flow cytometer (BD Biosciences). Cells positive for CD137, CD3 and CD8 were sorted, one cell per well was harvested in a 96-well V-bottom-plate (Greiner Bio-One) containing human CCD-1079Sk cells as feeder cells, centrifuged at 4 C. and stored immediately at 80 C.

(47) RNA Extraction, SMART-Based cDNA Synthesis and Unspecific Amplification from Sorted Cells

(48) RNA from sorted T cells was extracted with the RNeasy Micro Kit (Qiagen, Hilden, Germany) according to the instructions of the supplier. A modified BD SMART protocol was used for cDNA synthesis: BD PowerScript Reverse Transcriptase (BD Clontech, Mountain View, CA) was combined with oligo(dT)-T-primer long for priming of the first-strand synthesis reaction and TS-short (Eurogentec S. A., Seraing, Belgium) introducing an oligo(riboG) sequence to allow for creation of an extended template by the terminal transferase activity of the reverse transcriptase and for template switch (Matz, M. et al. (1999) Nucleic Acids Res. 27, 1558-1560). First strand cDNA synthesized according to the manufacturer's instructions was subjected to 21 cycles of amplification with 5 U PfuUltra Hotstart High-Fidelity DNA Polymerase (Stratagene, La Jolla, CA) and 0.48 M primer TS-PCR primer in the presence of 200 M dNTP (cycling conditions: 2 min at 95 C. for, 30 s at 94 C., 30 s at 65 C., 1 min at 72 C. for, final extension of 6 min at 72 C.). Successful amplification of TCR genes was controlled with either human or murine TCR- constant region specific primers and consecutive clonotype-specific human or murine V-/V-PCRs were only performed if strong bands were detected.

(49) First strand cDNA for the amplification of HLA class I or II sequences was synthesized with SuperScriptII Reverse Transcriptase (Invitrogen) and Oligo(dT) primer with 1-5 g RNA extracted from patient-derived PBMCs.

(50) Design of PCR Primers for TCR and HLA Amplification

(51) For design of human TCR consensus primers, all 67 TCR-V and 54 TCR-V genes (open reading frames and pseudogenes) as listed in the ImMunoGeneTics (IMGT) database (http://www.imgt.org) together with their corresponding leader sequences were aligned with the BioEdit Sequence Alignment Editor (e.g. http://www.bio-soft.net). Forward primers of 24 to 27 bp length with a maximum of 3 degenerated bases, a GC-content between 40-60% and a G or C at the 3end were designed to anneal to as many leader sequences as possible and equipped with a 15 bp 5extension featuring a rare restriction enzyme site and Kozak sequence. Reverse primers were designed to anneal to the first exons of the constant region genes, with primer TRACex1_as binding to sequences corresponding to amino acids 7 to 16 of C and TRBCex1_as to amino acids (aa) 8 to 16 in C1 and C2. Both oligonucleotides were synthesized with a 5 phosphate. Primers were bundled in pools of 2-5 forward oligos with identical annealing temperature.

(52) This strategy was replicated for the design of murine TCR consensus primers, aligning 129 listed TCR-V and 35 listed TCR-V genes. Reverse primers mTRACex1_as and mTRBCex1_as are homologous to sequences corresponding to aa 24 to 31 and 8 to 15, respectively.

(53) HLA consensus primers were designed by aligning all HLA class I and II sequences listed on the Anthony Nolan Research Institute website (www.anthonynolan.com) with the BioEdit Sequence Alignment Editor. Forward primers of 23 to 27 bp length with a maximum of 3 degenerated but code-preserving bases annealing to as many as possible HLA sequences of one locus were equipped with a 5-phosphate and Kozak sequence extension. Reverse primers were designed analogously but without introduction of wobble bases and equipped with a 14 bp 5-extension encoding an AsiSI restriction enzyme site.

(54) PCR Amplification and Cloning of V(D)J Sequences

(55) 3-6 l of preamplified cDNA from isolated T cells was subjected to 40 cycles of PCR in the presence of 0.6 M V-/V-specific oligo pool, 0.6 M C- or C-oligo, 200 M dNTP and 5 U Pfu polymerase (cycling conditions: 2 min at 95 C., 30 s at 94 C., 30 s annealing temperature, 1 min at 72 C., final extension time of 6 min at 72 C.). PCR products were analyzed using Qiagen's capillary electrophoresis system. Samples with bands at 400-500 bp were size fractioned on agarose gels, the bands excised and purified using a Gel Extraction Kit (Qiagen, Hilden, Germany). Sequence analysis was performed to reveal the sequence of both the V(D)J domain and constant region, as TRBCex1_as and mTRBCex1_as primer, respectively, match to both TCR constant region genes 1 and 2 in human and mouse, respectively. DNA was digested and cloned into the IVT vectors containing the appropriate backbone for a complete TCR-/ chain.

(56) Flow Cytometric Analyses

(57) Cell surface expression of transfected TCR genes was analyzed by flow cytometry using PE-conjugated anti-TCR antibody against the appropriate variable region family or the constant region of the TCR chain (Beckman Coulter Inc., Fullerton, USA) and FITC-/APC-labeled anti-CD8/-CD4 antibodies (BD Biosciences). Cell surface expression of transfected CARs was analyzed using a Dylight-650-conjugated idiotype-specific antibody (Ganymed Pharmaceuticals) recognizing the scFv fragment contained in all CLDN6-CAR constructs. HLA antigens were detected by staining with FITC-labeled HLA class II-specific (Beckman Coulter Inc., Fullerton, USA) and PE-labeled HLA class I-specific antibodies (BD Biosciences). CLDN6 surface expression on target cells was analyzed by staining with an Alexa-Fluor647-conjugated CLDN6-specific antibody (Ganymed Pharmaceuticals). Flow cytometric analysis was performed on a FACS CANTO II flow cytometer using the FACS Diva software (BD Biosciences).

(58) Luciferase Cytotoxicity Assay

(59) For assessment of cell-mediated cytotoxicity a bioluminescence-based assay was established as an alternative and optimization to .sup.51Cr release. In contrast to the standard chromium release assay, this assay measures lytic activity of effector cells by calculating the number of viable luciferase expressing target cells following coincubation. The target cells were stably or transiently transfected with the luciferase gene coding for the firefly luciferase from firefly Photinus pyralis (EC 1.13.12.7). Luciferase is an enzyme catalyzing the oxidation of luciferin. The reaction is ATP-dependent and takes place in two steps:
luciferin+ATP.fwdarw.luciferyl adenylate+PP.sub.i
luciferyl adenylate+O.sub.2.fwdarw.oxyluciferin+AMP+light

(60) Target cells were plated at a concentration of 10.sup.4 cells per well in white 96-well plates (Nunc, Wiesbaden, Germany) and were cocultivated with varying numbers of TCR-transfected T cells in a final volume of 100 l. 3 h later 50 l of a D-Luciferin (BD Biosciences) containing reaction mix (Luciferin (1 g/l), HEPES-buffer (50 mM, pH), Adenosine 5-triphosphatase (ATPase, 0.4 mU/l, Sigma-Aldrich, St. Louis, USA) was added to the cells. By addition of ATPase to the reaction mix luminescence resulting from luciferase released from dead cells was diminished.

(61) After a total incubation time of 4 h bioluminescence emitted by viable cells was measured using the Tecan Infinite 200 reader (Tecan, Crailsheim, Germany) Cell-killing activity was calculated in regard to luminescence values obtained after complete cell lysis induced by the addition of 2% Triton-X 100 and in relationship to luminescence emitted by target cells alone. Data output was in counts per second (CPS) and percent specific lysis was calculated as follows:
(1(CPS.sub.expCPS.sub.min)/(CPS.sub.maxCPS.sub.min)))*100.

(62) Maximum luminescence (maximum counts per second, CPSmax) was assessed after incubating target cells without effectors and minimal luminescences (CPSmin) was assessed after treatment of targets with detergent Triton-X-100 for complete lysis.

(63) ELISPOT (Enzyme-Linked ImmunoSPOT Assay)

(64) Microtiter plates (Millipore, Bedford, MA, USA) were coated overnight at room temperature with an anti-IFN antibody 1-D1k (Mabtech, Stockholm, Sweden) and blocked with 2% human albumin (CSL Behring, Marburg, Germany) 2-510.sup.4/well antigen presenting stimulator cells were plated in triplicates together with 0.3-310.sup.5/well TCR-transfected CD4+ or CD8+ effector cells 24 h after electroporation. The plates were incubated overnight (37 C., 5% CO.sub.2), washed with PBS 0.05% Tween 20, and incubated for 2 hours with the anti-IFN biotinylated mAB 7-B6-1 (Mabtech) at a final concentration of 1 g/ml at 37 C. Avidin-bound horseradish peroxidase H (Vectastain Elite Kit; Vector Laboratories, Burlingame, USA) was added to the wells, incubated for 1 hour at room temperature and developed with 3-amino-9-ethyl carbazole (Sigma, Deisenhofen, Germany)

(65) CFSE (Carboxyfluorescein Succinimidyl Ester) Proliferation Assay

(66) CD8+ T cells were transfected with TCR or CAR RNA and labeled with 2.5 M CFSE. Labeled T cells were washed and cocultured with RNA-transfected autologous monocytes or iDCs (E:T (effector cells: target(tumor) cells)=10:1). After 4 days of coculture cells were harvested and proliferation was analyzed by flow cytometry based on the progressive halving of CFSE fluorescence within daughter cells following cell divisions.

(67) Retroviral Construct for Stable CAR Expression

(68) For stable expression of the CLDN6-CAR or the CAR against an unrelated tumor antigen used as a negative control the retroviral SIN vector ES12.6 was used (FIG. 19).

(69) Transduction of Human T Cells

(70) For the mouse adoptive cell transfer (ACT) experiments, human T lymphocytes were enriched from PBMCs of healthy donors by removal of monocytes after 2 h of plastic adherence. T lymphocytes were cultured in X-Vivo15 (Lonza) medium supplemented with 5% human AB serum (Invitrogen), 100 U/ml IL2 (Proleukin S, Novartis), 20 ng/ml IL7 (Miltenyi), 10 ng/ml IL15 (Miltenyi) and stimulated with magnetic anti-CD3/anti-CD28 beads (Dynabeads; Invitrogen) at a 1:3 CD3 cell to bead ratio and transduced on days 3 and 4 post stimulation with retroviral supernatants. Cells were expanded in X-Vivo15 medium supplemented with 5% human AB serum, 300 U/ml IL2, 20 ng/ml IL7 and 10 ng/ml IL15. Incubation 37 C., 5% CO.sub.2, 95% rH (FIG. 20).

(71) Mouse Model for In-Vivo Validation of Antitumoral Activity

(72) Xenograft tumors were established by subcutaneous injection of 110.sup.7 OV90-SC12 human ovarian tumor cells into 8-14 week-old NOD.Cg-Prkdcscid Il2rgtm1Wjl/SzJ (NSG) mice (The Jackson Laboratory, Bar Harbor, ME). After 4 days, mice were treated with a single intravenous injection of 110.sup.7 of CAR transduced T cells (20-37% CAR positive). Tumor monitoring was performed weekly by volume measurements using caliper (FIG. 21(a)).

Example 2: Isolation of High-Affinity HLA-A*02-Restricted Murine TCRs Specific for Claudin-6

(73) We validated the immunogenic potential of CLDN6 in A2/DR1 mice by repetitive intranodal immunization with CLDN6 encoding IVT-RNA and used spleen cells of these mice for isolation of CLDN6-specific T cells and subsequent cloning of the corresponding TCR genes (FIG. 5). Spleen cells of immunized mice were analyzed for the successful induction of CLDN6-specific T cells and their reactivity against predicted HLA-A*02 binding CLDN6 peptides ex-vivo by IFN-ELISPOT assay (FIG. 6).

(74) Significant frequencies of CLDN6-specific T cells could be induced In all three mice by RNA immunization, whereas T cell reactivity was focused on two CLDN6 peptides predicted, that were with the best HLA-A*02 binding score (Cl6-A2-1 and Cl6-A2-2).

(75) For isolation of CLDN6-specific T cells, spleen cells of immunized mice were restimulated in-vitro and sorted by flow cytometry based on the activation-induced upregulation of CD137 (FIG. 7).

(76) CLDN6-specific CD8+ T cells could be retrieved from all three immunized A2/DR1 mice and a total of 11 CLDN6-specific TCRs were cloned from single-sorted murine T cells.

(77) TCRs were subjected to immunological validation assays, which revealed that six CLDN6-TCRs recognized the HLA-A*0201-restricted epitope CLDN6-91-99 (Cl6-A2-1) and four CLDN6-TCRs were specific for CLDN6-14-22 (Cl6-A2-2), whereas both epitopes were previously identified by ex-vivo ELISPOT analysis (FIG. 8). One CLDN6-TCR (TCR.sub.CD8-CLDN6#7) recognized the peptide CLDN6-7-15 (Cl6-A2-3).

Example 3: Comparative Testing of Murine TCRs Specific for CLDN6 91-99

(78) In total six murine TCRs were identified that all recognize the HLA-A*02-restricted epitope CLDN6-91-99. In order to confirm that this epitope is naturally processed and presented by endogenously CLDN6 expressing tumor cell lines and to evaluate the potential of the identified murine TCRs to mediate killing of such cells a luciferase-based cytotoxicity assay was performed. Human preactivated CD8+ T cells were transfected with TCR RNA and surface expression was analyzed by flow cytometry (FIG. 9). All murine TCRs were expressed on a high percentage of human CD8+ T cells after RNA transfer as indicated by staining with an fluorochrome-conjugated antibody specific for the constant domain of the murine TCR- chain. TCR-transfected T cells were subjected to luciferase-based cytotoxicity assay together with the CLDN6-expressing tumor cell lines PA1 (teratoma) and NIH-Ovcar3 (ovarian carcinoma). The CLND6-negative breast cancer cell line MDA-MB-231 served as negative control. All TCRs mediated efficient lysis of CLDN6-expressing tumor cell lines ranging from 38-94% of PA1 and 29-76% of NIH-Ovcar3, while no lysis could be observed with untransfected T cells (FIG. 10). Most target cells were lysed when the mTCR.sub.CD8-CLDN6 #1, #8 or #18 were used. In order to analyze, if the murine TCRs can mediate specific proliferation of human T cells after coculture with autologous antigen-expressing target cells a CFSE proliferation assay was performed (FIG. 11). TCR-transfected CD8+ T cells were cocultured with autologous monocytes transfected with titrated amounts of CLDN6 RNA. All TCRs mediated specific proliferation indicated by the dilution of the CFSE proliferation dye after 4 days of coculture with CLDN6-RNA-transfected CD14+ cells, whereas again mTCR.sub.CD8-CLDN6 #1, #8 or #18 showed the best results, especially when low amounts of CLDN6 RNA were transfected into the target cells. We decided to use mTCR.sub.CD8-CLDN6 #18 as a gold standard for the lead structure selection together with CLDN6 targeting CAR formats.

Example 4: Generation and In-Vitro Validation of Claudin-6-Specific CARs

(79) We evaluated two different CAR formats to specifically target CLDN6 on CLDN6 expressing target cells. One of them represents a novel format based on the linkage of the scFv with the constant domain of the murine TCR chain and coexpression of the constant domain of the TCR chain (CAR/C) (Voss R H et al., (2011) Molecular Therapy 19, supplement, S86) (FIG. 3). The second format represents a classical 2nd generation CAR (CAR-28) that contains the signaling and costimulatory moieties of CD3 and CD28, respectively. A deletion of the lck binding moiety in the CD28 endodomain abrogates IL2 secretion upon CARengagement to prevent induction of regulatory T cells (Kofler D. M. et al., (2011) Molecular Therapy 19 (4), 760-767). A modification of the IgG1 Fc spacer domain in the extracellular moiety of the CAR avoids off-target activation and unintended initiation of an innate immune response (Hombach A. et al., (2010) Gene Therapy 17, 1206-1213).

(80) As CARs provide HLA independent scFv-mediated antigen-binding they are functional in both CD4+ and CD8+ T cells. Therefore, we first analyzed the CAR surface expression on CD4+ and CD8+ T cells after transfection of CAR RNA into bulk PBMCs.

(81) Both, the novel CAR/C and the classical 2nd generation CAR (CAR-28) are expressed on the surface of human T cells after RNA transfer (FIG. 12). The CAR-2 was significantly better expressed on the surface of CD4+ and CD8+ T cells than the CAR/C. The latter one was transferred either by cotransfection of the CAR and the C chain or as a 2A peptide-based bicistronic vector for simultaneous expression of CAR and C genes. Flow cytometry analysis demonstrated that the 2A-based linkage of CAR and C results in decreased surface expression compared to coexpression of the two components. As a bicistronic vector would be used for clinical testing the linkage of the two CAR/C components has to be further improved.

(82) To analyze the specific tumor cell lysis mediated by the different CLDN6-targeting receptor formats a luciferase-based cytotoxicity assay was performed. CAR- or TCR-transfected preactivated CD8+ T cells were cultured with CLDN6-positive or negative tumor cell lines at different effector-to-target ratios and the specific lysis was calculated after 4 h of coculture (FIG. 13). All CAR- and TCR-transfected T cells demonstrated significant specific lysis of CLDN6 expressing tumor cell lines compared to untransfected T cells.

(83) A prerequisite for the proliferation and persistence of CAR-engineered T cells in the patient is the presence of antigen as demonstrated by promising clinical trial results of CD19-specific CARs in hematologic malignancies. In analogy to the expansion of endogenous T cells by RNA immunization, we wanted to analyze, if CAR T cells could also be expanded using RNA-vaccination of target cells to provide natural CLND6 for CAR T cell stimulation. An in vitro proliferation assay was performed using CAR-transfected CD8+ T cells together with CLDN6 or control RNA-transfected autologous iDCs (FIG. 14). The mTCR.sub.CD8-CLDN6 #18 mediated best proliferation in response to CLDN6-transfected target cells (73%). The CLDN6-CAR-28 also resulted in a significant proportion of proliferating T cells (44%), while the CLDN6-CAR/C failed to induce proliferation probably due to the lack of CD28-mediated costimulation. As induction of proliferation is a prerequisite for successful antitumoral activity, we decided to use CAR-28 format for further lead structure selection.

Example 5: CLDN6-CAR-28 Lead Structure Selection for Preclinical and Clinical Testing

(84) The CLDN6-CAR-2 scFv fragment that is responsible for antigen recognition contains an unpaired cysteine. As such a free cysteine could result in misfolding of the CAR protein under certain circumstances or in unwanted interactions with other cyteines by the formation of disulfide bonds, we decided to eliminate this cysteine and exchanged it by a serine, a glycine or an alanine.

(85) We than comparatively analyzed the resulting CLDN6-CAR-2 constructs regarding surface expression (FIG. 15, 16) and cytotoxicity (FIG. 17). Except of the glycine variant all mutated constructs demonstrated surface expression and lysis comparable to the wild-type variant.

(86) In order to compare the affinity of the mutated CAR constructs their cytotoxic potential in response to autologous iDCs transfected with titrated amounts of CLDN6 RNA was analyzed. Even extremely little amounts of CLDN6 RNA (0.001 g) resulted in significant lysis of target cells mediated by all CAR constructs. As the serine variant of the CLDN6-CAR-28 showed slightly better results regarding surface expression and cytotoxicity, we decided to use this variant for preclinical testing.

Example 6: In-Vivo Antitumoral Activity of the CLDN6-CAR

(87) After having determined the antitumor activity against CLDN6 expressing tumor cell lines in-vitro the antitumor ability in tumor-bearing mice was determined. Therefore, the potency of CLDN6-CAR transduced human T cells was compared to T cells transduced with a control CAR against an unrelated tumor antigen and untransduced T cells in a xenograft model. A total of 110.sup.7 cells of the human ovarian carcinoma cell line OV90-SC12 were injected subcutaneously in NSG mice. Four days after tumor engraftment the mice were treated with a single intravenous injection of 110.sup.7 of CAR-transduced T cells. Tumor monitoring was performed weekly by volume measurements using caliper. Treatment of the mice with CLDN6-CAR-transduced T cells significantly slowed tumor growth compared to control groups treated with unrelated tumor antigen-CAR-transduced, untransduced T cells or a group not receiving T cells (FIGS. 21 (b) and (c)).

Example 7: In-Vitro Proliferation of CLDN6-CAR T Cells in Response to CLDN6-Expressing Target Cells

(88) In analogy to the expansion of endogenous T cells by RNA immunization, the stimulation and expansion of CAR T cells using RNA-vaccination of target cells to provide natural CLND6 was analyzed by in vitro proliferation assay. CD8.sup.+ T cells were transfected with IVT-RNA encoding a CAR against CLDN6 or an unrelated tumor antigen as negative control, labeled with CFSE (carboxyfluorescein succinimidyl ester) and cocultured with CLDN6-transfected autologous iDCs for 4 days (FIG. 22). The CLDN6-CAR mediated proliferation of nearly all CD8.sup.+ T cells in response to CLDN6-transfected iDC could be observed (95%), while only background proliferation (1.5%) could be observed for unrelated tumor antigen-CAR transfected T cells indicating that proliferation was not depending on the CAR backbone but was CLDN6-specific.

(89) TABLE-US-00001 CLDN6-specificTcellepitopes A2-1(aa91-99) ALFGLLVYL A2-2(aa14-22) TLLGWVNGL A2-3(7-15) QILGVVLTL CLDN6-specificTcellreceptors TCR.sub.CD8-mC16#1: SEQIDNO:6;>V9N.3J13C MLLALLSVLGIHFLLRDAQAQSVTQPDARVTVSEGASLQLRCKYSYFGTPYLFWYVQY PRQGLQLLLKYYPGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDWAVYFCAVSMSS GTYQRFGTGTKLQVVPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFI TDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETD MNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:7;>V29D1J2.5C2 MRVRLISAVVLCFLGTGLVDMKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQ DPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSSQNQ DTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSW WVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEED KWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGL VLMAMVKKKNS TCR.sub.CD8-mC16#2: SEQIDNO:8;>V6N.6J23C MDSFPGFVAVILLILGRTHGDSVTQTEGQVTVSESKSLIINCTYSATSIGYPNLFWYVRYP GEGLQLLLKVITAGQKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALNNQGKLI FGQGTKLSIKPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVL DMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQ NLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:9;>V13.2D1J2.4C2 MGSRLFFVLSSLLCSKHMEAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDT GHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGDSQN TLYFGAGTRLSVLEDLRNVTPPKVSLFE,PSKAEIANKQKATLVCLARGFFPDHVELSWW VNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDK WPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGLVL MAMVKKKNS TCR.sub.CD8-mC16#3: SEQIDNO:18;>V16NJ6C MLILSLLGAAFGSICFAATSMAQKVTQTQTSISVVEKTTVTMDCVYETRDSSYFLFWYK QTASGEIVFLIRQDSYKKENATVGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRDSSG GNYKPTFGKGTSLVVHPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTF ITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFET DMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:19;>V2D2J2.4C2 MGSIFLSCLAVCLLVAGPVDPKIIQKPKYLVAVTGSEKILICEQYLGHNAMYWYRQSAK KPLEFMFSYSYQKLMDNQTASSRFQPQSSKKNHLDLQITALKPDDSATYFCASSQEDWG SQNTLYFGAGTRLSVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELS WWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSE EDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVS GLVLMAMVKKKNS TCR.sub.CD8-mC16#7: SEQIDNO:28;>V6N.7orV6D.7_4J26C MDSFPGFMTVMLLIFTRAHGDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYP GEGPQFLFRASRDKEKGSSRGFEATYDKGTTSFHLRKASVQESDSAVYYCALGNNYAQ GLTFGLGTRVSVFPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDK TVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNL NFQNLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:29;>V13.3D1J1.4_02C1 MGSRLFFVVLILLCAKHMEAAVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDT GHGLRLIHYSYVADSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASSTGNERL FFGHGTKLSVLEDLRNVTPPKVSLl-E,PSKAEIANKQKATLVCLARGFFPDHVELSWWVN GKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWP EGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVM AMVKRKNS TCR.sub.CD8-mC16#8: SEQIDNO:10;>V16NJ13C MLILSLLGAAFGSICFATSMAQKVTQTQTSISVVEKTTVTMDCVYETRDSSYFLFWYKQ TASGEIVFLIRQDSYKKENATVGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMREAANS GTYQRFGTGTKLQVVPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFI TDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETD MNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:11;>V2D1J1.3C1 MGSIFLSCLAVCLLVAGPVDPKIIQKPKYLVAVTGSEKILICEQYLGHNAMYWYRQSAK KPLEFMFSYSYQKLMDNQTASSRFQPQSSKKNHLDLQITALKPDDSATYFCASSQQNSG NTLYFGEGSRLIVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSW WVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEED KWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLV VMAMVKRKNS TCR.sub.CD8-mC16#10: SEQIDNO:20;>V13D.4_03J42C MKRLVCSLLGLLCTQVCWVKGQQVQQSPASLVLQEGENAELQCNFSSTATRLQWFYQ RPGGSLVSLLYNPSGTKHTGRLTSTTVTKERRSSLHISSSQTTDSGTYFCAMSSNSGGSN AKLTFGKGTKLSVKSNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFIT DKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETD MNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:21;>V4_02D2J2.7C2 MGCRLLSCVAFCLLGIGPLETAVFQTPNYRVTRVGNEVSFNCEQTLDHNTMYWYKQDS KKLLKIMFSYNNKQLIVNETVPRRFSPQSSDKAHLNLRIKSVELEDSAVYLCASSDWGDS YEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSW WVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEED KWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGL VLMAMVKKKNS TCR.sub.CD8-mC16#12: SEQIDNO:12;>V3.3J50C MKTVTGPLFLCFWLQLNCVSRGEQVEQRPPHLSVREGDSAVITCTYTDPNSYYFFWYK QEPGASLQLLMKVFSSTEINEGQGFTVLLNKKDKRLSLNLTAAHPGDSAAYFCAVESSS FSKLVFGQGTSLSVVPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFIT DKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETD MNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:13;>V26D2J2.5C2 MATRLLCYTVLCLLGARILNSKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNK NNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLTGGA QDTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELS WWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSE EDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVS GLVLMAMVKKKNS TCR.sub.CD8-mC16#13: SEQIDNO:22;>V16NJ22C MLILSLLGAAFGSICFAATSMAQKVTQTQTSISVVEKTTVTMDCVYETRDSSYFLFWYK QTASGEIVFLIRQDSYKKENATVGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRVASS GSWQLIFGSGTQLTVMPDIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTF ITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFET DMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:23;>V2D1J2.1C2 MGSIFLSCLAVCLLVAGPVDPKIIQKPKYLVAVTGSEKILICEQYLGHNAMYWYRQSAK KPLEFMFSYSYQKLMDNQTASSRFQPQSSKKNHLDLQITALKPDDSATYFCASSQGDNN YAEQFFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELS WWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSE EDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVS GLVLMAMVKKKNS TCR.sub.CD8-mC16#14: SEQIDNO:14;>V4N.4orV4D.4_03J6C MQRNLVAVLGILWVQICWVRGDQVEQSPSALSLHEGTGSALRCNFTTTMRAVQWFRK NSRGSLINLFYLASGTKENGRLKSAFDSKERYSTLHIRDAQLEDSGTYFCAAEGGGNYK PTFGKGTSLVVHPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKT VLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNL NFQNLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:15;>V31D1J1.1C1 MLYSLLAFLLGMFLGVSAQTIHQWPVAEIKAVGSPLSLGCTIKGKSSPNLYWYWQATG GTLQQLFYSITVGQVESVVQLNLSASRPKDDQFILSTEKLLLSHSGFYLCAWSPPINTEVF FGKGTRLTVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVN GKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWP EGSPKPVTQNISAEAWGRADCGITSASYQQGVLSATILYEILLGKATLYAVLVSTLVVM AMVKRKNS TCR.sub.CD8-mC16#15: SEQIDNO:24;>V3.1J39C MKTVTGPLLLCFWLQLNCVSRGEQVEQRPPHLSVREGDSAIIICTYTDSATAYFSWYKQ EAGAGLQLLMSVLSNVDRKEEQGLTVLLNKKDKRLSLNLTAAHPGDSAVYFCATNAG AKLTFGGGTRLTVRPDIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFIT DKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETD MNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:25;>V4D2J2.7C2 MGCRLLSCVAFCLLGIGPLETAVFQTPNYHVTQVGNEVSFNCKQTLGHDTMYWYKQD SKKLLKIMFSYNNKQLIVNETVPRRFSPQSSDKAHLNLRIKSVEPEDSAVYLCASSLYWG DSYEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELS WWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSE EDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVS GLVLMAMVKKKNS TCR.sub.CD8-mC16#17: SEQIDNO:26;>V14.3orV14D.3/DV8_08J22C MDKNLTASFLLLGLHLAGVSGQQEKRDQQQVRQSPQSLTVWEGETAILNCSYENSAFD YFPWYQQFPGEGPALLISILSVSDKKEDGRFTIFFNKREKKLSLHIADSQPGDSATYFCAA SLSSGSWQLIFGSGTQLTVMPDIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTME SGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEK SFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:27;>V3D2J2.7C2 MDIWLLGWIIFSFLEAGHTGPKVLQIPSHQIIDMGQMVTLNCDPVSNHLYFYWYKQILG QQMEFLVNFYNGKVMEKSKLFKDQFSVERPDGSYFTLKIQPTALEDSAVYFCASSLVGG YEQYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSW WVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEED KWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGL VLMAMVKKKNS TCR.sub.CD8-mC16#18: SEQIDNO:16;>V6D.6_02J4C MDSSPGFVAVILLILGRTHGDSVTQTEGPVTVSESESLIINCTYSATSIAYPNLFWYVRYP GEGLQLLLKVITAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALGETGSFN KLTFGAGTRLAVCPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITD KTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDM NLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS SEQIDNO:17;>V26D1J2.7C2 MATRLLCYTVLCLLGARILNSKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNK NNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLGIYE QYFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWV NGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKW PEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGLVLM AMVKKKNS