Compositions comprising chemerin analogs and methods of use
12559523 ยท 2026-02-24
Assignee
Inventors
Cpc classification
A61P29/00
HUMAN NECESSITIES
C07K5/0215
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
A61K9/0014
HUMAN NECESSITIES
A61K47/60
HUMAN NECESSITIES
A61K47/542
HUMAN NECESSITIES
International classification
A61P29/00
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61K47/60
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
Abstract
The present disclosure relates to peptide compositions and methods for treating an inflammatory condition such as ocular inflammation, retinal inflammation, dry eye, uveitis, allergic conjunctivitis, and inflammation resulting from nerve injury or nerve degeneration. The peptide compositions disclosed herein can also be used for treating pain such as neuropathic pain, ocular pain, chronic pain, pain resulting from chemotherapy or radiation, pain resulting from nerve injury or nerve degeneration, and pain resulting from an inflammatory condition, dysesthesia, or allodynia.
Claims
1. A composition comprising a peptide selected from: TABLE-US-00004 (SEQIDNO:2) AAFY-Nle-PSQYA-Tic-dA; (SEQIDNO:3) AG-dY-F-Nle-P-dS-Aad-FA-Tic-dA; (SEQIDNO:4) dA-G-dY-F-Nle-P-dS-Q-fF-dA-Tic-dA; (SEQIDNO:5) NorV-G-dY-F-Nle-P-dS-QF-dA-Tic-dA; (SEQIDNO:6) AG-dY-F-Nle-P-dS-QFA-Tic-dS; and (SEQIDNO:7) dA-G-dY-F-Nle-P-dS-QF-dA-Tic-dA, wherein Nle denotes norleucine, Tic denotes(S)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid, dA denotes D-alanine, dY denotes D-tyrosine, dS denotes D-serine, Aad denotes -aminoadipic acid, fF denotes fluorinated phenylalanine and NorV denotes norvaline; and wherein palmitic acid-PEG8 is linked at the N-terminus of the peptide, wherein PEG8 denotes an average number of 8 ethylene glycol units.
2. A pharmaceutical composition comprising the composition of claim 1 and a pharmaceutically acceptable carrier.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2) ##STR00003##
(3)
(4) ##STR00004##
(5)
(6)
(7)
(8)
DETAILED DESCRIPTION OF THE DISCLOSURE
(9) As described in further detail herein, there is an unmet need for novel strategies to treat pain, in particular neuropathic pain, a disease which affects millions of people worldwide and occurs in as much as 7% of the population. The management of patients with neuropathic pain is complex, with many patients not responding to treatment or only experiencing partial relief. At the extreme, there is a substantial subpopulation with moderate to severe chronic refractory pain where there is an urgent need for more effective, long acting therapeutics.
(10) CMKLR1 is a G protein-coupled receptor which has been shown to modulate nociception. This receptor is expressed in glia, dorsal root ganglion neurons, and immune cells. The endogenous ligand (agonist) for CMKLR1 is chemerin, a 163 amino acid protein Chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), tazarotene-induced gene 2 protein (TIG2), or RAR-responsive protein TIG2, is a protein that in humans is encoded by the RARRES2 gene. The Homo sapiens' amino acid sequence of chemerin is shown below in SEQ ID NO: 8.
(11) TABLE-US-00001 NCBIReferenceSequence:NP_002880.1 (SEQIDNO:8) MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKH PPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKR DWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKAL PRS.
(12) Chemerin is inactive as pre-prochemerin (having SEQ ID NO: 8) and is activated through cleavage of the C-terminus and N-terminus to form a chemerin fragment having an amino acid sequence from position 21 to 157 of SEQ ID NO: 8, which can function as an agonist for CMKLR1 This chemerin fragment has the following amino acid sequence:
(13) TABLE-US-00002 (SEQIDNO:9) ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPF PAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLA CIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR AGEDPHSFYFPGQFAFS.
(14) Among other things, the present disclosure provides a composition comprising a chemerin analog that can retain some or all of the biological functions of the amino acid sequence of SEQ ID NO: 9, e.g., functioning as an agonist of CMKLR1. The chemerin analog can be an analog of either the full length or a fragment of chemerin.
(15) In one aspect, the present disclosure provides a composition comprising: a peptide comprising amino acids having a sequence of X.sub.1X.sub.2X.sub.3X.sub.4-Nle-PX.sub.5X.sub.6X.sub.7X.sub.8-Tic-X.sub.9 (SEQ ID NO: 1), and a lipid entity linked to the peptide. In some embodiments, any one or more than one of the amino acids in the peptide can be either an L-amino acid or a D-amino acid. In some embodiments, any one or more than one of the amino acids in the peptide can be fluorinated. As used herein, a fluorinated amino acid is an amino acid in which one or more hydrogen is replaced by a fluorine. As used herein, Nle refers to norleucine; and Tic refers to (S)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid.
(16) In some embodiments, X.sub.1 is selected from A, dA, and NorV; X.sub.2 is A or G; X.sub.3 is F or dY; X.sub.4 is F or Y; X.sub.5 is S or dS; X.sub.6 is Q or -aminoadipic acid (Aad); X.sub.7 is selected from Y, F, and fF; X.sub.8 is A or dA; and X.sub.9 is dA or dS.
(17) As used herein, NorV refers to norvaline.
(18) As used herein, a lowercase d in front of an amino acid denotes a D-amino acid of that amino acid. For example, dA denotes D-alanine; dY denotes D-tyrosine; and dS denotes D-serine.
(19) As used herein, a lowercase f in front of an amino acid denotes that the amino acid is fluorinated. For example, f denotes fluorinated phenylalanine.
(20) In some embodiments, the peptide has no more than 20 amino acids, no more than 19 amino acids, no more than 18 amino acids, no more than 17 amino acids, no more than 16 amino acids, no more than 15 amino acids, no more than 14 amino acids, no more than 13 amino acids, or no more than 12 amino acids.
(21) In some embodiments, the peptide has at least 9 amino acids, at least 10 amino acids, at least 11 amino acids, or at least 12 amino acids.
(22) Combinations of the above-referenced ranges for the number of amino acids are also possible. For example, the peptide can have about 9 to 20 amino acid, about 10 to 20 amino acids, or about 10 to 18 amino acids.
(23) In some embodiments, the peptide consists of amino acids having the sequence of X.sub.1X.sub.2X.sub.3X.sub.4-Nle-PX.sub.5X.sub.6X.sub.7X.sub.8-Tic-X.sub.9 (SEQ ID NO: 1).
(24) In some embodiments, the peptide comprises AAFY-Nle-PSQYA-Tic-dA (SEQ ID NO: 2), AG-dY-F-Nle-P-dS-Aad-FA-Tic-dA (SEQ ID NO: 3), dA-G-dY-F-Nle-P-dS-Q-fF-dA-Tic-dA (SEQ ID NO: 4), NorV-G-dY-F-Nle-P-dS-QF-dA-Tic-dA (SEQ ID NO: 5), AG-dY-F-Nle-P-dS-QFA-Tic-dS (SEQ ID NO: 6), or dA-G-dY-F-Nle-P-dS-QF-dA-Tic-dA (SEQ ID NO: 7).
(25) In some embodiments, the peptide consists of AAFY-Nle-PSQYA-Tic-dA (SEQ ID NO: 2), AG-dY-F-Nle-P-dS-Aad-FA-Tic-dA (SEQ ID NO: 3), dA-G-dY-F-Nle-P-dS-Q-fF-dA-Tic-dA (SEQ ID NO: 4), NorV-G-dY-F-Nle-P-dS-QF-dA-Tic-dA (SEQ ID NO: 5), AG-dY-F-Nle-P-dS-QFA-Tic-dS (SEQ ID NO: 6), or dA-G-dY-F-Nle-P-dS-QF-dA-Tic-dA (SEQ ID NO: 7).
(26) Any of a variety of lipid entities may be utilized in accordance with the present disclosure. According to various embodiments, a lipid entity can comprise an entity capable of insertion into a lipid bilayer (e.g., a cell membrane). In some embodiments, a lipid entity is capable of incorporating into a lipid raft in a lipid bilayer (e.g., a cell membrane).
(27) In some embodiments, the lipid entity can comprise a saturated or unsaturated fatty acid. The numbers in the lipid name are used to describe the fatty acid chains on the lipid. The numbers are generally presented in the format (number of carbons in fatty acid chain):(number of double bonds in fatty acid chain), e.g., 16:0 would be 16 carbons in the fatty acid chain with zero double bonds. The saturated or unsaturated fatty acid can include at least 4 carbons, at least 5 carbons, at least 6 carbons, at least 7 carbons, at least 8 carbons, at least 9 carbons, at least 10 carbons, or at least 15 carbons in the fatty acid chain. In some embodiments, the saturated or unsaturated fatty acid can include about 4-24 carbons in the fatty acid chain. The number of double bonds in the fatty acid chain can be in the range of 0-10, e.g., 0-8, 0-6, 1-8, 1-6. For example, the lipid entity can be C22:0, C22:1, C22:2, C22:3, C22:4, C22:5, C22:6, C20:0, C20:1, C20:2, C20:3, C20:4, C20:5, C20:6, C18:0, C18:1, C18:2, C18:3, C18:4, C18:5, C18:6, C10:0, C10:1, C10:2, C10:3, C10:4, etc.
(28) For example, the lipid entity can be selected from the group consisting of -linolenic acid, -linolenic acid, stearidonic acid, eicosapentaenoic acid, docosahexaenoic acid, linoleic acid, dihomo--linolenic acid, arachidonic acid, docosatetraenoic acid, palmitoleic acid, vaccenic acid, paullinic acid, oleic acid, elaidic acid, gondoic acid, erucie acid, nervonic acid, mead acid, myristic acid, palmitic acid, stearic acid, 1,2-dipaimitoyl-sn-glycero-3-phosphoethanolamine (DPPE), GM11 ganglioside, GaM2 ganglioside, GM3 ganglioside, 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-dioleoyl-sn-glycero-3-phospho-L-serine (DOPS), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), a glycosphingolipid, a sphingolipid, phosphatidylinositol 4,5-bisphosphate (PIP2), a ceramide, cholesterol, ergosterol, phytosterol, a hopanoid, a steroid, fluorinated-GM1, fluorinated-GM2, fluorinated-GM3, 17-carboxy-1-oxo-heptadecyl, and an isoprenoid lipid (e.g., farnesyl (C-15) or geranylgeranyl (C-20)). In some embodiments, the lipid entity can be -linolenic acid. In some embodiments, the lipid entity can be -linolenic acid. In some embodiments, the lipid entity can be palmitic acid. In some embodiments, the lipid entity can be vaccenic acid. In some embodiments, the lipid entity can be oleic acid. In some embodiments, the lipid entity can be elaidic acid. In some embodiments, the lipid entity can be myristic acid. In some embodiments, the lipid entity can be 17-carboxy-1-oxo-heptadecyl.
(29) The attachment of a lipid entity to a peptide is referred to herein as lipidation. In some embodiments, the lipid entity is linked to the peptide covalently. In some embodiments, lipidation comprises the attachment of a peptide with any compound that is soluble in a cellular membrane (e.g., 10:1 in equilibrium constant K.sub.assoc10).
(30) In some embodiments, lipidation may comprise one or more of the following: attachment of diacylglycerol to the side chain of an N-terminal cysteine of a peptide via the sulfur atom; attachment of O-octanoyl to a serine or threonine of a peptide; and attachment of S-archaeol to a cysteine of a peptide. In some embodiments, lipidation may occur, for example, at any lysine, glutamic acid, aspartic acid, serine, threonine, cysteine, and/or tyrosine.
(31) In some embodiments, lipidation may include fluorination. Fluorination can include the addition of one or more C.sub.6F.sub.13 chains. Without wishing to be bound by theory, it is thought that the presence of one or more C.sub.6F.sub.13 chains may allow a lipid entity to segregate from hydrocarbon lipid membrane components (see J. Am. Chem. Soc. 2007, 129, 9037-9043; J. Phsy. Chem. B, 2008, 112, 8250-8256; J. Am. Chem. Soc., 2009, 131, 12091-12093).
(32) In some embodiments, the lipid entity is attached to an amino acid residue which can be at or near the N-terminus of the peptide. In some embodiments, the lipid entity can be attached to an amino acid residue which is at or near the C-terminus of the peptide.
(33) In some embodiments, the presence of at least one alkene in the structure of a lipid entity provides increased fluidity in a membrane (i.e., greater ability to move within the membrane) as compared to similar lipid entities lacking at least one alkene. In some embodiments, a lipid entity with greater fluidity is able to provide enhanced activity towards targets (e.g., receptors, ion channels, or enzymes) with a low density in a membrane. Without wishing to be bound by theory, it is possible that a lipid entity with increased ability to move within a membrane are able to encounter a low density target faster than a lipid entity with less mobility within a membrane.
(34) The lipid entity can be linked to the peptide through a linker entity. As such, the composition can have the follow formula:
(35) ##STR00005##
(36) In some embodiments, the linker entity can have a length of between about 2 and 300 , inclusive. In some embodiments, the linker entity is between 30 and 150 , inclusive.
(37) In some embodiments, the linker entity is attached to an amino acid residue which can be at or near the N-terminus of the peptide. In some embodiments, the linker entity can be attached to an amino acid residue which is at or near the C-terminus of the peptide.
(38) In some embodiments, the linker entity can comprise one or more amino acids, which can either be natural or synthetic. For example, the linker entity can comprise a Glycine, Alanine, Leucine, Methionine, Phenylalanine, Tryptophan, Lysine, Glutamine, Glutamic Acid, Serine, Proline, Valine, Isoleucine, Cysteine, Tyrosine, Histidine, Arginine, Asparagine, Aspartic Acid, Threonine, or a combination thereof.
(39) In some embodiments, the linker entity can comprise a peptide (peptide linker), e.g., between about 2 and 20 amino acid residues in length, or between about 5 and 10 amino acid residues in length. According to various embodiments, peptide linkers can be designed such that one or more -helices are formed between the peptide described herein and a lipid entity. In some embodiments, a peptide linker may comprise a plurality of -helices. In some embodiments, the plurality of -helices is consecutive. In some embodiments, a plurality of -helices is 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more -helices.
(40) In some embodiments, a peptide linker can comprise repeating units, for example a plurality of repeating glycine-asparagine (GN) units. In some embodiments, a peptide linker can comprise an epitope tag (e.g., a c-Myc tag) or other markers to allow for identification and/or characterization of provided agents and their fate in vitro and/or in vivo.
(41) In some embodiments, the peptide linker can comprise the amino acid sequence of GGK or GG.
(42) In some embodiments, the linker entity can comprise a non-peptide entity (non-peptide linker). In some embodiments, the linker entity can comprise ethylene glycol and/or aminoethylethanolamine (AEEA). In some embodiments, non-peptide linkers may be a synthetic polymer. According to various embodiments, the synthetic polymer may be any of a variety of lengths. In some embodiments, a linker entity comprising a synthetic polymer comprises a monomeric unit of the polymer. In some embodiments, a linker entity comprising a synthetic polymer comprises two or more monomeric units of a synthetic polymer (e.g., 2, 3, 4, 5, 6, 7, 9, 10, 20, 30, 40, 50, 100 or more monomeric units).
(43) In some embodiments, a linker entity can comprise a polyethylene glycol (PEG). In Some embodiments, the average number of ethylene glycol units in the PEG is 2-20, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In some embodiments, the linker entity can comprise PEG8, which means that the average number of ethylene glycol units is 8.
(44) Non-limiting examples of suitable polymeric linkers include linkers with one or more monomeric units according to one of the following formulas:
(45) ##STR00006##
where n represents an integer greater than or equal to 1. In some embodiments, n is an integer between 2 and 50, 4 and 24, and/or 8 and 24, inclusive.
(46) In some embodiments, the linker entity can have any one of the following structures:
(47) ##STR00007## ##STR00008##
(48) In some embodiments, a linker entity can comprise a monosaccharide, an oligosaccharide, or a polysaccharide, e.g., glucose, fructose, galactose, inulin, or a trisaccharide.
(49) In some embodiments, a linker entity can comprise I-Ethyl-3-(3-Dimethylaminopropyl) carbodiimide (EDAC), Benzophenone-4-Isothiocyanate, Bis-((N-Iodoacetyl)Piperazinyl)Sulfonerhodarmine, Succinimidyl 2-(2-Pyridyldithio)Propionate (SPDP), 4-Azido-2,3,5,6-Tetrafluorobenzoic acid (ATFB), (N-((2-Pyridyldthio)ethyl)-4-Azidosalicylamide), Succinimidyl trans-4-(maleimidylmethyl)cyclohexane-1-car boxy late (SMCC), and/or N-(t-BOC)-aminooxyacetic acid. Those of skill in the art will be able to identify additional candidate linker entities according to known methods.
(50) In some embodiments, a linker entity can comprise both a peptide and a non-peptide entity. For example, the linker entity can comprise both PEG8 and a peptide, e.g., a peptide having the amino acid sequence of GGK or GO.
(51) In some embodiments, a linker entity is formed, at least in part, as a result of a click reaction, e.g., an azide-alkyne Huisgen cycloaddition reaction.
(52) Additional examples of lipid entities, linker entities, and methods of lipidation can be found at US20160052982 and US20190022168, the contents of each of which are incorporated herein by reference.
(53) Any embodiment of the lipid entities described herein and any embodiment of the linker entities described herein can be combined. For example, a combination of the lipid entity and the linker entity can comprise palmitic acid--glutamic acid, palmitic acid-lysine, palmitic acid--glutamic acid-lysine, myristic acid-lysine, 17-carboxy-1-oxo-heptadecyl--glutamic acid-(AEEA).sub.2, AEEA-PEG, or 17-carboxy-1-oxo-heptadecyl--glutamic acid-(AEEA).sub.2-lysine.
(54) In some embodiments, the combination of the lipid entity and linker entity can be
(55) ##STR00009##
where the squiggly line denotes the point of coupling to the peptide.
(56) In some embodiments, when lipidation occurs at the N-terminus of the peptide, palmitic acid, myristic acid, palmitic acid--glutamic acid, palmitic acid--glutamic acid-2xOEG, 17-carboxy-1-oxo-heptadecyl--glutamic acid-(AEEA).sub.2, or cholesterol can be attached to the N-terminus of the peptide.
(57) In some embodiments, when lipidation occurs at the C-terminus of the peptide, palmitic acid-lysine, palmitic acid--glutamic acid-lysine, myristic acid-lysine, or 17-carboxy-1-oxo-heptadecyl--glutamic acid-(AEEA).sub.2-lysine can be attached to the C-terminus of the peptide.
(58) In some embodiments, the compositions described herein are soluble in water.
(59) Administration of the Compositions
(60) The therapeutically effective amount of a composition according to this disclosure can vary within wide limits and may be determined in a manner known in the art. For example, the composition can be dosed according to body weight. Such dosage will be adjusted to the individual requirements in each particular case including the specific composition being administered, the route of administration, the condition being treated, as well as the patient being treated. In another embodiment, the composition can be administered by fixed doses, e.g., dose not adjusted according to body weight. In general, in the case of oral or parenteral administration to adult humans, a daily dosage of from about 0.5 mg to about 1000 mg should be appropriate, although the upper limit may be exceeded when indicated. The dosage can be from about 5 mg to about 500 mg per day, e.g., about 5 mg to about 400 mg, about 5 mg to about 300 mg, about 5 mg to about 200 mg. The daily dosage can be administered as a single dose or in divided doses, or for parenteral administration it may be given as continuous infusion.
(61) A therapeutically effective amount of a composition is that which provides an objectively identifiable improvement as noted by the clinician or other qualified observer.
(62) The present disclosure also provides a pharmaceutical composition comprising the peptide composition described herein and a pharmaceutically acceptable carrier. The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration. The compositions described herein can be administered topically, orally, nasally, transdermally, pulmonary, inhalationally, buccally, sublingually, intraperintoneally, subcutaneously, intramuscularly, intravenously, rectally, intrapleurally, intrathecally, or parenterally. In one embodiment, the composition is administered topically. For example, the composition is administered in the form of eye drops. In one embodiment, the composition is administered orally. In some embodiments, the composition is administered intravenously. In some embodiments, the composition is administered intrathecally. One skilled in the art will recognize the advantages of certain routes of administration.
(63) The dosage regimen utilizing the compositions described herein is selected in accordance with a variety of factors including species, ethnicity, age, weight, sex and medical condition of the patient; the severity of the condition to be treated; the route of administration; the renal and hepatic function of the patient; and the particular composition employed. An ordinarily skilled physician or veterinarian can readily determine and prescribe the effective amount of the drug required to prevent, counter, or arrest the progress of the condition.
(64) The compositions described herein can be administered once a day, twice a day, thrice a day, more than thrice a day, or once every few days.
(65) Techniques for formulation and administration of the disclosed compositions of the disclosure can be found in Remington: the Science and Practice of Pharmacy, 19.sup.th edition, Mack Publishing Co., Easton, Pa. (1995). In an embodiment, the lipidated peptides described herein, and the pharmaceutically acceptable salts thereof, are used in pharmaceutical preparations in combination with a pharmaceutically acceptable carrier or diluent. Suitable pharmaceutically acceptable carriers include inert solid fillers or diluents and sterile aqueous or organic solutions. The lipidated peptides will be present in such pharmaceutical compositions in amounts sufficient to provide the desired dosage amount in the range described herein.
(66) In some embodiments, the pharmaceutical composition can be formulated for topical administration. Formulations suitable for topical administration include, but are not limited to, liquid and/or semi liquid preparations such as liniments, lotions, oil in water and/or water in oil emulsions such as creams, ointments and/or pastes, and/or solutions and/or suspensions. Topically-administrable formulations may, for example, comprise from about 1% to about 10% (wt/wt) active ingredient, although the concentration of active ingredient may be as high as the solubility limit of the active ingredient in the solvent. Formulations for topical administration may further comprise one or more of the additional ingredients.
(67) In some embodiments, the pharmaceutical composition can be formulated for oral administration. Oral formulations containing the pharmaceutical composition described herein can be formulated into any conventionally used oral forms, including: tablets, capsules, pills, troches, lozenges, pastilles, cachets, pellets, medicated chewing gum, granules, bulk powders, effervescent or non-effervescent powders or granules, solutions, emulsions, suspensions, solutions, wafers, sprinkles, elixirs, syrups, buccal forms, and oral liquids. Capsules may contain mixtures of the active compound(s) with inert fillers and/or diluents such as the pharmaceutically acceptable starches (e.g. corn, potato or tapioca starch), sugars, artificial sweetening agents, powdered celluloses, such as crystalline and microcrystalline celluloses, flours, gelatins, gums, etc. Useful tablet formulations can be made by conventional compression, wet granulation or dry granulation methods and utilize pharmaceutically acceptable diluents, binding agents, lubricants, disintegrants, surface modifying agents (including surfactants), suspending or stabilizing agents, including, but not limited to, magnesium stearate, stearic acid, talc, sodium lauryl sulfate, microcrystalline cellulose, carboxymethylcellulose calcium, polyvinylpyrrolidone, gelatin, alginic acid, acacia gum, xanthan gum, sodium citrate, complex silicates, calcium carbonate, glycine, dextrin, sucrose, sorbitol, dicalcium phosphate, calcium sulfate, lactose, kaolin, mannitol, sodium chloride, talc, dry starches and powdered sugar. In some embodiments are surface modifying agents which include nonionic and anionic surface modifying agents. For example, surface modifying agents include, but are not limited to, poloxamer 188, benzalkonium chloride, calcium stearate, cetostearyl alcohol, cetomacrogol emulsifying wax, sorbitan esters, colloidal silicon dioxide, phosphates, sodium dodecylsulfate, magnesium aluminum silicate, and triethanolamine. Oral formulations herein may utilize standard delay or time release formulations to alter the absorption of the active compound(s). The oral formulation may also consist of administering the active ingredient in water or a fruit juice, containing appropriate solubilizers or emulsifiers as needed.
(68) Methods of Treatment
(69) The compositions described herein can be used to treat a variety of conditions including pain such as neuropathic pain, ocular pain, chronic pain, pain resulting from chemotherapy or radiation, pain resulting from nerve injury or nerve degeneration, and pain resulting from an inflammatory condition, dysesthesia, or allodynia. The compositions described herein can also be used to treat an inflammatory condition such as ocular inflammation, retinal inflammation, dry eye, uveitis, allergic conjunctivitis, and inflammation resulting from nerve injury or nerve degeneration.
(70) In one aspect, the present disclosure provides a method of treating neuropathic pain with the compositions described herein. Neuropathic pain according to the present disclosure is a pain initiated or caused by a primary lesion or dysfunction in the nervous system. Neuropathic pain can be divided into peripheral (originating in the peripheral nervous system) and central (originating in the brain or spinal cord). For example, neuropathic pain syndromes include postherpetic neuralgia (caused by Herpes Zoster), root avulsions, painful traumatic mononeuropathy, painful polyneuropathy (particularly due to diabetes), central pain syndromes (potentially caused by virtually any lesion at any level of the nervous system), postsurgical pain syndromes (e.g., postmastectomy syndrome, postthoracotomy syndrome, or phantom pain), and complex regional pain syndrome (e.g., reflex sympathetic dystrophy or causalgia).
(71) Neuropathic pain has typical symptoms like dysesthesias (spontaneous or evoked burning pain, often with a superimposed lancinating component), but the pain may also be deep and aching. Other sensations like hyperesthesia, hyperalgesia, allodynia (pain due to a normoxious stimulus), and hyperpathia (particularly unpleasant, exaggerated pain response) may also occur. The compositions of the present disclosure can be administered to ameliorate at least one of these symptoms.
(72) Current therapy for neuropathic pain aims only at reducing symptoms, generally by suppressing neuronal activity. Thus, treatment options, e.g., non-steroidal anti-inflammatory drugs (NSAIDS), antidepressants, anticonvulsants, baclofen, neuromodulation modalities, or opiates, predominantly alleviate symptoms via nonspecific reduction of neuronal hyperexcitability rather than targeting the specific etiologies. The compositions of the present disclosure can be administered in combination with the current therapy for treating neuropathic pain. For example, the compositions of the present disclosure can be administered in combination with an NSAID, an antidepressant, an anticonvulsant, baclofen, a neuromodulation modality, or an opiate for treating neuropathic pain.
(73) In another aspect, the present disclosure provides a method of treating ocular pain with the compositions described herein. Ocular pain can be co-incident with a number of conditions, including but not limited to trauma due to accidental or surgical injury, uveitis, dry eye, and diabetic neuropathy. The standard of care for treatment of ocular pain is typically either topically administered NSAJDs, or orally administered analgesic agents, such as NSATDS or opioids like hydrocodone. In some embodiments, the compositions of the present disclosure can be administered in combination with an NSAID or opioid for treating ocular pain.
(74) In another aspect, the present disclosure provides a method of treating chronic pain with the compositions described herein. The compositions described herein can be used as non-opioid analgesics for treating chronic pain.
(75) In another aspect, the present disclosure provides a method of treating pain resulting from chemotherapy or radiation. Commonly used chemotherapy drugs, such as vincristine sulfate, paclitaxel or cisplatin, may cause what is known as chemotherapy-induced peripheral neuropathy or paresthesia.
(76) In another aspect, the present disclosure provides a method of treating pain resulting from nerve injury or nerve degeneration with the compositions described herein.
(77) In another aspect, the present disclosure provides a method of treating pain resulting from an inflammatory condition, dysesthesia, or allodynia with the compositions described herein.
(78) The compositions described herein can be administered in combination with an analgesic agent to treat pain. Examples of analgesic agents include, but are not limited to, paracetamol, an NSAID, a COX-2 inhibitor, an opioid, and medical cannabis.
(79) In another aspect, the present disclosure provides a method of treating ocular inflammation or retinal inflammation with the compositions described herein. Ocular inflammation can be caused by a microbial infection of the eye. Such infection may be fungal, viral or bacterial. Current therapies for treating ocular inflammation include locally administered anti-cytokine or anti-inflammatory agents. In some embodiments, the compositions of the present disclosure can be administered in combination with an anti-cytokine or anti-inflammatory agent for treating ocular inflammation.
(80) Anti-cytokine or anti-inflammatory agents include, but are not limited to, NF Kappa B inhibitors, for example corticosteroids, glucocorticoids such as flucinolonone; NSAIDs such as sulindac and tepoxalin; antioxidants such as dithiocarbamate; and other compounds such as sulfasalazine [2-hydroxy-5-[-4-[C2-pyridinylamino)sulfonyl]azo]benzoic acid], clonidine, and autologous blood-derived products such as Orthokine.
(81) The compositions described herein can also be used to treat dry eye. Dry eye is primarily caused by the break-down of the pre-ocular tear film which results in dehydration of the exposed outer surface. Dry eye can be diagnosed through a comprehensive eye examination. Testing, with emphasis on the evaluation of the quantity and quality of tears produced by the eyes, may include: (a) patient history to determine the patient's symptoms and to note any general health problems, medications or environmental factors that may be contributing to the dry eye problem; (b) external examination of the eye, including lid structure and blink dynamics; (c) evaluation of the eyelids and cornea using bright light and magnification; and (d) measurement of the quantity and quality of tears for any abnormalities. Special dyes may be put in the eyes to better observe tear flow and to highlight any changes to the outer surface of the eye caused by insufficient tears.
(82) Without wishing to be bound by theory, there is a rationale that ocular inflammation as a result of pro-inflammatory cytokines and growth factors plays a major role in the underlying causes of dry eye. As such, locally administered anti-cytokine or anti-inflammatory agents are often used in the treatment of dry eye. In some embodiments, the compositions of the present disclosure can be administered in combination with an anti-cytokine or anti-inflammatory agent for treating dry eye.
(83) In some embodiments, a therapeutically effective amount for treating ocular inflammation is an amount that reduces the extent of inflammation in the subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% compared to a placebo.
(84) In some embodiments, a therapeutically effective amount for treating dry eye is an amount that increases the production of tears in the subject by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, or at least 150% compared to a placebo.
(85) The compositions described herein can be used to treat uveitis such as noninfectious uveitis. Uveitis means inflammation in one or both of the patient's eyes. Uveitis is a wide range of inflammatory diseases of the eye, specifically the uvea. There are 3 basic layers of the eye the sclera and cornea on the outside, the retina on the inside, and the uvea in between. The uvea is comprised mostly of blood vessels and connective tissue, including pigmented cells. The different parts of the uvea are the iris in the front, the ciliary body in the middle, and the choroid located behind these, which lies around most of the eye. Sometimes uveitis can affect parts of the eye other than uvea, such as retina, vitreous, or optic nerve. Types of uveitis can be based on what part of the eye is affected. For example, anterior uveitis is the inflammation in the front of the eye, called iritis or iridocyclitis; intermediate uveitis is the inflammation in the middle part of the eye, or pars planitis or vitritis; posterior uveitis is the inflammation of the back of the eye, such as choroiditis, retinal vasculitis, retinitis, neuroretinitis, retinochoroiditis, or chorioretinitis.
(86) Symptoms of uveitis commonly include redness, blurry vision, pain, light sensitivity, and floaters and flashes.
(87) Noninfectious uveitis can result from an eye injury or a disease somewhere else in the patient's body. Typically, steroids or immunosuppressants are used to treat noninfectious uveitis. In some embodiments, the compositions described herein can be used in combination with a steroid or an immunosuppressant to treat noninfectious uveitis.
(88) The compositions described herein can be used to treat allergic conjunctivitis. Allergic conjunctivitis is an eye inflammation caused by an allergic reaction to substances like pollen or mold spores. Typically, antihistamines, decongestants, or steroids are used to treat allergic conjunctivitis. In some embodiments, the compositions described herein can be used in combination with an antihistamine, a decongestant, or a steroid to treat allergic conjunctivitis.
(89) The compositions described herein can be used to treat inflammation resulting from nerve injury or nerve degeneration.
(90) The compositions described herein can be used to prevent any one of the diseases, disorders, or conditions described herein. For example, the compositions described herein can be used to prevent neuropathic pain, ocular pain, ocular inflammation, dry eye, uveitis, or allergic conjunctivitis.
(91) With respect to combination therapies involving a first therapeutic agent (e.g., a composition of the present disclosure) and a second therapeutic agent (e.g., an anti-inflammatory agent, an opioid, an NSAITD, or an antidepressant), the first therapeutic agent can be administered concurrently with the second therapeutic agent; the first therapeutic agent can be administered before the second therapeutic agent; or the first therapeutic agent can be administered after the second therapeutic agent. The administrations of the first and second therapeutic agents can be separated by minutes or hours, e.g., one hour, two hours, three hours, four hours, five hours, or six hours.
Definitions
(92) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains. Although other methods and materials similar, or equivalent, to those described herein can be used in the practice of the present invention, the preferred materials and methods are described herein. It is to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting.
(93) As used herein, the term at least one, in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements. This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase at least one refers, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, at least one of A and B (or, equivalently, at least one of A or B, or, equivalently at least one of A and/or B) may refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
(94) The term and/or, as used herein, should be understood to mean either or both of the elements so conjoined, i.e., elements that are conjunctively present in some cases and disjunctively present in other cases. Multiple elements listed with and/or should be construed in the same fashion, i.e., one or more of the elements so conjoined. Other elements may optionally be present other than the elements specifically identified by the and/or clause, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, a reference to A and/or B, when used in conjunction with open-ended language such as comprising may refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
(95) The terms peptide, polypeptide, and protein are used interchangeably herein and typically refer to a molecule comprising a chain of two or more amino acids (e.g., most typically L-amino acids, but also including, e.g., D-amino acids, modified amino acids, amino acid analogs, and amino acid mimetic). Peptides may be naturally occurring, synthetically produced, or recombinantly expressed. Peptides may also comprise additional groups modifying the amino acid chain, for example, functional groups added via post-translational modification. Examples of post-translation modifications include, but are not limited to, acetylation, alkylation (including methylation), biotinylation, glutamylation, glycylation, glycosylation, isoprenylation, lipoylation, phosphopantetheinylation, phosphorylation, selenation, and C-terminal amidation. The term peptide also includes peptides comprising modifications of the amino terminus and/or the carboxyl terminus. Modifications of the terminal amino group include, but are not limited to, des-amino, N-lower alkyl, N-di-lower alkyl, and N-acyl modifications. Modifications of the terminal carboxy group include, but are not limited to, amide, lower alkyl amide, dialkyl amide, and lower alkyl ester modifications (e.g., wherein lower alkyl is C.sub.1-C.sub.4 alkyl). The term peptide also includes modifications, such as but not limited to those described above, of amino acids falling between the amino and carboxy termini. The term peptide can also include peptides modified to include one or more detectable labels.
(96) The phrase amino acid residue as used herein refers to an amino acid that is incorporated into a peptide by an amide bond or an amide bond mimetic. The amino acid can either be natural or synthetic.
(97) The terminal amino acid at one end of the peptide chain typically has a free amino group (i.e., the amino terminus). The terminal amino acid at the other end of the chain typically has a free carboxyl group (i.e., the carboxy terminus). Typically, the amino acids making up a peptide are numbered in order, starting at the amino terminus and increasing in the direction of the carboxy terminus of the peptide.
(98) As used herein, the term analog refers to a variant or mutant polypeptide having one or more amino acid modifications compared to the wild type.
(99) As used herein, the terms treat, treating, treatment, and the like refer to reducing or ameliorating a disorder and/or a symptom associated therewith. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder or symptom associated therewith be completely eliminated. The terms treat, treating, or treatment, do not include prevention.
(100) As used herein, the term prevent refers to reducing or eliminating the onset of the symptoms or complications of a disease, condition, or disorder.
(101) As used herein, a subject can be any mammal, e.g., a human, a non-human primate, mouse, rat, dog, cat, cow, horse, pig, sheep, goat, camel. In some embodiments, the subject is a human.
(102) The term pharmaceutical composition refers to a mixture of the peptide composition disclosed herein with other chemical components, such as diluents or carriers. The pharmaceutical composition facilitates administration of the peptide composition to an organism such as a human. Pharmaceutical compositions can also be obtained by reacting compounds with inorganic or organic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid and the like.
(103) Pharmaceutically acceptable carrier means a carrier that is useful in preparing a pharmaceutical composition that is generally safe, non-toxic and neither biologically nor otherwise undesirable, and includes excipient that is acceptable for veterinary use as well as human pharmaceutical use. Useful pharmaceutical carriers for the preparation of the compositions hereof, can be solids, liquids or gases; thus, the compositions can take the form of tablets, pills, capsules, suppositories, powders, enterically coated or other protected formulations (e.g. binding on ion-exchange resins or packaging in lipid-protein vesicles), sustained release formulations, solutions, suspensions, elixirs, aerosols, and the like. The carrier can be selected from the various oils including those of petroleum, animal, vegetable or synthetic origin, e.g., peanut oil, soybean oil, mineral oil, sesame oil, and the like. Water, saline, aqueous dextrose, and glycols are preferred liquid carriers, particularly (when isotonic with the blood) for injectable solutions. For example, formulations for intravenous administration comprise sterile aqueous solutions of the active ingredient(s) which are prepared by dissolving solid active ingredient(s) in water to produce an aqueous solution, and rendering the solution sterile. Suitable pharmaceutical excipients include starch, cellulose, talc, glucose, lactose, talc, gelatin, malt, rice, flour, chalk, silica, magnesium stearate, sodium stearate, glycerol monostearate, sodium chloride, dried skim milk, glycerol, propylene glycol, water, ethanol, and the like. The compositions may be subjected to conventional pharmaceutical additives such as preservatives, stabilizing agents, wetting or emulsifying agents, salts for adjusting osmotic pressure, buffers and the like. Suitable pharmaceutical carriers and their formulation are described in Remington's Pharmaceutical Sciences by E. W. Martin. Such compositions will, in any event, contain an effective amount of the active compound together with a suitable carrier so as to prepare the proper dosage form for proper administration to the recipient.
(104) The term therapeutically effective amount, as used herein, refers to an amount of a pharmaceutical agent to treat, ameliorate, or prevent an identified disease or condition, or to exhibit a detectable therapeutic or inhibitory effect. The effect can be detected by any assay method known in the art. The precise effective amount for a subject will depend upon the subject's body weight, size, and health; the nature and extent of the condition; and the therapeutic or combination of therapeutics selected for administration. Therapeutically effective amounts for a given situation can be determined by routine experimentation that is within the skill and judgment of the clinician.
(105) As used herein, the singular forms a, an and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a solvent includes a combination of two or more such solvents, reference to a peptide includes one or more peptides, or mixtures of peptides, reference to a drug includes one or more drugs, reference to a device includes one or more devices, and the like. Unless specifically stated or obvious from context, as used herein, the term or is understood to be inclusive and covers both or and and.
(106) Throughout the specification the word comprising, or variations such as comprises or comprising, will be understood to imply the inclusion of a stated element, integer or step, or group of elements, integers or steps, but not the exclusion of any other element, integer or step, or group of elements, integers or steps.
(107) Unless specifically stated or obvious from context, as used herein, the term about is understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from the context, all numerical values provided herein are modified by the term about.
EXAMPLES
Example 1
(108) Synthesis of Lipidated Peptides
(109) All peptides were prepared using an Fmoc-tBu strategy. This utilizes an Fmoc protecting group on the N-terminus with side chain protecting groups being either tBu or Trt based depending on the specific functionality present. Activation utilized diisopropoylcarbodiimide in the presence of hydroxybenzotriazole (HOBT) to minimize racemization in DMF. Fmoc removal is facilitated with 20% piperidine in DMF at a ratio of 10 ml/g of resin. The peptide resin is washed with DMF and IpOH (10 ml of solvent/g of resin) following a deblocking step and following coupling steps. Upon completion of the linear peptide sequence, the peptide is cleaved from the solid support and simultaneously deprotected on the side chains using an acidolytic cleavage with TFA and cationic scavengers (water, triisoproplylsilane, 3,6-dioxa-1,8-octanedithiol (DODT), thioanisole, phenol) added according to presence of specific side chain protecting groups. Cleavage time is typically between 60 mnin and 120 min. The crude peptide is isolated by filtration to remove the spent resin beads and subsequently precipitated in ice cold methyl t-butyl ether. The precipitated peptide is collected using a sintered glass funnel and dried in drying oven until a constant weight is obtained.
(110) The crude peptide is subsequently redissolved in an appropriate buffer system (eg. 20% AcOH in water) and purified by preparative reverse phase HPLC. Following purification, fractions which meet the minimum pool criterion of >95% are pooled and subsequently lyophilized. The final freeze-dried peptides are analyzed by analytical RP-HPLC, ESI-MS and other analytical methods such as Karl Fischer for water analysis, elemental analysis for Nitrogen for peptide content, and amino acid analysis.
(111) Cell Culture Assays
(112) PathHunter -Arrestin GPCR cell lines co-expressing the ProLink (PK) tagged GPCR (human Chemokine-like receptor 1, CMKLR1) and the Enzyme Acceptor (EA) tagged -Arrestin were used. Activation of the GPCR-PK induces -Arrestin-EA recruitment, forcing complementation of the two -galactosidase enzyme fragments (EA and PK). The resulting functional enzyme hydrolyzes substrate to generate a chemiluminescent signal. The PathHunter -Arrestin assay monitors the activation of a GPCR in a homogenous, non-imaging assay format using a technology developed by DiscoverX called Enzyme Fragment Complementation (EFC) with -galactosidase (-Gal) as the functional reporter. The enzyme is split into two inactive complementary portions (EA for Enzyme Acceptor and PK for ProLink) expressed as fusion proteins in the cell. EA is fused to -Arrestin and PK is fused to the GPCR of interest. When the GPCR is activated and -Arrestin is recruited to the receptor, ED and EA complementation occurs, restoring -Gal activity which is measured using chemiluminescent PathHunter Detection Reagents.
(113) Assay Design:
(114) (a) Cell Handling: 1. PathHunter cell lines co-expressing the ProLink (PK) tagged GPCR (human Chemokine-like receptor 1, CMKLR1) and the Enzyme Acceptor (EA) tagged -Arrestin were expanded from freezer stocks according to standard procedures. 2. Cells were seeded in a total volume of 20 L, into white walled, 384-well microplates and incubated at 37 C. for the appropriate time prior to testing.
(115) (b) Agonist Format: 1. For agonist determination, cells were incubated with peptide to induce response. 2. Intermediate dilution of peptide stocks was performed to generate 5 sample in assay buffer. 3.5 L of 5 peptide was added to cells and incubated at 37 C. or room temperature for 90 to 180 minutes. Vehicle concentration was 1%.
(116) (c) Signal Detection: 1. Assay signal was generated through a single addition of 12.5 or 15 L (50% v/v) of PathHunter Detection reagent cocktail, followed by a one hour incubation at room temperature. 2. Microplates were read following signal generation with a PerkinElmer Envision instrument for chemiluminescent signal detection.
(117) (d) Data Analysis: 1. Compound activity was analyzed using Chemical and Biological Information System (CBIS) data analysis suite (ChemInnovation, CA). 2. For agonist mod assays, percentage activity was calculated using the following formula: % Activity=100%(mean RFU of test samplemean RFU of vehicle control)/(mean MAX control ligandmean RFU of vehicle control). RFU means relative fluorescence units.
(118) TABLE-US-00003 TABLE1 EC50resultsforvariouspeptideswithN-terminalPEG8-Palmiticacid. Peptide EC50 Identifier Chemerinanalogs nM OK-101 Gly-Gly-dTyr-Phe-Leu-Pro-dSer-Gln-Phe-dAla-Tic-Ser(SEQIDNO:10) 2.6 OK-102 dAla-Gly-dTyr-Phe-Nle-Pro-dSer-Gln-Phe-dAla-Tic-dAla(SEQIDNO:7) 2.3 OK-103 Ala-Ala-Tyr-Phe-Nle-Pro-Ser-Gln-Phe-Ala-Tic-dAla(SEQIDNO:11) 43 OK-104 Ala-Ala-Phe-Tyr-Nle-Pro-Ser-Gln-Tyr-Ala-Tic-dAla(SEQIDNO:2) 2.6 OK-105 Ala-Gly-Tyr-Phe-Nle-Pro-Thr-Asn-Phe-Ala-Tic-dAla(SEQIDNO:12) 203 OK-106 Ala-Ala-Phe-Tyr-Nle-Pro-Thr-Gln-Phe-Ala-Tic-dAla(SEQIDNO:13) 32.5 Ok-107 Ala-Ala-Tyr-Phe-Nle-Pro-Ser-Gln-Tyr-dAla-Phe-dAla(SEQIDNO:14) 1708 OK-108 Ala-Gly-dTyr-Tyr-Nle-Pro-dSer-Gln-Phe-dAla-Phe-dAla(SEQIDNO:15) 23.9 OK-109 Ala-Gly-dTyr-Phe-Nle-Pro-dSer-Aad-Phe-Ala-Tic-dAla(SEQIDNO:3) <.5 OK-110 dAla-Gly-dTyr-Tyr-Nle-Pro-dSer-Aad-Phe-dAla-Tic-dAla(SEQIDNO:6) 11 OK-111 dAla-Gly-dTyr-Phe-Nle-Pro-dSer-Aad-Phe-dAla-Tic-dAla(SEQIDNO:17) 15 OK-112 dAla-Gly-dTyr-Phe-Nle-Pro-dSer-Gln-fluorPhe-dAla-Tic-dAla(SEQIDNO: 1.4 4) OK-113 NorV-Gly-dTyr-Phe-Nle-Pro-dSer-Gln-Phe-dAla-Tic-dAla(SEQIDNO:5) <.5 OK-114 Ala-Gly-dTyr-Phe-Nle-Pro-dSer-Gln-Phe-Ala-Tic-dSer(SEQIDNO:6) <.5 OK-115 Ala-Gly-Phe-Phe-Nle-Pro-Ser-Gln-Phe-Ala-Tic-dAla(SEQIDNO:18) 12.4 OK-116 Gly-Gly-Phe-Phe-Nle-Pro-Ser-Gln-Phe-Ala-Tic-dSer(SEQIDNO:19) 63.9
Example 2
(119) In
(120) In
(121) In