Compositions and methods for producing human milk oligosaccharides
12559732 ยท 2026-02-24
Assignee
Inventors
- Jose M. Bruno-Barcena (Raleigh, NC, US)
- Suzanne DAGHER (Raleigh, NC, US)
- Maria Andrea Azcarate-Peril (Raleigh, NC, US)
Cpc classification
C12P19/18
CHEMISTRY; METALLURGY
C12P19/00
CHEMISTRY; METALLURGY
C12N9/2471
CHEMISTRY; METALLURGY
A23L33/125
HUMAN NECESSITIES
C12N15/79
CHEMISTRY; METALLURGY
A23G9/34
HUMAN NECESSITIES
C12P19/26
CHEMISTRY; METALLURGY
C12Y302/01023
CHEMISTRY; METALLURGY
C12P19/14
CHEMISTRY; METALLURGY
International classification
A23L33/125
HUMAN NECESSITIES
C12N15/79
CHEMISTRY; METALLURGY
C12P19/18
CHEMISTRY; METALLURGY
Abstract
The present disclosure provides compositions and methods related to the production of human milk oligosaccharides (HMOs). In particular, the present disclosure provides compositions and methods for converting lactose and N-acetylglucosamine (GlcNAc) into N-acetyllactosamine (LacNAc)-enriched galactooligosaccharide (GOS) compositions using novel -hexosyl-transferase (BHT) enzymes.
Claims
1. A functional, recombinant -hexosyl-transferase (rBHT) polypeptide comprising at least 90% sequence identity with SEQ ID NO: 1 and an N-terminal truncation of 56 amino acids to 81 amino acids in length, with reference to SEQ ID NO: 1.
2. The polypeptide of claim 1, wherein the polypeptide comprises at least 95% sequence identity with SEQ ID NO: 1.
3. The polypeptide of claim 1, wherein the polypeptide further comprises at least one additional amino acid substitution.
4. The polypeptide of claim 1, wherein the polypeptide further comprises a signal sequence.
5. The polypeptide of claim 4, wherein the signal sequence comprises an amino acid sequence from a protein from any one of Komagataella (Pichia) pastoris, Saccharomyces cerevisiae, Yarrowia lipolytica, Hansenula (Ogataea) polymorpha, or Kluyveromyces lactis.
6. The polypeptide of claim 4, wherein the signal sequence comprises a polypeptide with at least 90% sequence identity to at least one of -mating factor signal sequence from Saccharomyces cerevisiae (MF) (SEQ ID NO: 29), Invertase (IV) signal sequence (SEQ ID NO: 30), Glucoamylase (GA) signal sequence (SEQ ID NO: 31), or Inulinase (IN) signal sequence (SEQ ID NO: 32).
7. The polypeptide of claim 4, wherein the polypeptide comprises the amino acid sequence of SEQ ID NO: 50, 52, 54, 56, 58, 60, 68, or 70.
8. The polypeptide of claim 1, wherein the polypeptide comprises at least one asparagine residue at position 289, 297, 431, or 569 with respect to SEQ ID NO: 1.
9. The polypeptide of claim 1, wherein the polypeptide catalyzes the hydrolysis of lactose -(1-4) glycosidic linkages.
10. A nucleic acid molecule encoding the polypeptide of claim 1.
11. A vector comprising the nucleic acid molecule of claim 10.
12. A method of generating a galactooligosaccharide (GOD) composition from lactose in a host cell using the polypeptide of claim 1.
13. The method of claim 12, wherein the GOS composition comprises LacNAc-enriched GOS or GOS lacking GlcNAc.
14. The method of claim 13, wherein the host cell is one or more of a yeast cell, a fungal cell, a mammalian cell, an insect cell, a plant cell, or an algal cell.
15. The method of claim 14, wherein the host cell comprises one or more cells from Komagataella (Pichia) pastoris, Saccharomyces cerevisiae, Yarrowia lipolytica, Hansenula (Ogataea) polymorpha, or Kluyveromyces lactis, Aspergillus spp., and Trichoderma reesei.
16. The method of claim 13, wherein the method produces a LacNAc-enriched GOS yield of at least 10% of initial lactose concentration, and a total GOS concentration of at least 50% of initial lactose concentration.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
DETAILED DESCRIPTION
(8) The present disclosure provides compositions and methods related to the production of human milk oligosaccharides (HMOs). In particular, the present disclosure provides compositions and methods for converting lactose and N-acetylglucosamine (GlcNAc) into N-acetyllactosamine (LacNAc)-enriched galactooligosaccharide (GOS) compositions using novel -hexosyl-transferase (BHT) enzymes.
(9) Hamamotoa (Sporobolomyces) singularis codes for an industrially important inducible membrane bound -hexosyltransferase (BHT), which is partially secreted soluble when heterologously expressed by Komagataella (Pichia) pastoris. BHT secretion is determined by a 22 amino acid signal sequence that is part of a novel amino terminal region (1-110 amino acids) and predicted to be glycosylated on four arginine positions of the catalytic glycosyl hydrolase (GH1) within the carboxyl terminal domain. To evaluate the role of each N-glycosylation site in the generation of biologically active soluble enzyme, the activity of N-glycosylated recombinant enzyme variants (e.g., N289Q, N297Q, N431Q and N569Q) produced by Komagataella (Pichia)pastoris were comparatively analyzed. Functional analysis of four deglycosylated soluble variants revealed a reduced total recombinant (rBHT) measurable activity (58-97% decrease) indicating that glycosylation at all four sites is critical for the generation of active enzyme. Additionally, in silico structural predictions show the presence of disordered segments within the novel amino terminal region (1-110 amino acids) preceding the catalytic C-terminal GH1 domain. Deletion analysis was performed targeting segments surrounding the putative disordered regions to generate eight truncated N-terminal domain enzyme variants. The impact of the enzyme truncations on the ratio of membrane bound to secreted soluble enzyme variants was assessed. Fusions of the truncated active soluble variants to the MF signal sequence and modified MF versions generated by Komagataella (Pichia) pastoris were compared for secretion titers, stability and enzyme kinetics. Surprisingly, N-terminal deletions up to 56 amino acids produced fully functional secreted soluble enzyme variants while 65% of the total secreted active enzyme was membrane bound under the experimental conditions described herein.
(10) Hamamotoa (Sporobolomyces) singularis (H Singularis) expresses, under inducible conditions, an extracellular membrane-bound glycosylated -hexosyltransferase (BHT). BHT catalyzes the hydrolysis of cellobiose -(1-4) glycosidic linkages and possesses appealing enzymatic transgalactosylation capabilities in the presence of lactose allowing for the synthesis of galacto-oligosaccharides (GOS), which are considered prebiotics and widely used as functional food additives. For this reason, the interest in the important role of this novel enzyme catalyzing transgalactosylation reactions has increased.
(11) More recently, heterologous expression of biologically inactive rBHT by Escherichia coli (E. coli) suggested that post-translational modifications such as glycosylation were a requirement for obtaining an active enzyme. However, it remains unclear as to whether all the potential glycosylation sites within the carboxyl terminal domain and/or motifs on the N-terminal region are involved in the generation of biologically active rBHT. The novel N-terminal region has no known sequence homologs and has yet to be characterized. The carbohydrate moieties of glycoproteins are generally believed to facilitate protein folding, oligomerization, protection from proteolysis, secretion, intracellular trafficking, cell surface expression, and enzymatic activity.
(12) Komagataella (Pichia)pastoris (K. pastoris) is commonly used as eukaryotic hosts for production of recombinant proteins due to its post-translational modifications and secretion capabilities. As would be recognized by one of ordinary skill in the art based on the present disclosure, Komagataella (Pichia) pastoris (K. pastoris) is also referred to as Kamagataaella phaffi. As described further herein, the various compositions and methods of the present disclosure are applicable to any host cell, including but not limited to, a yeast cell, a fungal cell, a mammalian cell, an insect cell, a plant cell, or an algal cell. In some embodiments, the host cell includes any cell from the genus Komagataella.
(13) In K. pastoris, N-glycans form high-mannose-type heterogeneous oligosaccharides beginning with the addition of the core unit Glc.sub.3Man.sub.9GlcNAc.sub.2 (Glc=glucose; GlcNAc=N-acetylglucosamine; Man=mannose) at asparagine in the recognition sequence Asn-X-Ser/Thr. Heterologous expression of rBHT by K. pastoris resulted in a glycosylated extracellular cell wall or membrane bound enzyme. Surprisingly, the native protein leader directed secretion of a small fraction of the enzyme into the culture broth as active soluble enzyme. Previous work demonstrated that K. pastoris was able to secrete soluble biologically active rBHT into the culture broth, which opened the possibility of a straightforward downstream recovery processes protocol. Thus, experiments were conducted to recover, purify, and evaluate the activity and stability of the soluble active enzyme and compare it with the membrane-bound rBHT.
(14) The predicted protein includes 594 amino acids, contains an amino terminal region of 1-110 amino acids without known sequence homologs followed by a carboxyl terminal glycosyl hydrolase family 1 (GH1) catalytic domain. The N-terminus also possesses a secretory signal peptide consisting of 22 amino acids that limits its secretion when fused, upstream of the entire open reading frame, to the -mating factor (MF) signal sequence from Saccharomyces cerevisiae. Experiments demonstrated that this restriction could be partially released by replacing the native BHT signal sequence (1-22 aa) by the MF signal sequence. The result was an unexpected 53-fold activity increase of the biologically active soluble enzyme in the culture broth and also an increase of the K. pastoris membrane associated form of the enzyme. These results demonstrated that the BHT signal sequence influences membrane bound localization versus secretion of soluble enzyme into the medium. While previous results did not address the role of N-terminal regions outside of the first 22 amino acid signal peptide, it did establish a system in which this question could be evaluated using deletion mutagenesis within the novel 1-110 N-terminal domain, as described further herein.
(15) Secretion of soluble proteins by K. pastoris is highly protein dependent and remains a general bottleneck to production processes, as is well-recognized in the art. One of the reasons for this limitation is believed to come from improper folding, which can be remedied by overexpressing folding helper proteins. Alternative methods can include reengineered strains and mutagenesis as ways to improve secretion. Furthermore, a number of studies have shown increases in secretion of soluble recombinant proteins by altering glycosylation and cellular trafficking associated genes.
(16) In this present disclosure, experiments were conducted (using site directed mutagenesis and progressive deletion analysis) to address whether secretion of soluble active rBHT is controlled by posttranslational N-glycosylation modifications buried within the C-terminal GH1 domain, and/or restricted by features contained within the novel 110 N-terminal region (amino acids 23 to 110). The overall analysis of rBHT expression of each altered or truncated enzyme variant was complemented by the analysis of enzyme activity, measured as the ratio of soluble versus membrane-associated enzyme. Finally, results of the present disclosure further demonstrate the uniqueness of the N-terminus by presenting a comparative sequence and structural analysis with homologous GH1 proteins, whose coordinates are available in the protein data bank (PDB) using the recently derived crystal structure of the BHT enzyme.
(17) On the basis of BHT's industrial applications and importance, improving secretion efficiency of soluble active enzyme is highly desirable. Recently, structural information has become available for 90% of the BHT enzyme, and evidence was compared with other GH1 family members. The data obtained confirmed in silico structural predictions of the enzyme showing two distinct structural domains: a novel 110 N-terminal domain containing a signal sequence and probable disordered regions, and a conserved carboxyl GH1 domain. These data also predicted various glycosylation and phosphorylation sites. Thus, three general categories of protein structural modifications were performed: 1) site directed mutagenesis of four glycosylation sites; 2) truncations in the 110 N-terminal regions; and 3) replacement and modification of the secretion signals. The first group of modifications targeted the glycosylation sites by site directed mutagenesis and confirmed their importance for enzyme activity. The second group of modifications demonstrated that removal of up to 56 N-terminal amino acids does not impact enzyme activity, and that these residues do not play a critical role in secreting soluble active rBHT. The third group of modifications showed that altering MF signal sequence allows for an increased ratio (0.67) of secreted soluble protein to membrane-associated protein (Table 1).
(18) Examining the correlation between rBHT N-glycosylation and the corresponding enzymatic characteristics is an important step towards evaluating enzymatic stability, activity and even production. Post-translational modifications such as N-glycosylation are involved in protein folding in the ER and play an important role in heterologous protein secretion. However, not all predicted N-glycosylated sequons in polypeptides are glycosylated in vivo. A number of algorithms are available for predicting N- and O-glycosylation sites, although the effect of enhancing or removing a putative site on expression and secretion can only be confirmed in vivo. In silico analysis suggested that the BHT GH1 domain contains four N-glycosylation sites recently confirmed by the three-dimensional structure (HsBglA, PDB ID:M6E4). Importantly, single site replacement of asparagine by glutamine indicated a strong link to expression of the active enzyme. Though, surprisingly, the ratio of secreted soluble enzyme to cell membrane associated activity increased from 0.40 to 0.66 for BHT.sub.(23-594)(N569Q)-HIS. In particular, the substitutions led to dramatic decreases in secreted soluble protein from 58% to 97%, and in cell membrane associated active protein from 75% to 95% compared to the parent strain, rBHT.sub.(23-594)-HIS. This wide range in activities represented as a percentage of fully active enzyme shows that even the absence of one N-glycosylation site is sufficient to reduce titers of active enzyme, and a fully functional enzyme is only obtained when all four sites tested are glycosylated.
(19) Experiments also examined whether secretion of soluble active protein is influenced by the presence of disordered N-terminal segments, and if their removal has a functional significance on catalytic activity of the truncated secreted soluble rBHT variants. Little is known about the novel 110 N-terminal region of BHT, a fragment that so far lacks homology with other known proteins. Based on the predicted disordered segments of the novel 110 N-terminal domain, deletion chimeras fused the MF signal sequences were generated. Heterologous expression of N-terminal truncations comprising amino acids 1-56 generated comparable enzymatic kinetic parameter values for each secreted soluble, stable, and bioactive enzyme, whereas further N-terminal deletions of disordered segments abrogated the secretory process (
(20) Intrinsically disordered proteins (IDPs) exist in interchanging conformations rather than adapting well-defined structures. Disordered regions can be discriminated from ordered ones based on the amino acid sequence and in most cases, disordered proteins are less evolutionarily conserved but rather their disordered structure has been maintained. IDPs participate in a number of cellular functions, including transcription, translation, regulation, and signal transduction and are enriched in phosphorylation sites. Often IDPs are involved in binding DNA or RNA, and to other proteins, and can assist in the assembly of multi-protein complexes. Moreover, IDPs are less frequent in enzymes, and while different servers yield significant deviations as output within the GH1 domain, when using the more stringent server DISOPRED3 there is a lack of disordered regions in the GH1 domain.
(21) Additionally, as described further herein, structural modifications were performed by replacing the secretion signal given that, previously, truncated active polypeptides of BHT at residues 17 or 22 were detected in protein cell extracts from cell membranes of H. singularis. This finding suggested that this fragment was cleaved to form the mature BHT. Using K. pastoris, results demonstrated that BHT amino acids 1-22 act as a functional native signal sequence. It was demonstrated that its replacement with the MF signal sequence allowed for secretion of soluble active rBHT variants, though approximately an additional 71% of the secreted enzyme remained membrane associated (Table 1), in agreement with previous results.
(22) It should be noted that the persistent partial localization of rBHT with the cell membrane following removal of the N-terminal disordered regions suggests that either impartial cleavage of the MF or perhaps the 57-110 amino acids within the novel N-terminal region or the BHT GH1 domain may contain points of association with cell membrane. Most secreted proteins in eukaryotes contain N-terminal signal sequences that direct the protein to cellular or extracellular locations. The ability of peptide sequences with minimal sequence homology to function as signal peptides has allowed substitution of the original signal sequence with signal peptide sequences found in yeast. A comparison of four signal sequences revealed that the secreted BHT peptide continues to be associated with the cell membrane.
(23) Cleavage of the signal peptide has been found to be important for the assembly and secretion of functional prolipoproteins across the E. coli membrane. In one study, unprocessed consensus MF--interferon accumulated in the periplasmic space and cell wall, and secretion into the culture medium and cellular accumulation could be alleviated with Glu-Ala dipeptide between MF and -interferon. Furthermore, deletion of amino acids 57-70 in the pro-region of MF has been shown to increase secretion of horseradish peroxidase and lipase by at least 50%. Thus, based on these results, cleavage of the signal peptide by signal peptidases may be required for the final assembly and secretion of soluble rBHT. The same modifications to MF found in the variants GS115::MF.sub.(57-70)-rBht.sub.(23-594)-HIS and GS115::MF.sub.(57-70)-rBht.sub.(57-594)-HIS increased secretion compared to GS115::MF-rBht.sub.(23-594)-HIS by 58%, and as a result, increased the ratio of secreted soluble to membrane associated by 40% (Table 1).
(24) The crystal structure of BHT is similar overall to GH1 family proteins; however, the N-terminus (residues 1-110) has no known homolog and residues 23-54 were not defined in the structure. It was previously proposed that this region is unstructured and structurally dynamic. As described further herein, deletion analysis was performed on the N-terminal unstructured domain based on in silico results. In light of these results, features within the first N-terminal 56 residues likely play a limited role in cell associated activity but are not required for enzyme folding, secretion or activity.
(25) For rational enzyme redesign it is imperative to determine the possible regulatory mechanisms for the BHT N-terminal unstructured region. According to the results of the present disclosure, homologous structures include the conserved C-terminal catalytic domain but lack the highly intrinsically disordered N-terminal domain found in the BHT in silico analysis (
(26) All the above data further document the role of N-terminal disordered regions beyond residue 56 for sustaining active rBHT and attributes the basis for partial selective sequestration of cell wall bound rBHT to the inefficient processing of the signal secretion sequence. Overall, results of the present disclosure using K. pastoris improved secreted titers of soluble rBHT by removing the endogenous 56 N-terminal amino acids while fused to a truncated MF version.
(27) Section headings as used in this section and the entire disclosure herein are merely for organizational purposes and are not intended to be limiting.
1. DEFINITIONS
(28) Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. In case of conflict, the present document, including definitions, will control. Preferred methods and materials are described below, although methods and materials similar or equivalent to those described herein can be used in practice or testing of the present disclosure. The phrase in one embodiment as used herein does not necessarily refer to the same embodiment, though it may. Furthermore, the phrase in another embodiment as used herein does not necessarily refer to a different embodiment, although it may. Thus, as described below, various embodiments of the present disclosure may be readily combined, without departing from the scope or spirit of the embodiments provided herein. All publications, patent applications, patents and other references mentioned herein are incorporated by reference in their entirety. The materials, methods, and examples disclosed herein are illustrative only and not intended to be limiting.
(29) The terms comprise(s), include(s), having, has, can, contain(s), and variants thereof, as used herein, are intended to be open-ended transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures. The singular forms a, and and the include plural references unless the context clearly dictates otherwise. The present disclosure also contemplates other embodiments comprising, consisting of and consisting essentially of, the embodiments or elements presented herein, whether explicitly set forth or not.
(30) For the recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
(31) Correlated to as used herein refers to compared to.
(32) As used herein, the term nucleic acid molecule refers to any nucleic acid containing molecule, including but not limited to, DNA or RNA. The term encompasses sequences that include any of the known base analogs of DNA and RNA including, but not limited to, 4-acetylcytosine, 8-hydroxy-N6-methyladenosine, aziridinylcytosine, pseudoisocytosine, 5-(carboxyhydroxylmethyl) uracil, 5-fluorouracil, 5-bromouracil, 5-carboxymethylaminomethyl-2-thiouracil, 5-carboxymethylaminomethyluracil, dihydrouracil, inosine, N6-isopentenyladenine, 1-methyladenine, 1-methylpseudouracil, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-methyladenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5-methoxycarbonylmethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid, oxybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, N-uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid, pseudouracil, queosine, 2-thiocytosine, and 2,6-diaminopurine.
(33) The term gene refers to a nucleic acid (e.g., DNA) sequence that comprises coding sequences for the production of a polypeptide, precursor, or RNA (e.g., rRNA, tRNA, sRNA, microRNA, lincRNA). The polypeptide can be encoded by a full-length coding sequence or by any portion of the coding sequence so long as the desired activity or functional properties (e.g., enzymatic activity, ligand binding, signal transduction, immunogenicity, etc.) of the full-length or fragment are retained. The term also encompasses the coding region of a structural gene and the sequences located adjacent to the coding region on both the 5 and 3 ends for a distance of about 1 kb or more on either end such that the gene corresponds to the length of the full-length mRNA. Sequences located 5 of the coding region and present on the mRNA are referred to as 5 non-translated sequences. Sequences located 3 or downstream of the coding region and present on the mRNA are referred to as 3 non-translated sequences. The term gene encompasses both cDNA and genomic forms of a gene. A genomic form or clone of a gene contains the coding region interrupted with non-coding sequences termed introns or intervening regions or intervening sequences. Introns are segments of a gene that are transcribed into nuclear RNA (hnRNA); introns may contain regulatory elements such as enhancers. Introns are removed or spliced out from the nuclear or primary transcript; introns therefore are absent in the messenger RNA (mRNA) transcript. The mRNA functions during translation to specify the sequence or order of amino acids in a nascent polypeptide.
(34) As used herein, the term heterologous gene refers to a gene that is not in its natural environment. For example, a heterologous gene includes a gene from one species introduced into another species. A heterologous gene also includes a gene native to an organism that has been altered in some way (e.g., mutated, added in multiple copies, linked to non-native regulatory sequences, etc.). Heterologous genes are distinguished from endogenous genes in that the heterologous gene sequences are typically joined to DNA sequences that are not found naturally associated with the gene sequences in the chromosome or are associated with portions of the chromosome not found in nature (e.g., genes expressed in loci where the gene is not normally expressed).
(35) As used herein, the term oligonucleotide, refers to a short length of single-stranded polynucleotide chain. Oligonucleotides are typically less than about 300 residues long (e.g., between 15 and 100), however, as used herein, the term is also intended to encompass longer polynucleotide chains. Oligonucleotides are often referred to by their length. For example, a 24-residue oligonucleotide is referred to as a 24-mer. Oligonucleotides can form secondary and tertiary structures by self-hybridizing or by hybridizing to other polynucleotides. Such structures can include, but are not limited to, duplexes, hairpins, cruciforms, bends, and triplexes.
(36) Peptide and polypeptide as used herein, and unless otherwise specified, refer to polymer compounds of two or more amino acids joined through the main chain by peptide amide bonds (C(O)NH). The term peptide typically refers to short amino acid polymers (e.g., chains having fewer than 25 amino acids), whereas the term polypeptide typically refers to longer amino acid polymers (e.g., chains having more than 25 amino acids).
(37) As used herein, the term fragment refers to a peptide or polypeptide that results from dissection or fragmentation of a larger whole entity (e.g., protein, polypeptide, enzyme, etc.), or a peptide or polypeptide prepared to have the same sequence as such. Therefore, a fragment is a subsequence of the whole entity (e.g., protein, polypeptide, enzyme, etc.) from which it is made and/or designed. A peptide or polypeptide that is not a subsequence of a preexisting whole protein is not a fragment (e.g., not a fragment of a preexisting protein).
(38) As used herein, the term sequence identity refers to the degree two polymer sequences (e.g., peptide, polypeptide, nucleic acid, etc.) have the same sequential composition of monomer subunits. The term sequence similarity refers to the degree with which two polymer sequences (e.g., peptide, polypeptide, nucleic acid, etc.) have similar polymer sequences. For example, similar amino acids are those that share the same biophysical characteristics and can be grouped into the families, e.g., acidic (e.g., aspartate, glutamate), basic (e.g., lysine, arginine, histidine), non-polar (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan) and uncharged polar (e.g., glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine). The percent sequence identity (or percent sequence similarity) is calculated by: (1) comparing two optimally aligned sequences over a window of comparison (e.g., the length of the longer sequence, the length of the shorter sequence, a specified window), (2) determining the number of positions containing identical (or similar) monomers (e.g., same amino acids occurs in both sequences, similar amino acid occurs in both sequences) to yield the number of matched positions, (3) dividing the number of matched positions by the total number of positions in the comparison window (e.g., the length of the longer sequence, the length of the shorter sequence, a specified window), and (4) multiplying the result by 100 to yield the percent sequence identity or percent sequence similarity. For example, if peptides A and B are both 20 amino acids in length and have identical amino acids at all but 1 position, then peptide A and peptide B have 95% sequence identity. If the amino acids at the non-identical position shared the same biophysical characteristics (e.g., both were acidic), then peptide A and peptide B would have 100% sequence similarity. As another example, if peptide C is 20 amino acids in length and peptide D is 15 amino acids in length, and 14 out of 15 amino acids in peptide D are identical to those of a portion of peptide C, then peptides C and D have 70% sequence identity, but peptide D has 93.3% sequence identity to an optimal comparison window of peptide C. For the purpose of calculating percent sequence identity (or percent sequence similarity) herein, any gaps in aligned sequences are treated as mismatches at that position.
(39) In some embodiments the substitutions can be conservative amino acid substitutions. Examples of conservative amino acid substitutions, unlikely to affect biological activity, include the following: alanine for serine, valine for isoleucine, aspartate for glutamate, threonine for serine, alanine for glycine, alanine for threonine, serine for asparagine, alanine for valine, serine for glycine, tyrosine for phenylalanine, alanine for proline, lysine for arginine, aspartate for asparagine, leucine for isoleucine, leucine for valine, alanine for glutamate, aspartate for glycine, and these changes in the reverse. See e.g. Neurath et al., The Proteins, Academic Press, New York (1979), the relevant portions of which are incorporated herein by reference. Further, an exchange of one amino acid within a group for another amino acid within the same group is a conservative substitution, where the groups are the following: (1) alanine, valine, leucine, isoleucine, methionine, norleucine, and phenylalanine: (2) histidine, arginine, lysine, glutamine, and asparagine; (3) aspartate and glutamate; (4) serine, threonine, alanine, tyrosine, phenylalanine, tryptophan, and cysteine; and (5) glycine, proline, and alanine.
(40) The term homology and homologous refers to a degree of identity. There may be partial homology or complete homology. A partially homologous sequence is one that is less than 100% identical to another sequence.
(41) As used herein, the terms complementary or complementarity are used in reference to polynucleotides (e.g., a sequence of nucleotides such as an oligonucleotide or a target nucleic acid) related by the base-pairing rules. For example, for the sequence 5-A-G-T-3 is complementary to the sequence 3-T-C-A-5. Complementarity may be partial, in which only some of the nucleic acids' bases are matched according to the base pairing rules. Or, there may be complete or total complementarity between the nucleic acids. The degree of complementarity between nucleic acid strands has significant effects on the efficiency and strength of hybridization between nucleic acid strands. This is of particular importance in amplification reactions, as well as detection methods that depend upon binding between nucleic acids. Either term may also be used in reference to individual nucleotides, especially within the context of polynucleotides. For example, a particular nucleotide within an oligonucleotide may be noted for its complementarity, or lack thereof, to a nucleotide within another nucleic acid strand, in contrast or comparison to the complementarity between the rest of the oligonucleotide and the nucleic acid strand.
(42) In some contexts, the term complementarity and related terms (e.g., complementary, complement) refers to the nucleotides of a nucleic acid sequence that can bind to another nucleic acid sequence through hydrogen bonds, e.g., nucleotides that are capable of base pairing, e.g., by Watson-Crick base pairing or other base pairing. Nucleotides that can form base pairs, e.g., that are complementary to one another, are the pairs: cytosine and guanine, thymine and adenine, adenine and uracil, and guanine and uracil. The percentage complementarity need not be calculated over the entire length of a nucleic acid sequence. The percentage of complementarity may be limited to a specific region of which the nucleic acid sequences that are base-paired, e.g., starting from a first base-paired nucleotide and ending at a last base-paired nucleotide. The complement of a nucleic acid sequence as used herein refers to an oligonucleotide which, when aligned with the nucleic acid sequence such that the 5 end of one sequence is paired with the 3 end of the other, is in antiparallel association. Certain bases not commonly found in natural nucleic acids may be included in the nucleic acids of the present disclosure and include, for example, inosine and 7-deazaguanine. Complementarity need not be perfect; stable duplexes may contain mismatched base pairs or unmatched bases. Those skilled in the art of nucleic acid technology can determine duplex stability empirically considering a number of variables including, for example, the length of the oligonucleotide, base composition and sequence of the oligonucleotide, ionic strength and incidence of mismatched base pairs.
(43) Thus, in some embodiments, complementary refers to a first nucleobase sequence that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to the complement of a second nucleobase sequence over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, or more nucleobases, or that the two sequences hybridize under stringent hybridization conditions. Fully complementary means each nucleobase of a first nucleic acid is capable of pairing with each nucleobase at a corresponding position in a second nucleic acid. For example, in certain embodiments, an oligonucleotide wherein each nucleobase has complementarity to a nucleic acid has a nucleobase sequence that is identical to the complement of the nucleic acid over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, or more nucleobases.
(44) As used herein, a double-stranded nucleic acid may be a portion of a nucleic acid, a region of a longer nucleic acid, or an entire nucleic acid. A double-stranded nucleic acid may be, e.g., without limitation, a double-stranded DNA, a double-stranded RNA, a double-stranded DNA/RNA hybrid, etc. A single-stranded nucleic acid having secondary structure (e.g., base-paired secondary structure) and/or higher order structure comprises a double-stranded nucleic acid. For example, triplex structures are considered to be double-stranded. In some embodiments, any base-paired nucleic acid is a double-stranded nucleic acid
(45) The term isolated when used in relation to a nucleic acid, as in an isolated oligonucleotide or isolated polynucleotide refers to a nucleic acid sequence that is identified and separated from at least one component or contaminant with which it is ordinarily associated in its natural source. Isolated nucleic acid is such present in a form or setting that is different from that in which it is found in nature. In contrast, non-isolated nucleic acids as nucleic acids such as DNA and RNA found in the state they exist in nature. For example, a given DNA sequence (e.g., a gene) is found on the host cell chromosome in proximity to neighboring genes; RNA sequences, such as a specific mRNA sequence encoding a specific protein, are found in the cell as a mixture with numerous other mRNAs that encode a multitude of proteins. However, isolated nucleic acid encoding a given protein includes, by way of example, such nucleic acid in cells ordinarily expressing the given protein where the nucleic acid is in a chromosomal location different from that of natural cells, or is otherwise flanked by a different nucleic acid sequence than that found in nature. The isolated nucleic acid, oligonucleotide, or polynucleotide may be present in single-stranded or double-stranded form. When an isolated nucleic acid, oligonucleotide or polynucleotide is to be utilized to express a protein, the oligonucleotide or polynucleotide will contain at a minimum the sense or coding strand (i.e., the oligonucleotide or polynucleotide may be single-stranded), but may contain both the sense and anti-sense strands (i.e., the oligonucleotide or polynucleotide may be double-stranded).
(46) As used herein, the term purified or to purify refers to the removal of components (e.g., contaminants) from a sample. For example, antibodies are purified by removal of contaminating non-immunoglobulin proteins; they are also purified by the removal of immunoglobulin that does not bind to the target molecule. The removal of non-immunoglobulin proteins and/or the removal of immunoglobulins that do not bind to the target molecule results in an increase in the percent of target-reactive immunoglobulins in the sample. In another example, recombinant polypeptides are expressed in bacterial host cells and the polypeptides are purified by the removal of host cell proteins; the percent of recombinant polypeptides is thereby increased in the sample.
(47) Preferred methods and materials are described below, although methods and materials similar or equivalent to those described herein can be used in practice or testing of the present disclosure. All publications, patent applications, patents and other references mentioned herein are incorporated by reference in their entirety. The materials, methods, and examples disclosed herein are illustrative only and not intended to be limiting.
2. RECOMBINANT -HEXOSYL-TRANSFERASE (RBHT) POLYPEPTIDES
(48) Embodiments of the present disclosure provide compositions and methods related to the production of human milk oligosaccharides (HMOs). In particular, the present disclosure provides compositions and methods for converting lactose and N-acetylglucosamine (GlcNAc) into N-acetyllactosamine (LacNAc)-enriched galactooligosaccharide (GOS) compositions using novel -hexosyl-transferase (BHT) enzymes.
(49) As would be recognized by one of ordinary skill in the art based on the present disclosure, recombinant rBHT proteins, or rBHT proteins, includes full length rBHT proteins and any fragments and/or variants thereof, which includes proteins encoded by naturally-occurring allelic variants of the rBHT gene, as well as recombinantly-produced rBHT proteins, which may contain some sequence changes relative to naturally-occurring rBHT proteins. A recombinant protein can be a protein that results from the process of genetic engineering, which generally involves use of a corresponding recombinant nucleic acid molecule encoding the peptide that is inserted into an engineered host cell in order to express the nucleic acid molecule and the corresponding peptide. That is, the host cell has been transfected, transformed or transduced with a recombinant polynucleotide molecule, and thereby altered so as to cause the cell to express the desired polypeptide (e.g., rBHT).
(50) In accordance with these embodiments, the present disclosure includes a functional, recombinant -hexosyl-transferase (rBHT) polypeptide comprising at least 90% sequence identity with SEQ ID NO: 1 and an N-terminal truncation of at least one amino acid with reference to SEQ ID NO: 1. In some embodiments, the polypeptide comprises at least 95% sequence identity with SEQ ID NO: 1. In some embodiments, the polypeptide further comprises at least one additional amino acid substitution.
(51) In some embodiments, the polypeptide comprises an N-terminal truncation that is from about 1 to about 81 amino acids in length. In some embodiments, the N-terminal truncation is from about 1 to about 56 amino acids in length. In some embodiments, the polypeptide comprises an N-terminal truncation that is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 83, 74, 75, 76, 77, 78, 79, 80, or 81 amino acids in length.
(52) In some embodiments, the polypeptide comprises at least 90% sequence identity with any of SEQ ID NOs: 3, 5, 7, and 9. In some embodiments, the polypeptide comprises at least 91% sequence identity with any of SEQ ID NOs: 3, 5, 7, and 9. In some embodiments, the polypeptide comprises at least 92% sequence identity with any of SEQ ID NOs: 3, 5, 7, and 9. In some embodiments, the polypeptide comprises at least 93% sequence identity with any of SEQ ID NOs: 3, 5, 7, and 9. In some embodiments, the polypeptide comprises at least 94% sequence identity with any of SEQ ID NOs: 3, 5, 7, and 9. In some embodiments, the polypeptide comprises at least 95% sequence identity with any of SEQ ID NOs: 3, 5, 7, and 9. In some embodiments, the polypeptide comprises at least 96% sequence identity with any of SEQ ID NOs: 3, 5, 7, and 9. In some embodiments, the polypeptide comprises at least 97% sequence identity with any of SEQ ID NOs: 3, 5, 7, and 9. In some embodiments, the polypeptide comprises at least 98% sequence identity with any of SEQ ID NOs: 3, 5, 7, and 9. In some embodiments, the polypeptide comprises at least 99% sequence identity with any of SEQ ID NOs: 3, 5, 7, and 9.
(53) As would be recognized by one of ordinary skill in the art based on the present disclosure, soluble secreted proteins and proteins expressed on the cell surface can include an N-terminal signal sequence, which is generally a hydrophobic sequence that mediates insertion of the protein through the membrane of the endoplasmic reticulum (ER) in a eukaryotic cell. Type 1 transmembrane proteins also comprise signal sequences. Signal sequences, as used herein, can include amino-terminal hydrophobic sequences which are generally enzymatically removed following the insertion of part or all of the protein through the ER membrane into the lumen of the ER. Thus, a signal sequence can be present as part of a precursor form of a secreted or transmembrane protein, but will generally be absent from the mature form of the protein. When a protein is said to comprise a signal sequence, it is to be understood that, although a precursor form of the protein does contain the signal sequence, a mature form of the protein will likely not contain the signal sequence. Signal sequences may contain a residue adjacent to and immediately upstream from the cleavage site (position 1) and another residue at position 3, which are important for this enzymatic cleavage. (See, e.g., Nielsen et al. 1997 Protein Eng 10(1) 1-6; von Heijne 1983 Eur J Biochem 133(1) 7-21; von Heijne 1985 J Mol Biol 184 99-105, which describes signal sequences and how to identify them). In some embodiments, the rBHT polypeptides of the present disclosure can be soluble or membrane-bound. In some embodiments, about 1% to about 50% of the polypeptide is soluble. In some embodiments, about 1% to about 45% of the polypeptide is soluble. In some embodiments, about 1% to about 40% of the polypeptide is soluble. In some embodiments, about 1% to about 35% of the polypeptide is soluble. In some embodiments, about 1% to about 30% of the polypeptide is soluble. In some embodiments, about 1% to about 25% of the polypeptide is soluble. In some embodiments, about 1% to about 20% of the polypeptide is soluble. In some embodiments, about 10% to about 15% of the polypeptide is soluble. In some embodiments, about 10% to about 10% of the polypeptide is soluble.
(54) In accordance with the embodiments of the present disclosure, any signal peptide(s) or signal sequence(s) can be included in the rBHT polypeptides of the present disclosure, including signal sequences derived from a peptide(s) or polypeptide(s) from a prokaryotic organism, a eukaryotic organism, a fungus, a mammal, an insect, a yeast, or a plant. In some embodiments, signal sequence(s) that can be included, without limitation, in the rBHT polypeptides of the present disclosure include those described in Ahmad, M., et. Al., (2014) Protein expression in Komagataella (Pichia) pastoris: recent achievements and perspectives for heterologous protein production, Applied Microbiology and Biotechnology 98(12): 5301-5317.
(55) In some embodiments, the rBHT polypeptides of the present disclosure include a signal sequence that is non-native or exogenous with reference to a host cell engineered to express the rBHT polypeptides. In some embodiments, the rBHT polypeptides of the present disclosure include a signal sequence that is native or endogenous with reference to a host cell engineered to express the rBHT polypeptides. In either case, the signal sequence can be in its native form/sequence, or truncated, and/or can include at least one amino acid substitution with reference to its native form/sequence.
(56) In some embodiments, the signal sequence comprises an amino acid sequence derived from a yeast protein. In some embodiments, the signal sequence comprises an amino acid sequence from a protein from any one of Komagataella (Pichia) pastoris, Saccharomyces cerevisiae, Yarrowia lipolytica, Hansenula (Ogataea) polymorpha, or Kluyveromyces lactis. In some embodiments, the signal sequence comprises a polypeptide with at least 90% sequence identity to at least one of -mating factor signal sequence from Saccharomyces cerevisiae (MF) (SEQ ID NO: 29), Invertase (IV) signal sequence (SEQ ID NO: 30), Glucoamylase (GA) signal sequence (SEQ ID NO: 31), or Inulinase (IN) signal sequence (SEQ ID NO: 32). In some embodiments, the polypeptide comprises at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of SEQ ID NOs: 29, 30, 31, or 32. In some embodiments, the polypeptide comprises at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of SEQ ID NO: 29. In some embodiments, the polypeptide comprises at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of SEQ ID NO: 30. In some embodiments, the polypeptide comprises at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of SEQ ID NO: 31. In some embodiments, the polypeptide comprises at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of SEQ ID NO: 32.
(57) As described further herein, the rBHT polypeptides of the present disclosure include a signal sequence (or functional fragment thereof) from any of SEQ ID NOs: 29, 30, 31, or 32. In accordance with these embodiments, the rBHT polypeptide can comprise at least 90% sequence identity with any of SEQ ID NOs: 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70. In some embodiments, the rBHT polypeptide can comprise at least 91% sequence identity with any of SEQ ID NOs: 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70. In some embodiments, the rBHT polypeptide can comprise at least 92% sequence identity with any of SEQ ID NOs: 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70. In some embodiments, the rBHT polypeptide can comprise at least 93% sequence identity with any of SEQ ID NOs: 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70. In some embodiments, the rBHT polypeptide can comprise at least 94% sequence identity with any of SEQ ID NOs: 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70. In some embodiments, the rBHT polypeptide can comprise at least 95% sequence identity with any of SEQ ID NOs: 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70. In some embodiments, the rBHT polypeptide can comprise at least 96% sequence identity with any of SEQ ID NOs: 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70. In some embodiments, the rBHT polypeptide can comprise at least 97% sequence identity with any of SEQ ID NOs: 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70. In some embodiments, the rBHT polypeptide can comprise at least 98% sequence identity with any of SEQ ID NOs: 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70. In some embodiments, the rBHT polypeptide can comprise at least 99% sequence identity with any of SEQ ID NOs: 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70.
(58) The rBHT polypeptides of the present disclosure may be glycosylated to varying degrees or may not be glycosylated. For example, rBHT polypeptides of the present disclosure can comprise one or more N- or O-linked glycosylation sites in addition to those already found in a protein or polypeptide comprising any of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70. One of ordinary skill in the art would recognize based on the present disclosure that asparagine residues that are part of the sequence Asn Xxx Ser/Thr (where Xxx is any amino acid except proline) can serve as sites of addition for N-glycans. In addition, there are serine and threonine residues that may serve as O-linked glycosylation sites. Glycosylation may increase in vivo half-life or alter biological activity. Variants of rBHT proteins also include proteins comprising one, two, three, four, five, six, seven, eight, nine, or ten more N- and/or O-linked glycosylation sites than are present in a corresponding wildtype protein or polypeptide, as long as the resulting protein or polypeptide maintains its function as a glycosyl hydrolase and a -hexosyl-transferase. Variant rBHT polypeptides also include those that have one, two, three, four, or five fewer N- and/or O-linked glycosylation sites than are present in a corresponding wildtype protein or polypeptide, as long as the resulting protein or polypeptide maintains its function as a glycosyl hydrolase and a -hexosyl-transferase. In some embodiments, the rBHT polypeptides of the present disclosure comprise at least one asparagine residue at positions 289, 297, 431, and 569 with respect to SEQ ID NO: 1. In some embodiments, the rBHT polypeptides of the present disclosure comprise at least two asparagine residues at positions 289, 297, 431, and 569 with respect to SEQ ID NO: 1. In some embodiments, the rBHT polypeptides of the present disclosure comprise at least three asparagine residues at positions 289, 297, 431, and 569 with respect to SEQ ID NO: 1. In some embodiments, the rBHT polypeptides of the present disclosure comprise asparagine residues at positions 289, 297, 431, and 569 with respect to SEQ ID NO: 1.
(59) Embodiments of the present disclosure include secreted, soluble variants of the rBHT polypeptides described herein, as well as variants that include a transmembrane domain that can be expressed on a cell surface. Such proteins can be isolated as part of a purified protein preparation in which the rBHT polypeptides constitute at least 80% or at least 90% of the protein present in the preparation. The rBHT polypeptides of the present disclosure encompass proteins and polypeptides comprising an amino acid sequence set forth in SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70, as well as fragments, derivatives, and variants thereof, including fusion proteins.
(60) The rBHT polypeptides of the present disclosure can be fusion proteins comprising at least one rBHT polypeptide, which can comprise an amino acid sequence that is a variant and/or a fragment of any of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70 (as explained above), and at least one other moiety. The other moiety can also be a non-protein moiety such as, for example, a polyethylene glycol (PEG) moiety or a cytotoxic, cytostatic, luminescent, and/or radioactive moiety. Attachment of PEG has been shown to increase the in vivo half-life of at least some proteins. Moreover, cytotoxic, cytostatic, luminescent, and/or radioactive moieties have been fused to antibodies for diagnostic or therapeutic purposes. A variety of polypeptides other than a rBHT polypeptide (or fragment thereof) can be fused to an rBHT polypeptide for a variety of purposes such as, for example, to increase in vivo half-life of the protein, to facilitate identification, isolation and/or purification of the protein, to increase the activity of the protein, and to promote oligomerization of the protein.
(61) Many polypeptides can facilitate identification and/or purification of a recombinant fusion protein of which they are a part. Examples include polyarginine, polyhistidine, or HAT (Clontech), which is a naturally-occurring sequence of non-adjacent histidine residues that possess a high affinity for immobilized metal ions. rBHT proteins comprising these polypeptides can be purified by, for example, affinity chromatography using immobilized nickel or TALON resin (Clontech), which comprises immobilized cobalt tons. See e.g. Knol et al. 1996 J Biol Chem 27(26) 15358-15366. Polypeptides comprising polyarginine allow effective purification by ion exchange chromatography. Other useful polypeptides include, for example, the antigenic identification peptides described in U.S. Pat. No. 5,011,912 and in Hopp et al. 1988 Bio/Technology 6 1204. One such peptide is the FLAG peptide, which is highly antigenic and provides an epitope reversibly bound by a specific monoclonal antibody, enabling rapid assay and facile purification of expressed recombinant fusion protein. A murine hybridoma designated 4E11 produces a monoclonal antibody that binds the FLAG peptide in the presence of certain divalent metal cations, as described in U.S. Pat. No. 5,011,912. The 4E11 hybridoma cell line has been deposited with the American Type Culture Collection under Accession No. HB 9259. Monoclonal antibodies that bind the FLAG peptide can be used as affinity reagents to recover a polypeptide purification reagent that comprises the FLAG peptide. Other suitable protein tags and affinity reagents are: 1) those described in GST-Bind system (Novagen), which utilizes the affinity of glutathione-S-transferase fusion proteins for immobilized glutathione; 2) those described in the T7-TAG affinity purification kit, which utilizes the affinity of the amino terminal 11 amino acids of the T7 gene 10 protein for a monoclonal antibody; or 3) those described in the STREP-TAG system (Novagen), which utilizes the affinity of an engineered form of streptavidin for a protein tag. Some of the above-mentioned protein tags, as well as others, are described in Sassenfeld 1990 TIBTECH 8: 88-93, Brewer et al., in Purification and Analysis of Recombinant Proteins, pp. 239-266, Seetharam and Sharma (eds.), Marcel Dekker, Inc. (1991), and Brewer and Sassenfeld, in Protein Purification Applications, pp. 91-111, Harris and Angal (eds.), Press, Inc., Oxford England (1990). The portions of these references that describe protein tags are incorporated herein by reference. Further, fusions of two or more of the tags described herein, such as, for example, a fusion of a FLAG tag and a polyhistidine tag, can be fused to an rBHT polypeptide of the present disclosure.
(62) In some embodiments, the rBHT polypeptides of the present disclosure also include an affinity tag that can be used as part of means for producing the polypeptides. In addition to the 6-HIS tag described further herein, a variety of purification methods may be used such as affinity tags, such as antigenic tags (e.g., FLAG (Sigma-Aldrich, Hopp et al. 1988 Nat Biotech 6:1204-1210), hemagluttanin (HA) (Wilson et al., 1984 Cell 37:767), Intein fusion expression systems (New England Biolabs, USA) Chong et al. 1997 Gene 192(2), 271-281, or maltose-binding protein (MBP)), glutathione S transferase (GST)/glutathione, poly His/Ni or Co (Gentz et al., 1989 PNAS USA 86:821-824). Fusion proteins containing GST-tags at the N-terminus of the protein are also described in U.S. Pat. No. 5,654,176 (Smith). Magnetic separation techniques may also be used such as Strepavidin-DynaBeads (Life Technologies, USA). Alternatively, photo-cleavable linkers may be used, e.g., U.S. Pat. No. 7,595,198 (Olejnik & Rothchild). Many other systems are known in the art and are suitable for use with the embodiments of the present disclosure.
3. NUCLEIC ACID CONSTRUCTS
(63) Embodiments of the present disclosure also include a nucleic acid molecule encoding any of the rBHT polypeptides described herein. Embodiments of the present disclosure also include a vector comprising any one of these nucleic acid molecules. In some embodiments, isolated nucleic acids, including, for example DNA and RNA molecules, encode the rBHT polypeptides described herein, which include polypeptides comprising the amino acid sequence of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, or 70 and fragments and/or variants thereof. In some embodiments, these nucleic acids are useful for producing recombinant proteins having glycosyl hydrolase and a -hexosyl-transferase activity. Such nucleic acids can be modified genomic DNA or cDNA. In some cases, the nucleic acids can comprise an uninterrupted open reading frame encoding an rBHT protein. Nucleic acid molecules of the present disclosure include DNA and RNA in both single-stranded and double-stranded form, as well as the corresponding complementary sequences. An isolated nucleic acid is a nucleic acid that has been separated from adjacent genetic sequences present in the genome of the organism from which the nucleic acid was isolated, in the case of nucleic acids isolated from naturally-occurring sources, in the case of nucleic acids synthesized chemically, such as oligonucleotides, or enzymatically from a template, such as polymerase chain reaction (PCR) products or cDNAs, it is understood that the nucleic acids resulting from such processes are isolated nucleic acids. An isolated nucleic acid molecule refers to a nucleic acid molecule in the form of a separate fragment or as a component of a larger nucleic acid construct.
(64) The present disclosure also includes nucleic acids comprising the sequence of SEQ ID NOs: 2, 4, 6, 7, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, and 69 or a fragment thereof or nucleic acids that hybridize under moderately stringent conditions, and optionally highly stringent conditions, to nucleic acids comprising the nucleotide sequence of SEQ ID NOs: 2, 4, 6, 7, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, and 69, which includes the nucleotide sequence of the full length rBHT cDNA (SEQ ID NO: 1), wherein the nucleic acid encodes a protein that can act as a glycosyl hydrolase and a -hexosyl-transferase. Hybridization techniques are well known in the art and are described by Sambrook, J., E. F. Fritsch, and T. Maniatis (Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., chapters 9 and 11, 1989) and Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., John Wiley & Sons, Inc., sections 2.10 and 6.3-6.4 1995).
4. METHODS OF PRODUCTION
(65) Embodiments of the present disclosure include methods of generating compositions comprising GOS (GOS compositions) from lactose in a host cell using any of the rBHT polypeptides described herein. As described further herein, the rBHT polypeptides of the present disclosure are functional in that they exhibit the ability to catalyze the hydrolysis of -(1-4) glycosidic linkages to generate any GOS composition(s) from lactose, including but not limited to, GOS with or without GlcNAc, as well as LacNAc-enriched GOS compositions. As would be recognized by one of ordinary skill in the art based on the present disclosure, GOS generally refers to a galactose-containing polysaccharide with two or more sugar units such as Gal-Gal or [Gal].sub.n-Glc (1n8), including -D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Glc, -D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Glc, and -D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Glc.
(66) In some embodiments, the GOS produced using the rBHT polypeptides of the present disclosure includes one or more N-acetyllactosamine (LacNAc) units. In one embodiment, GOS can be produced by incubating a host cell expressing the rBHT polypeptide in a medium that comprises a disaccharide substrate such as for example lactose. In one embodiment, the GOS is produced from lactose simultaneously with a glucose removal system. The glucose removal system may be a generally recognized as safe (GRAS) organism. In some embodiments, the host cell is one or more of a yeast cell, a fungal cell, a mammalian cell, an insect cell, a plant cell, or an algal cell. In some embodiments, the host cell comprises one or more cells from Komagataella (Pichia) pastoris (also referred to as Kamagataaella phaffi), Saccharomyces cerevisiae, Yarrowia lipolytica, Hansenula (Ogataea) polymorpha, or Kluyveromyces lactis, Aspergillus spp., and Trichoderma reesei. In some embodiments, the host cell includes any cell from the genus Komagataella. In some embodiments, the GOS comprises N-acetyllactosamine (LacNAc). In some embodiments, the method produces a LacNAc-enriched GOS yield of at least 10% of initial lactose concentration, and a total GOS concentration of at least 50% of initial lactose concentration. In some embodiments, the method produces a LacNAc-enriched GOS yield of at least 10% of initial lactose concentration, and a total GOS concentration of at least 60% of initial lactose concentration. In some embodiments, the method produces a LacNAc-enriched GOS yield of at least 10% of initial lactose concentration, and a total GOS concentration of at least 70% of initial lactose concentration. In some embodiments, the method produces a LacNAc-enriched GOS yield of at least 10% of initial lactose concentration, and a total GOS concentration of at least 75% of initial lactose concentration. For example, using an initial lactose-to-GlcNAc ratio of 1:8, the methods provided herein using the rBHT polypeptides (e.g., whole cells membrane bound enzyme) with about 200 g lactose and about 25 g GlcNAc) generate about 25 g of LacNAc and about 100 g GOS. Initial lactose-to-GlcNAc ratios can range from about 1:20 to about 20:1.
(67) In some embodiments, the rBHT polypeptides of the present disclosure are useful for producing LacNAc and related compositions. The prebiotic LacNAc is regarded as one of the most important building blocks for higher order human milk oligosaccharide (HMO) generation. However, feasible industrial production routes by chemical synthesis suffer from low yields, thus favoring the biocatalysis of LacNAc. The major difference between other biosynthesis routes and the biological synthesis of LacNAc with the enzyme BHT, as described further herein, is lower cost and higher purity. Embodiments of the present disclosure demonstrate that LacNAc production by the rBHT polypeptides described herein is more suitable for industrial scale when compared with other processes. As shown in the example in
(68) In some embodiments, the rBHT polypeptides of the present disclosure can be used for producing GOS compositions that do not include N-acetylglucosamine (GlcNAc). Embodiments of the present disclosure includes materials and methods for producing GOS compositions lacking GlcNAc, which include reacting lactose with rBHT polypeptides having the amino acid sequences provided herein under suitable conditions so as to produce GOS. Similar compositions and methods are described in related U.S. Pat. Nos. 10,513,695, and 9,783,789, both of which are herein incorporated by reference.
(69) The rBHT polypeptides of the present disclosure can be made using various means known in the art. For example, a nucleic acid molecule that encodes an rBHT polypeptide, as described herein, can be introduced into a vector, which can be introduced into a host cell. Vectors and host cells comprising nucleic acids encoding an rBHT polypeptide are encompassed by the embodiments of the present disclosure. The host cell containing the nucleic acids encoding an rBHT polypeptide can be cultured under conditions such that the rBHT polypeptide can be expressed. The expressed rBHT polypeptide can then be obtained from the medium in which the cells are cultured or from the cells and purified by any of the many appropriate means known in the art. In addition, genetic engineering methods for the production of rBHT polypeptide include the expression of the polynucleotide molecules in cell free expression systems, in cellular hosts, in tissues, and in animal models, according to known methods.
(70) The vector can include a selectable marker and an origin of replication, for propagation in a host. The vector can further include suitable transcriptional or translational regulatory sequences, such as those derived from mammalian, microbial, viral, or insect genes, operably linked to the nucleic acid encoding the rBHT polypeptide. Examples of such regulatory sequences include transcriptional promoters, operators, or enhancers, mRNA ribosomal binding sites, and appropriate sequences that control transcription and translation. Nucleotide sequences are operably linked when the regulatory sequence functionally relates to the DNA encoding the target protein. Thus, a promoter nucleotide sequence is operably linked to an rBHT polypeptide sequence if the promoter nucleotide sequence directs the transcription of the rBHT protein-encoding sequence. If the rBHT polypeptide is a fusion protein, a nucleic acid sequence encoding a portion of the fusion protein, for example, a signal sequence, can be part of a vector, and a nucleic acid encoding an rBHT polypeptide can be inserted into the vector such that a protein comprising the added signal sequence plus the rBHT polypeptide is encoded by the vector.
(71) Suitable host cells for expression of rBHT polypeptides include prokaryotic cells, yeast cells, plant cells, insect cells, and higher eukaryotic cells. The regulatory sequences in the vector will be chosen such that they are operable in the host cell. Suitable prokaryotic host cells include bacteria of the genera Escherichia, Bacillus, and Salmonella, as well as members of the genera Pseudomonas, Streptomyces, and Staphylococcus. For expression in prokaryotic cells, for example, in E. coli the polynucleotide molecule encoding an rBHT polypeptide includes an N-terminal methionine residue to facilitate expression of the recombinant polypeptide. The N-terminal methionine may optionally be cleaved from the expressed polypeptide. Suitable yeast host cells include cells from genera including, but not limited to, Saccharomyces, Pichia (Komagataella), and Kluyveromyces. In some embodiments, the host cell includes any cell from the genus Pichia (Komagataella). Preferred yeast hosts are S. cerevisiae and P. pastoris (also referred to as Kamagataaella phaffi). A suitable system for expression in an insect host cell is described, for example, in the review by Luckow and Summers (1988 BioTechnology 6 47-55), the relevant portions of which are incorporated herein by reference. Suitable mammalian host cells include the COS-7 line of monkey kidney cells (Gluzman et al. 1981 Cell 23 175-182), baby hamster kidney (BHK) cells, Chinese hamster ovary (CHO) cells (Puck et al. 1958 PNAS USA 60 1275-1281), CV-1 (Fischer et al. 1970 Int J Cancer 5 21-27), 293 cells from human kidney (American Type Culture Collection (ATCC) catalog no. CRL-10852), and human cervical carcinoma cells (HELA) (ATCC CCL 2). The relevant portions of the references referred to in this paragraph are incorporated herein by reference.
(72) Expression vectors for use in cellular hosts generally comprise one or more phenotypic selectable marker genes. Such genes encode, for example, a protein that confers antibiotic resistance or that supplies an auxotrophic requirement. A wide variety of such vectors are readily available from commercial sources. Examples include pGEM vectors (Promega), pSPORT vectors, and pPROEX vectors (InVitrogen, Life Technologies, Carlsbad, Calif), Bluescript vectors (Stratagene), and pQE vectors (Qiagen). Yeast vectors will often contain an origin of replication sequence from a yeast plasmid, an autonomously replicating sequence (ARS), a promoter region, sequences for polyadenylation, sequences for transcription termination, and a selectable marker gene. Vectors replicable in both yeast and E. coli (termed shuttle vectors) may also be used. In addition to the above-mentioned features of yeast vectors, a shuttle vector will also include sequences for replication and selection in E. coli. Direct secretion of the target polypeptides expressed in yeast hosts may be accomplished by the inclusion of nucleotide sequence encoding the yeast -factor leader sequence at the 5 end of the rBHT-encoding nucleotide sequence. Brake 1989 Biotechnology 13 269-280.
(73) Examples of suitable expression vectors for use in mammalian host cells include pcD A3.1/Hygro (Invitrogen), pDC409 (McMahan et al. 1991 EMBO J 10: 2821-2832), and pSVL (Pharmacia Biotech). Expression vectors for use in mammalian host cells can include transcriptional and translational control sequences derived from viral genomes.
(74) Commonly used promoter sequences and enhancer sequences that can be used to express rBHT RNA include, but are not limited to, those derived from human cytomegalovirus (CMV). Adenovirus 2, Polyomavirus, and Simian virus 40 (SV40). Methods for the construction of mammalian expression vectors are disclosed, for example, in Okayama and Berg (1982 Mol Cell Biol 2: 161-170), Cosman et al. (1986 Mol Immunol 23:935-941), Cosman et al. (1984 Nature 312: 768-771), EP-A-0367566, and WO 91/18982. The relevant portions of these references are incorporated herein by reference. Additionally, any spray drying or lyophilization or other concentration methods can be used to render the reaction mixture as a final product, as would be recognized by one of ordinary skill in the art based on the present disclosure. Cell separation techniques may be required when whole cells are used instead of pure enzymes.
5. COMPOSITIONS
(75) Embodiments of the present disclosure include a composition comprising any of the polypeptides described herein and/or one or more GOS generated using any of the polypeptides described herein (e.g., GOS with or without GlcNAc, as well as LacNAc-enriched GOS). In some embodiments, the composition is a food product. In some embodiments, the food product includes, but is not limited to, infant formula, yogurt, dairy products, milk-based beverages, fruit beverages, hydration beverages, energy beverages, fruit preparations, and meal replacement beverages.
(76) As would be recognized by one of ordinary skill in the art based on the present disclosure, GOS compositions, including GOS with or without GlcNAc and LacNAc-enriched GOS compositions, are widely used as prebiotic supplements in foods and beverages around the world. These highly prized non-digestible sugars are able to mimic Human Milk Oligosaccharides (HMOs) by having a positive influence on the growth and metabolism of gastrointestinal (GI) bacteria (probiotics). Addition of prebiotics to the diet has shown a substantiated improvement in overall health of the host by reducing GI discomfort, managing the immune system and reducing pathogenic and opportunistic bacteria and viruses. Embodiments of the present disclosure demonstrate novel materials and methods for the development of prebiotics to generate LacNAc from pure lactose and GlcNAc and to significantly increase the concentration of secreted soluble rBHT.
(77) In some embodiments, the present disclosure includes use of the rBHT protein or cells expressing rBHT to produce a foodstuff or a dietary supplement containing LacNAc-enriched GOS compositions. The foodstuff may be diary foodstuff such as yogurt, cheese or fermented dairy products. The rBHT or cell expressing rBHT may be part added to the foodstuff or dietary supplements. The rBHT may be dried using Spray Dry; a quick and gentle method of obtaining even the smallest quantities of temperature sensitive substances in powder form. The dried rBHT also may be encapsulated form using the Spray dryer's ability to coat particles, immobilize solid material in a matrix and manufacture microcapsules (buchi.com/Mini_Spray_Dryer_B-290.179.0). Other drug delivery applications using functional GRAS encapsulating agents and technologies may be used. The dried rBHT tablet and powder forms may be analyzed for rBHT rate of activity once rehydrated in buffer containing lactose and in milk products.
(78) Any of the rBHT polypeptides described herein may be delivered in the form of a composition, that is, with one or more additional components such as a physiologically acceptable carrier, excipient, or diluent. For example, a composition may comprise a soluble rBHT polypeptides as described herein plus a buffer, an antioxidant such as ascorbic acid, a low molecular weight polypeptide (such as those having less than 10 amino acids), a protein, amino acids, carbohydrates such as glucose, sucrose, or dextrin, chelating agent such as EDTA, glutathione, and/or other stabilizers, excipients, and/or preservatives. The composition may be formulated as a liquid or a freeze-dried powder. Further examples of components that may be employed in pharmaceutical formulations are presented in Remington's Pharmaceutical Sciences, 16.sup.th Ed., Mack Publishing Company, Easton, Pa., (1980), the relevant portions of which are incorporated herein by reference.
(79) Compositions comprising therapeutic molecules described above can be administered by any appropriate means including, but not limited to, parenteral, topical, oral, nasal, vaginal, rectal, or pulmonary (by inhalation) administration. If injected, the composition(s) can be administered intra-articularly, intravenously, intraarterially, intramuscularly, intraperitoneally or subcutaneously by bolus injection or continuous infusion. Localized administration, that is, at the site of disease, is contemplated, as are transdermal delivery and sustained release from implants, skin patches, or suppositories. Delivery by inhalation includes, for example, nasal or oral inhalation, use of a nebulizer, inhalation in aerosol form, and the like. Administration via a suppository inserted into a body cavity can be accomplished, for example, by inserting a solid form of the composition in a chosen body cavity and allowing it to dissolve. Other alternatives include eye drops, oral preparations such as pills, lozenges, syrups, and chewing gum, and topical preparations such as lotions, gels, sprays, and ointments. In most cases, therapeutic molecules that are polypeptides can be administered topically or by injection or inhalation.
(80) The therapeutic molecules described above can be administered at any dosage, frequency, and duration that can be effective to treat the condition being treated. The dosage depends on the molecular nature of the therapeutic molecule and the nature of the disorder being treated. Treatment may be continued as long as necessary to achieve the desired results. The periodicity of treatment may or may not be constant throughout the duration of the treatment. For example, treatment may initially occur at weekly intervals and later occur every other week. Treatments having durations of days, weeks, months, or years are encompassed by the embodiments of the present disclosure. Treatment may be discontinued and then restarted.
(81) Maintenance doses may be administered after an initial treatment. Dosage may be measured as milligrams per kilogram of body weight (mg/kg) or as milligrams per square meter of skin surface (mg/m.sup.2) or as a fixed dose, irrespective of height or weight. These are standard dosage units in the art. A person's skin surface area is calculated from her height and weight using a standard formula. For example, a therapeutic rBHT protein can be administered at a dose of from about 0.05 mg/kg to about 10 mg/kg or from about 0.1 mg/kg to about 1.0 mg/kg. Alternatively, a dose of from about 1 mg to about 500 mg can be administered. Or a dose of about 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40, mg, 45, mg, 50 mg, 55 mg, 60 mg, 100 mg, 200 mg, or 300 mg can be administered.
6. MATERIALS AND METHODS
(82) Strains and media. Growth and maintenance of the strain GS115 (Invitrogen Life Technologies, Thermo Fisher Scientific) and media has been described previously. E. coli XL1-Blue was used as the cloning host (Agilent Technologies, Thermo Fisher Scientific). The plasmid pPIC9 (Invitrogen Life Technologies, Thermo Fisher Scientific) was used to construct expression vectors containing codon optimized Bht (rBht variants) (GenBank accession number JF29828).
(83) Plasmid constructions, Expression and Purification of rBHT-truncated variants. All molecular biology protocols were carried out as those described previously. Briefly, plasmids constructed for expression of rBHT variants in K. pastoris coding for truncation mutations were generated by PCR amplification of the codon optimized rBht open reading frame in pPIC9-MF-rBht.sub.(1-594)-HIS using primers purchased from Integrated DNA Technologies (IDT Coralville, IA, USA) (listed in Table 5). The bacterial strains and K. pastoris strains used in this study are shown in Tables 4A-4B. Bacteria were grown at 37 C. in Luria-Bertani (LB) Medium with antibiotic ampicillin (100 g/ml) (Thermo Fisher Scientific).
(84) Mutagenesis and Cloning. Plasmids coding for the truncated rBHT variants were generated by PCR amplification using HotStar Taq (Qiagen, Hilden, Germany) and pJB110 (pPIC9-MF-rBht.sub.(1-594)-HIS) as template. Primers were purchased from Integrated DNA Technologies (IDT Coralville, IA, USA). When appropriate, the primers included restriction sites to facilitate cloning (listed in Table 5). Briefly, primer pairs for sequences coding for the truncated rBHT variants encoding amino acids 32-594 (primers: JBB21/JBB5), 54-594 (primers: JBB22/JBB5), 57-594 (primers: JBB23/JBB5), 82-594 (primers: JBB24/JBB5), 95-594 (primers: JBB25/JBB5) and 103-594 (primers: JBB26/JBB5). The amplicons were digested with XhoI-NotI and cloned into pPIC9 (Invitrogen Life Technologies, Thermo Fisher Scientific) generating pJB123 (pPIC9-MF-rBht.sub.(32-594)-HIS), pJB124 (pPIC9-MF-rBht.sub.(54-594)-HIS), pJB125 (pPIC9-MF-rBht.sub.(57-594)-HIS), pJB126 (pPIC9-MF-rBht.sub.(82-594)-HIS), pJB127 (pPIC9-MF-rBht.sub.(95-594)-HIS) and pJB128 (pPIC9-MF-rBht.sub.(103-594)-HIS) respectively.
(85) Plasmids coding for pJB134 (pPIC9-IV-rBht.sub.(54-594)-HIS), pJB135 (pPIC9-GA-rBht.sub.(54-594)-HIS) and pJB136 (pPIC9-IN-rBht.sub.(54-594)-HIS) were generated using pJB124 (pPIC9-MF-rBht.sub.(54-594)-HIS) as the template and primer sets JBB37/JBB5, JBB38/JBB5 and JBB39/JBB5, respectively. The amplicons were digested with XhoI-NotI and cloned into pPIC9 (Invitrogen Life Technologies, Thermo Fisher Scientific).
(86) Site directed mutagenesis was performed using complementary oligonucleotides designed to incorporate the desired base changes using QuickChange site directed mutagenesis kit (Agilent Technologies Santa Clara, CA, USA) according to manufacturer's instructions to generate constructions containing single amino acid exchanges from asparagine to glutamine (N289Q (primers: JBB27/JBB28), N297Q (primers: JBB29/JBB30), N431Q (primers: JBB31/JBB32), and N569Q (primers: JBB33/JBB34)) in putative N-glycosylation sites using (pJB112, pPIC9-MF-rBht.sub.(23-594)-HIS) as the template and oligonucleotide primers with substituted nucleotides (Table 5). Site directed mutagenesis was also used to remove amino acids 57-70 from MF using primer set JBB35/JBB36 (Table 5) to generate pJB133 (pPIC9-MF.sub.(57-70)-rBht.sub.(23-594)-HIS) and pJB137(pPIC9-MF.sub.(57-70)-rBht.sub.(57-594)-HIS) (Tables 4A-4B). DNA fragments from restriction enzyme digests were purified from agarose gels using QIAquick gel extraction kit (Qiagen, Hilden, Germany). All mutations were confirmed with restriction digests for detecting restriction sites in primers and by Sanger sequencing performed by the NC State University Genomic Sciences Laboratory (Raleigh, NC, USA) using primers JBB3, JBB4, 5 AOX1, 3 AOX1 and -factor (Table 1).
(87) K. pastoris Transformation and Expression. K. pastoris was transformed with linearized plasmids as per the Invitrogen Pichia Expression Kit manual (Invitrogen, USA). Plasmid integration and Mut.sup.+ phenotype in histidine positive colonies was confirmed by sequencing PCR products generated by primers 5 AOX1 and 3 AOX1 (Invitrogen Pichia expression kit). Single copy integration was confirmed as previously described. Expression and purification have been described previously. Briefly, filtered culture media was purified using the KTApurifier and HISTrap HP Nickel column (GE Healthcare, Life sciences). The purified proteins were quantified by Bradford protein assay (Thermo Fisher Scientific).
(88) SDS-PAGE and Western Immunoblot Analysis. Proteins were analyzed by SDS-PAGE using 10% resolving gels and visualized by Coomassie and silver stain (Bio-Rad, Hercules, CA). Immunoblots were probed with 1:10,000 dilution of anti-HIS antibody (GenScript, Piscataway, NJ) followed by 1:10,000 dilution of alkaline phosphatase conjugated goat anti-mouse antibody (GenScript, Piscataway, NJ). Detection was carried out with 1-Step NBT/BCIP Substrate Solution according to manufacturer's instructions (Thermo Fisher Scientific).
(89) Enzyme Assays. The ONP-Glu activities were measured using the methods described previously (see, e.g., Dagher, S. F., and Bruno-Bircena, J. M. (2016) A novel N-terminal region of the membrane -hexosyltransferase: its role in secretion of soluble protein by Pichia pastoris. Microbiology 162, 23-34.)
(90) Sequence Analysis. Alignments were generated using ClustalX algorithm (www.clustal.org) and Jalview algorithm. The sequences of the top five homologous proteins were selected using NCBI blastp (blast.ncbi.nlm.nih.gov/): glycoside hydrolase family 1 protein glycoside hydrolase family 1 protein [Sphaerobolus stellatus SS14], accession number BAD95570.1, glycoside hydrolase [Violaceomyces palustris], accession number KIJ57308.1, glycoside hydrolase [Violaceomyces palustris], accession number PWN48553.1, hypothetical protein PFL1_06098 [Anthracocystis flocculosa PF-1], accession number XP_007881827.1, glycoside hydrolase [Testicularia cyperi], accession number PWZ03736.1 and glycoside hydrolase family 1 protein [Gymnopus luxurians FD-317 M1] accession number KIK57390.1.
(91) Secondary Structure Prediction. Secondary structure consensus prediction of BHT was performed at the PSIPRED server (protein structure prediction) and at the NPS@server (network protein sequence analysis). The signal sequence was predicted using the SignalP 5.0 algorithm. Protein disorder was predicted using the consensus of six methods, Dispred3, Phyre2, IUPred2A, PONDR-VSL2 and GlobPlot (prediction of protein disorder and globularity), PHYRE2. Domain boundaries were predicted using the DomPred server and Pfam version 32.0.
(92) N-glycosylation Prediction. BHT N- and O-glycosylation site prediction was performed at the GlycoEP server (see, e.g., Chauhan, J. S., Rao, A., and Raghava, G. P. S. (2013) In silico Platform for Prediction of N-, O- and C-Glycosites in Eukaryotic Protein Sequences. PLOS ONE 8, e67008).
(93) Phosphorylation Site Prediction. BHT phosphorylation site prediction was performed using DEPP (Disorder enhanced phosphorylation predictor), also known as DisPhos1.3 (www.dabi.temple.edu/disphos/) and NetPhosYeast1.0 (www.cbs.dtu.dk/services/NetPhosYeast/).
(94) Structural Modeling Programs. Structural figures and structural superimpositions were generated in PyMOL (www.schrodinger.com/pymol/). A dimer is present in the crystal asymmetric unit; however, the monomer was considered for structural analysis. Structural comparisons between BHT.sub.(23-594)-HIS and other known structures were executed with Dali (ekhidna2.biocenter.helsinki.fi/dali/) Dali Server against PDB90 database was used for the protein structure alignment. The alignment was visualized with the ESPript/ENDscript program (espript.ibcp.fr/ESPript/ESPript/). Protein sequences were obtained from the UniProt database (www.uniprot.org/) and aligned using Clustal Omega tool.
(95) Size Exclusion Chromatography. To determine molecular mass, NTA purified samples were subjected to size exclusion chromatography (Superdex 200 10/300 GL, GE Healthcare) equilibrated with SEC buffer (100 mM Tris pH7.5, 200 mM sodium chloride). The protein sample equilibrated in SEC buffer was applied to the column. The mass of BHT.sub.(23-594)-HIS was calculated based on the standards in the high molecular weight gel calibration kit (Cytiva Life Sciences).
(96) Small angle X-ray scattering: Data Collection and Analysis. rBHT.sub.(23-594)-HIS samples at 1 mg/ml and 4 mg/ml 5 mM in sodium phosphate buffer at pH 5 were measured on a Rigaku Bio-SAXS 2000. The instrument uses Cu K.sub. radiation (=1.54 ) and was collimated to provide a sufficient Q-range of 0.01-0.67 .sup.1. Measurements were performed at ambient temperature. Samples were measured for a total of 40 min in 5 min scans. Data were corrected for transmission and sample background. Reduction, averaging, and buffer subtraction were performed with Rigaku SAXSLab 3.1.0b14 (
7. EXAMPLES
(97) It will be readily apparent to those skilled in the art that other suitable modifications and adaptations of the methods of the present disclosure described herein are readily applicable and appreciable, and may be made using suitable equivalents without departing from the scope of the present disclosure or the aspects and embodiments disclosed herein. Having now described the present disclosure in detail, the same will be more clearly understood by reference to the following examples, which are merely intended only to illustrate some aspects and embodiments of the disclosure, and should not be viewed as limiting to the scope of the disclosure. The disclosures of all journal references, U.S. patents, and publications referred to herein are hereby incorporated by reference in their entireties.
(98) The present disclosure has multiple aspects, illustrated by the following non-limiting examples.
Example 1
(99) In silico analysis of BHT. Following translation, proteins can be altered by a variety of post-translation modifications (PTMs). This can include, for example, glycosylation and phosphorylation. The PTMs can alter protein conformation, thereby impacting stability, activity, subcellular distribution, and secretion. The crystal structure for BHT.sub.(23-594)-HIS (6M4E) has recently been solved; however, the initial portion of the novel N-terminal region (residues 23-54) was not modeled and still lacks a known structure. To achieve an accurate prediction for the BHT N-terminus structure and PTMs, comprehensive in silico predictions were conducted using different comparative methods (
Example 2
(100) Site directed mutagenesis of the predicted N-glycosylation sites within the conserved BHT GH1 domain. Glycosylation is one of the central post-translational modifications of proteins mainly occurring by binding glycans to the nitrogen atom of asparagine residues (N-linked) or to the hydroxyl oxygen of serine, threonine, or tyrosine residues (O-linked), but also by C-mannosylation, phospho-serine glycosylation and glypiation (formation of GPI anchors). N-glycosylation has been shown to influence enzymatic activity, stability, and cell surface expression as previously reviewed. Thus, extensive search and alignment analysis performed to identify BHT homologs predicted 25 potential N-linked glycosylation sites. Four of them were located within the GH1 domain with predicted highly conserved glycosylation consensus sites (Asn-X-Ser/Thr), suggesting a high probability of functionally relevant glycosylation at positions; N289LTY, N297STS, N431QSD and N569QSD (
(101) The results showed significant reductions of secreted soluble enzyme activities (90%, 95% and 97%) from three variants GS115::MF-rBht.sub.(23-594)(N431Q)-HIS, GS115::MF-rBht.sub.(23-594)(N289Q)-HIS and GS115::MF-rBht.sub.(23-594)(N297Q)-HIS when compared to non-mutated variant GS115::MF-rBht.sub.(23-594)-HIS activity, respectively. The GS115::MF-rBht.sub.(23-594)(N569Q)-HIS variant showed a less severe activity reduction of 58% compared to the GS115::MF-rBht.sub.(23-594)-HIS (
(102) TABLE-US-00001 TABLE 1 Normalized enzyme activity comparison of soluble versus membrane bound secreted protein variants. Ratio Mean values of secreted activity Secreted (mU .Math. OD.sub.600 nm) SD.sup.a Soluble/ Membrane Membrane Enzyme Source Soluble SD Bound SD Bound 1 GS115::rBht.sub.(1-594)-HIS 0.69 0.01 10.63 0.31 0.06 2 GS115::MF-rBht.sub.(1-594)-HIS ND ND 3 GS115::MF-rBht.sub.(23-594)-HIS 9.62 0.20 24.04 0.53 0.40 4 GS115::MF-rBht.sub.(23-594)(N289Q)-HIS 0.48 0.02 4.51 0.20 0.11 5 GS115::MF-rBht.sub.(23-594)(N297Q)-HIS 0.27 0.04 1.12 0.26 0.24 6 GS115::MF-rBht.sub.(23-594)(N431Q)-HIS 0.95 0.09 3.94 0.51 0.24 7 GS115::MF-rBht.sub.(23-594)(N569Q)-HIS 4.02 0.25 6.06 0.43 0.66 8 GS115::MF-rBht.sub.(32-594)-HIS 8.24 0.12 25.84 0.86 0.32 9 GS115::MF-rBht.sub.(54-594)-HIS 10.87 0.30 30.23 1.08 0.36 10 GS115::MF-rBht.sub.(57-594)-HIS 15.60 0.66 29.52 1.28 0.53 11 GS115::MF-rBht.sub.(82-594)-HIS ND ND 12 GS115::MF-rBht.sub.(95-594)-HIS ND ND 13 GS115::MF-rBht.sub.(103-594)-HIS ND ND 14 GS115::MF-rBht.sub.(111-594)-HIS ND ND 15 GS115::IV-rBht.sub.(54-594)-HIS 3.51 0.00 14.29 0.39 0.25 16 GS115::GA-rBht.sub.(54-594)-HIS 0.39 0.02 3.85 0.42 0.10 17 GS115::IN-rBht.sub.(54-594)-HIS 7.13 0.20 17.14 0.59 0.42 18 GS115::MF.sub.(57-70)-rBht.sub.(23-594)-HIS 22.96 0.54 34.11 1.18 0.67 19 GS115::MF.sub.(57-70)-rBht.sub.(57-594)-HIS 22.62 0.13 42.11 0.31 0.54 20 GS115 control ND ND .sup.aThe value of cell density (OD.sub.600 nm) reached by the recombinant strains after methanol induction was used to normalize the secreted soluble and membrane-bound activities. The maximum cell densities obtained were between 60 and 75 OD.sub.600 nm. The results are mean values for three measurements of enzyme activity and standard deviation (SD). ND indicates enzyme activity was not detected.
Example 3
(103) Expression and secretion by K. pastoris of truncated N-terminal rBHT variants. The novel BHT N-terminal 110 region lacks homology with known proteins; thus, in this region, in silico structural predictions were performed, which showed predominantly large proportions of disordered fragments using five available predictions tools (
(104) A major function of disordered regions is thought to be their ability to fold upon contact with the membrane and upon specific ligand binding. The approach of the present disclosure was to utilize this information to perform progressive and selective deletions of the predicted disordered fragments to determine if they have an impact on restricting secretion of soluble active rBHT. A schematic representation of the complete rBHT and eight rBHT-truncated variants of the enzyme generated and tested in the present disclosure are shown in
(105) To investigate for the presence of secreted soluble rBHT truncated protein variants, the medium broth was initially inspected by Coomassie stained SDS-PAGE (
(106) Most notable finding was an approximately 30 kDa mobility shift on SDS-PAGE between rBHT.sub.(32-594)-HIS and rBHT.sub.(54-594)-HIS, possibly due to the deletion of predicted phosphorylation sites and surrounding acidic residues (Y37 (LTSNYETPS), T39 (SNYETPSPT), S41 (YETPSPTAI), T43 (TPSPTAIPL), T50 (PLEPTPTAT), T52 (EPTPTATGT)) (
(107) Following the above results, the concentration of soluble proteins and activity normalized to cell concentration (OD.sub.600 nm) when assayed at 42 C. using ONP-Glu as the substrate were compared (
(108) An additional feature tested was the ability to drive secretion from predominantly membrane associated to soluble form. The secreted enzymatic activity associated with the membrane remained constant for rBHT.sub.(23-594)-HIS, rBHT.sub.(32-594)-HIS and rBHT.sub.(54-594)-HIS and rBHT.sub.(57-594)-HIS and no significant differences in ratio of soluble secreted versus membrane associated enzyme activity were observed for variants rBHT.sub.(23-594)-HIS, rBHT.sub.(32-594)-HIS and rBHT.sub.(54-594)-HIS. However, while the activity found associated with the membrane remained relatively constant, rBHT.sub.(57-594)-HIS variant's ratio of secreted versus membrane associated enzyme activity increased between 25 to 38% (Table 1) when compared to variants rBHT.sub.(23-594)-HIS, rBHT.sub.(32-594)-HIS and rBHT.sub.(54-594)-HIS. To further evaluate whether bioactive rBHT.sub.(82-594)-HIS, rBHT.sub.(95-594)-HIS and rBHT.sub.(103-594)-HIS variants, albeit in low amounts, were produced and secreted, inductions of the corresponding cell lines were performed, and culture broth was concentrated 100-fold followed by affinity chromatography with nickel resin. Yet, no protein could be eluted and/or activity was detected from either soluble or cell associated rBHT from those deletion variants (data not shown but can be made available upon request). The results of the activity assays indicated that amino acid residues 1 to 56 were not required for expression and secretion of active enzyme. This finding is consistent with SDS-PAGE and Western blot data (
Example 4
(109) Evaluation of alternative signal sequences. Testing alternative signal sequences other than the popularly used MF seemed daunting considering the ever-increasing choices. Thus, chimeras were generated merging the rBht.sub.(54-594) variant to signal sequences from the following open reading frames (ORF): Glucoamylase (GA), Invertase (IV), and Inulinase (IN). Under the experimental conditions, the results showed lower amounts of soluble, and membrane associated active protein compared to the MF signal sequence routinely used throughout this the present disclosure (Table 1). Therefore, it was decided to concentrate the investigation on MF. It has previously been shown that deletion of amino acids 57-70 of MF pro region enhances secretion of reporter proteins by at least 50%. A 58% and 31% increase in secretion of soluble enzyme was obtained by removing amino acids 57-70 from MF for expression GS115::MF.sub.(57-70)-rBht.sub.(23-594)-HIS and GS115::MF.sub.(57-70)-rBht.sub.(57-594)-HIS variants compared to expression from GS115::MF-rBht.sub.(23-594)-HIS and GS115::MF-rBht.sub.(57-594)-HIS, respectively (Table 1).
(110) It was inferred from these experiments that maintaining BHT amino acids 57-110 from the BHT N-terminal domain was necessary for enzymatic activity, secretion, and stability. These findings also underline an unbalanced secretion of soluble versus cell associated rBHT, with the balance shifting to the active soluble secreted form either when 56 amino terminal amino acids are deleted or when the MF signal sequence is altered (Table 1).
(111) Kinetic parameters of secreted soluble rBHT variants. After purification to homogeneity using a carboxy 6Histidine epitope and Nickel affinity chromatography purification, active soluble secreted rBHT variants were functionally characterized by standard kinetic assays. SDS-PAGE separation followed by detection using anti-HIS monoclonal antibody under reducing conditions indicated that the isolated proteins were essentially homogeneous (
Example 5
(112) Production of N-acetyllactosamine (LacNAc). As shown in
(113) The data provided herein provide an efficient solution to generate LacNAc at cost-competitive industrial scale. The capability of rBHT polypeptides of the present disclosure to synthesize LacNAc using lactose as a donor and N-acetylglucosamine as acceptor was demonstrated (
Example 6
(114) Sequence and Structural BHT homologs. Beta-glucosidases GH1 family members consist of a single domain with (a/0).sub.8 TIM barrel topology in the CaZy classification (www.cazy.org/GH1_characterized.html). However, BHT folds into two domains (
(115) Aside from Phanerochaete chrysosporium BGL1A (PDB: 2B3Z-A), the list includes Beta-glucosidase from Trichoderma reesei (PDB: 3AHY-B), Beta-1,4-Glucosidase from Trichoderma harzianum (PDB:5BWF-A), Beta-Glucosidase from Humicola insolens (PDB: 4MDO-A) and Beta-Glucosidase from Trichoderma harzianum (PDB:5JBO-A). Primary sequence alignment of these top 5 structures with the rBHT.sub.(23-594)-HIS shows that, while the core GH1 structure is shared, its N-terminus is distinct and unique (
(116) The CaZy database indicates that GenBank contains over 40,000 GH1 proteins and over 270 PDB structures are available. The GH1 protein sequences from the RCSB PDB database (rcsb.org) were extracted using SANSparallel (ekhidna2.biocenter.helsinki.fi/cgi-bin/sans/sans.cgi) and aligned with the Clustal Omega program. The amino acid sequence of 60 GH1 genes structurally homologous to the C-terminal domain of BHT and with Z scores above 40 showed 60% sequence identity with each other and 27-33% identity to BHT and no matches to the N-terminus. Additionally, Blast analysis of the N-terminal domain amino acid sequence did not locate a match. From this sequence and structure comparison data, it was concluded that the structure of the BHT N-terminus found in the 6M4E structure is novel to the GH1 proteins and does not presently have a close structural homolog in the PDB database.
(117) TABLE-US-00002 TABLE 2 Protein structural similarity results using Dali server. Accession Z- Identity RMSD Protein/ No. number score (%).sup.b .sup.c Superimposed.sup.d Organism Reference 1 2E3Z-A 49.3 34 1.3 450 from 460 Beta-Glucosidase Nijikken, et al. (BGL1A) from 2007 Phanerochaete chrysosporium 2 3AHY-B 48.1 32 1.7 458 from 466 Beta-Glucosidase Jeng, et al. 2011 (TrBg12) from Trichoderma reesei 3 5BWF-A 47.7 32 1.6 458 from 471 Beta-1,4- Santos, et al. 2016 Glucosidase (ThBg1) from Trichoderma harzianum 4 4MDO-A 47.3 33 1.7 461 from 477 Beta-Glucosidase de Giuseppe, et al. (HiBG) from 2014 Humicola insolens 5 5JBO-A 46.8 31 1.7 459 from 475 Beta-Glucosidase Florindo, et al. (ThBg12) from 2018 Trichoderma harzianum Monomeric HsBg1A(23-594)-HIS (PDB: 6M4E) was used as the query. The top 5 closest structures from the PDB90 database results are shown. Z-score used to select top 5 similar structures. .sup.bSequence identity. .sup.cAverage distance between superimposed residues. .sup.dNumber of superimposed residues from total residues.
Example 7
(118) Influence of N-terminal deletions on rBHT dimerization. rBHT.sub.(23-594)-HIS exists as a dimeric form in solution as determined by size exclusion chromatography (SEC) column packed with Sephacryl S-200 that showed rBHT.sub.(23-594)-HIS eluted as a single peak having a retention time of 12.5 min with calculated M. 150 kDa corresponding the dimeric state (data not shown but can be made available upon request). The dimer conformation was further validated in solution by small X-ray scattering (SAXS) (
(119) TABLE-US-00003 TABLE 3 Solution scattering parameters zero-angle intensity I.sub.0, radius of gyration R.sub.g, and maximum dimension D.sub.max and SAXS-calculated molecular weight for BHT at 1 mg/ml and 4 mg/ml. Sample (concentration) I.sub.0 (arbitrary unit) R.sub.g () D.sub.max () Mass (Da) rBHT.sub.(23-594)-HIS (1 mg/ml) 5.07 0.02 39.07 0.15 124 169400 1600 rBHT.sub.(23-594)-HIS (4 mg/ml) 20.27 0.05 38.29 0.08 125 169300 900
8. SEQUENCES
(120) Sequences relevant to the various embodiments of the present disclosure are provided in the tables below.
(121) TABLE-US-00004 TABLE 4A Sequence information. Size HIS SEQ ID NO: Name aMF amino acid tag 1 protein -hexosyl transferase (BHT; GenBank: no 594 no F298281.1) 2 DNA -hexosyl transferase (BHT; GenBank: no no F298281.1) 3 protein Synthetic -hexosyl transferase (23-594) no 572 no 4 DNA Synthetic -hexosyl transferase (23-594) no no 5 protein Synthetic -hexosyl transferase (32-594) no 563 no 6 DNA Synthetic -hexosyl transferase (32-594) no no 7 protein Synthetic -hexosyl transferase (54-594) no 541 no 8 DNA Synthetic -hexosyl transferase (54-594) no no 9 protein Synthetic -hexosyl transferase (57-594) no 538 no 10 DNA Synthetic -hexosyl transferase (57-594) no no 11 protein Synthetic -hexosyl transferase (82-594) no 513 no 12 DNA Synthetic -hexosyl transferase (82-594) no no 13 protein Synthetic -hexosyl transferase (95-594) no 500 no 14 DNA Synthetic -hexosyl transferase (95-594) no no 15 protein Synthetic -hexosyl transferase (103-594) no 492 no 16 DNA Synthetic -hexosyl transferase (103-594) no no 17 protein Synthetic -hexosyl transferase (111-594) no 484 no 18 DNA Synthetic -hexosyl transferase (111-594) no no 19 protein Synthetic -hexosyl transferase (23-594) no 572 no (N289Q) 20 DNA Synthetic -hexosyl transferase (23-594) no no (N289Q) 21 protein Synthetic -hexosyl transferase (23-594) no 572 no (N297Q) 22 DNA Synthetic -hexosyl transferase (23-594) no no (N297Q) 23 protein Synthetic -hexosyl transferase (23-594) no 572 no (N431Q) 24 DNA Synthetic -hexosyl transferase (23-594) no no (N431Q) 25 protein Synthetic -hexosyl transferase (23-594) no 572 no (N569Q) 26 DNA Synthetic -hexosyl transferase (23-594) no no (N569Q) 27 protein -mating factor signal sequence from yes 89 no Saccharomyces cerevisiae(MF) 28 DNA -mating factor signal sequence from yes no Saccharomyces cerevisiae(MF) 29 protein -mating factor signal sequence from Partial 67 no Saccharomyces cerevisiae (MF) (57-70) 30 protein Invertase (IV) signal sequence no 19 no 31 protein Glucoamylase (GA) signal sequence no 8 no 32 protein Inulinase (IN) signal sequence no 15 no 33 DNA MF-rBht(1-594)-HIS (nucleic acid) yes yes 34 protein MF-rBht(1-594)-HIS (protein) yes 689 yes 35 DNA rBht(1-594)-HIS (nucleic acid) no yes 36 protein rBht(1-594)-HIS (protein) no 600 yes 37 DNA MF-rBht(23-594)-HIS (nucleic acid) yes yes 38 protein MF-rBht(23-594)-HIS (protein) yes 667 yes 39 DNA MF-rBht(23-594)(N289Q)-HIS (nucleic yes yes acid) 40 protein MF-rBht(23-594)(N289Q)-HIS (protein) yes 667 yes 41 DNA MF-rBht(23-594)(N297Q)-HIS (nucleic yes yes acid) 42 protein MF-rBht(23-594)(N297Q)-HIS (protein) yes 667 yes 43 DNA MF-rBht(23-594)(N431Q)-HIS (nucleic yes yes acid) 44 protein MF-rBht(23-594)(N431Q)-HIS (protein) yes 667 yes 45 DNA MF-rBht(23-594)(N569Q)-HIS (nucleic yes yes acid) 46 protein MF-rBht(23-594)(N569Q)-HIS (protein) yes 667 yes 47 DNA MF-rBht(32-594)-HIS (nucleic acid) yes yes 48 protein MF-rBht(32-594)-HIS (protein) yes 658 yes 49 DNA MF-rBht(54-594)-HIS (nucleic acid) yes yes 50 protein MF-rBht(54-594)-HIS (protein) yes 636 yes 51 DNA MF-rBht(57-594)-HIS (nucleic acid) yes yes 52 protein MF-rBht(57-594)-HIS (protein) yes 633 yes 53 DNA MF-rBht(82-594)-HIS (nucleic acid) yes yes 54 protein MF-rBht(82-594)-HIS (protein) yes 608 yes 55 DNA MF-rBht(95-594)-HIS (nucleic acid) yes yes 56 protein MF-rBht(95-594)-HIS (protein) yes 595 yes 57 DNA MF-rBht(103-594)-HIS (nucleic acid) yes yes 58 protein MF-rBht(103-594)-HIS (protein) yes 587 yes 59 DNA MF-rBht(111-594)-HIS (nucleic acid) yes yes 60 protein MF-rBht(111-594)-HIS (protein) yes 584 yes 61 DNA IV-rBht(54-594)-HIS (nucleic acid) no yes 62 protein IV-rBht(54-594)-HIS (protein) no 566 yes 63 DNA GA-rBht(54-594)-HIS (nucleic acid) no yes 64 protein GA-rBht(54-594)-HIS (protein) no 565 yes 65 DNA IN-rBht(54-594)-HIS (nucleic acid) no yes 66 protein IN-rBht(54-594)-HIS (protein) no 563 yes 67 DNA MF(57-70)-rBht(23-594)-HIS (nucleic yes yes acid) 68 protein MF(57-70)-rBht(23-594)-HIS (protein) yes 653 yes 69 DNA MF(57-70)-rBht(57-594)-HIS (nucleic yes yes acid) 70 protein MF(57-70)-rBht(57-594)-HIS (protein) yes 619 yes
(122) TABLE-US-00005 TABLE5 Sequences. SEQID NO: Name Sequence 1 -hexosyl MMLHAALLVALPCVVLARPAGAVTYPGAIPLSLTSNYETPSPTAI transferase PLEPTPTATGTAELDALWNLVEAQYPVQTAAVTTLVTVPDDYKF BHT; EADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEG GenBank: RGPSTWDYLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLG F298281.1) INTYSFSISWTRIYPLGAGYVNEAGLAHYDAVIHSAKKYGLEPVG TVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNE VKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLK AHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEES AKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGY IKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDPNWPVCEEGSDP FAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGI YFSEFGWAEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHK DGINLRGALTWSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTF KLSAHAYAQFGRNHL 2 -hexosyl atgatgctgcatgctgcactgctagtagcgctgccatgtgttgttttggcgcgcccggccggagcggtta transferase cttatccgggagccattcctctgtccctgacgagcaattacgaaaccccaagtccgacagcaatcccgct (BHT; ggagccaacaccgacggctaccggtacagcagaattagatgcgctgtggaacttagtcgaagctcag GenBank: tacccagttcaaactgctgcagtgacaactttggtgacagtgcccgatgattataagtttgaggcagatc F298281.1) caccgagttatgcattagcagggtatgaaacaagcgagattgccggactgaagtttccaaaggggttta agtttggtgttgcgggggcagccattcaagttgaaggtgcagcaaaagccgaagggcggggcccaa gtacctgggattatctgtgtcatcactatgccagcacgcagtgtaacaattatgatcccgatattacaacc aaccattactacctgtacccattggactttgcgcgcctgcaacacctaggcattaacacttactcgttttca atttcatggacgcgtatttatccattgggcgcaggctatgttaatgaagcagggttagcccactatgatgc cgtaatccatagtgccaagaagtatggtctggaaccagtgggcaccgtttttcactgggatacgccact gtctctgatgctgaaatacggtgcctggcaagatactggtgaccaaattgttaaggactttgttacctatg ccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttcaatgaaccacgggttttct gttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtattaacagcacctccgctgtattt cgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcgggatctagttgcctccgg gaccattgcggcaggtgaaatcggctttaaatccgatgataactacccaatcccggcccgtccagggaa cgccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgggatttttgcgcaaccggtttat ggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctgccggccctgacggatgaa gataaaggatacattaaaggtagcggagatatttttgcgattgacgggtatcgtaccgatatttcccatgc ggctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattggccagtgtgtgaagaag ggtcagatccttttgctcatgtttacccatccgggtttgctattggtcaatcagccgatccactgtcttcatg gttagtcaactcagccccgtttatccgcgatcaactgaagtttctgacacaaacctaccctgctaagggt ggtatttatttctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctgtatcaaattacct gggatggtctgcgtacgcaatacctgacggactatctgagccagctgctgttggctgtgcacaaagac gggattaatctgcgaggcgcgctgacgtggagttttgtcgataattgggagtggggtttagggatgcaa cagaaattcggatttcagtttgttaatcaatcagatcccgatctgacacgcacgtttaaactgagcgctca cgcttacgcccaatttgggcgtaatcatctg 3 Synthetic- VTYPGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEA hexosyl QYPVQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPK transferase GFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYD (23-594) PDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEA GLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTG DQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYN LTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEI GFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYP DVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNG IANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLV NSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQIT WDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGL GMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHL 4 Synthetic- gttacttatccgggagccattcctctgtccctgacgagcaattacgaaaccccaagtccgacagcaatcc hexosyl cgctggagccaacaccgacggctaccggtacagcagaattagatgcgctgtggaacttagtcgaagct transferase cagtacccagttcaaactgctgcagtgacaactttggtgacagtgcccgatgattataagtttgaggcaga (23-594) tccaccgagttatgcattagcagggtatgaaacaagcgagattgccggactgaagtttccaaaggggttt aagtttggtgttgcgggggcagccattcaagttgaaggtgcagcaaaagccgaagggcggggcccaa gtacctgggattatctgtgtcatcactatgccagcacgcagtgtaacaattatgatcccgatattacaacca accattactacctgtacccattggactttgcgcgcctgcaacacctaggcattaacacttactcgttttcaat ttcatggacgcgtatttatccattgggcgcaggctatgttaatgaagcagggttagcccactatgatgccg taatccatagtgccaagaagtatggtctggaaccagtgggcaccgtttttcactgggatacgccactgtct ctgatgctgaaatacggtgcctggcaagatactggtgaccaaattgttaaggactttgttacctatgccac aactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttcaatgaaccacgggttttctgttcac aaaatagtggtctgccatacaatctgacgtatccagaaggtattaacagcacctccgctgtatttcgttgca cctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcgggatctagttgcctccgggaccattg cggcaggtgaaatcggctttaaatccgatgataactacccaatcccggcccgtccagggaacgccgat gacgaggaatcagccaagcgtcacgaggcttttcgcattgggatttttgcgcaaccggtttatggtaatg gcgattatccagatgttgttaaagaaactgttggagatatgctgccggccctgacggatgaagataaagg atacattaaaggtagcggagatatttttgcgattgacgggtatcgtaccgatatttcccatgcggctctgaa cgggatcgcgaattgtattcgcaaccaaagtgacccgaattggccagtgtgtgaagaagggtcagatcc ttttgctcatgtttacccatccgggtttgctattggtcaatcagccgatccactgtcttcatggttagtcaactc agccccgtttatccgcgatcaactgaagtttctgacacaaacctaccctgctaagggtggtatttatttctcg gaatttggttgggctgaagacgccgaatatgatcgtcaactgctgtatcaaattacctgggatggtctgcg tacgcaatacctgacggactatctgagccagctgctgttggctgtgcacaaagacgggattaatctgcga ggcgcgctgacgtggagttttgtcgataattgggagtggggtttagggatgcaacagaaattcggatttc agtttgttaatcaatcagatcccgatctgacacgcacgtttaaactgagcgctcacgcttacgcccaatttg ggcgtaatcatctg 5 Synthetic- SLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYPVQTAA hexosyl VTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAG transferase AAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDITTNHY (32-594) YLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDA VIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDF VTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGIN STSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDN YPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPDVVKETV GDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRN QSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIR DQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITWDGLRT QYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGMQQK FGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHL 6 Synthetic- tccctgacgagcaattacgaaaccccaagtccgacagcaatcccgctggagccaacaccgacggcta hexosyl ccggtacagcagaattagatgcgctgtggaacttagtcgaagctcagtacccagttcaaactgctgcagt transferase gacaactttggtgacagtgcccgatgattataagtttgaggcagatccaccgagttatgcattagcagggt (32-594) atgaaacaagcgagattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagcca ttcaagttgaaggtgcagcaaaagccgaagggcggggcccaagtacctgggattatctgtgtcatcact atgccagcacgcagtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattggact ttgcgcgcctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccattggg cgcaggctatgttaatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtatggt ctggaaccagtgggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggc aagatactggtgaccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatga agtcaagacgtggtttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctg acgtatccagaaggtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggt catgctgttaaagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatc cgatgataactacccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcac gaggcttttcgcattgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaa ctgttggagatatgctgccggccctgacggatgaagataaaggatacattaaaggtagcggagatattttt gcgattgacgggtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaacc aaagtgacccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggttt gctattggtcaatcagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactg aagtttctgacacaaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagacgcc gaatatgatcgtcaactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggactatct gagccagctgctgttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgt cgataattgggagtggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccg atctgacacgcacgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctg 7 Synthetic- TGTAELDALWNLVEAQYPVQTAAVTTLVTVPDDYKFEADPPSY hexosyl ALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPSTW transferase DYLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFS (54-594) ISWTRIYPLGAGYVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWD TPLSLMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWFT FNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAV KVYRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRHEA FRIGIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKGSGDI FAIDGYRTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAHVYP SGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFG WAEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINL RGALTWSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLSAH AYAQFGRNHL 8 Synthetic- accggtacagcagaattagatgcgctgtggaacttagtcgaagctcagtacccagttcaaactgctgca hexosyl gtgacaactttggtgacagtgcccgatgattataagtttgaggcagatccaccgagttatgcattagcagg transferase gtatgaaacaagcgagattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagc (54-594) cattcaagttgaaggtgcagcaaaagccgaagggcggggcccaagtacctgggattatctgtgtcatca ctatgccagcacgcagtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattgga ctttgcgcgcctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccattgg gcgcaggctatgttaatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtatgg tctggaaccagtgggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggc aagatactggtgaccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatga agtcaagacgtggtttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctg acgtatccagaaggtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggt catgctgttaaagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatc cgatgataactacccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcac gaggcttttcgcattgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaa ctgttggagatatgctgccggccctgacggatgaagataaaggatacattaaaggtagcggagatattttt gcgattgacgggtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaacc aaagtgacccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggttt gctattggtcaatcagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactg aagtttctgacacaaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagacgcc gaatatgatcgtcaactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggactatct gagccagctgctgttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgt cgataattgggagtggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccg atctgacacgcacgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctg 9 Synthetic- AELDALWNLVEAQYPVQTAAVTTLVTVPDDYKFEADPPSYALA hexosyl GYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPSTWDYL transferase CHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISW (57-594) TRIYPLGAGYVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPL SLMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWFTFNE PRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKV YRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRHEAFRI GIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAI DGYRTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAHVYPSGF AIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGWA EDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGA LTWSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLSAHAYA QFGRNHL 10 Synthetic- gcagaattagatgcgctgtggaacttagtcgaagctcagtacccagttcaaactgctgcagtgacaacttt hexosyl ggtgacagtgcccgatgattataagtttgaggcagatccaccgagttatgcattagcagggtatgaaaca transferase agcgagattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagccattcaagttg (57-594) aaggtgcagcaaaagccgaagggcggggcccaagtacctgggattatctgtgtcatcactatgccagc acgcagtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattggactttgcgcgc ctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccattgggcgcaggct atgttaatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtatggtctggaacc agtgggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggcaagatactg gtgaccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatgaagtcaagac gtggtttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctgacgtatcca gaaggtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggtcatgctgtta aagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatccgatgataa ctacccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcacgaggcttttc gcattgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaactgttggag atatgctgccggccctgacggatgaagataaaggatacattaaaggtagcggagatatttttgcgattga cgggtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaaccaaagtgac ccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggtttgctattggtc aatcagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactgaagtttctga cacaaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagacgccgaatatgatc gtcaactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggactatctgagccagctg ctgttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgtcgataattggg agtggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccgatctgacacgc acgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctg 11 Synthetic- TVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQV hexosyl EGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDITTNHYYLYPL transferase DFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAVIHSA (82-594) KKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYAT TVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTSAV FRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPIPA RPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDML PALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDPN WPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLKF LTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITWDGLRTQYLTD YLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGMQQKFGFQFV NQSDPDLTRTFKLSAHAYAQFGRNHL 12 Synthetic- acagtgcccgatgattataagtttgaggcagatccaccgagttatgcattagcagggtatgaaacaagcg hexosyl agattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagccattcaagttgaagg transferase tgcagcaaaagccgaagggggggcccaagtacctgggattatctgtgtcatcactatgccagcacgc (82-594) agtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattggactttgcgcgcctgc aacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccattgggcgcaggctatgtt aatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtatggtctggaaccagtg ggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggcaagatactggtga ccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtgg tttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctgacgtatccagaag gtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagt gtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatccgatgataactac ccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcacgaggcttttcgca ttgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaactgttggagatat gctgccggccctgacggatgaagataaaggatacattaaaggtagcggagatatttttgcgattgacgg gtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccg aattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggtttgctattggtcaat cagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactgaagtttctgacac aaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagacgccgaatatgatcgtc aactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggactatctgagccagctgctg ttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgtcgataattgggagt ggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccgatctgacacgcacg tttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctg 13 Synthetic- SYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPST hexosyl WDYLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYS transferase FSISWTRIYPLGAGYVNEAGLAHYDAVIHSAKKYGLEPVGTVFH (95-594) WDTPLSLMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKT WFTFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHG HAVKVYRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKR HEAFRIGIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKG SGDIFAIDGYRTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAH VYPSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFS EFGWAEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGI NLRGALTWSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLS AHAYAQFGRNHL 14 Synthetic- agttatgcattagcagggtatgaaacaagcgagattgccggactgaagtttccaaaggggtttaagtttg hexosyl gtgttgcgggggcagccattcaagttgaaggtgcagcaaaagccgaagggcggggcccaagtacctg transferase ggattatctgtgtcatcactatgccagcacgcagtgtaacaattatgatcccgatattacaaccaaccatta (95-594) ctacctgtacccattggactttgcgcgcctgcaacacctaggcattaacacttactcgttttcaatttcatgg acgcgtatttatccattgggcgcaggctatgttaatgaagcagggttagcccactatgatgccgtaatcca tagtgccaagaagtatggtctggaaccagtgggcaccgtttttcactgggatacgccactgtctctgatgc tgaaatacggtgcctggcaagatactggtgaccaaattgttaaggactttgttacctatgccacaactgtgt ttaagcgttatggtaatgaagtcaagacgtggtttactttcaatgaaccacgggttttctgttcacaaaatag tggtctgccatacaatctgacgtatccagaaggtattaacagcacctccgctgtatttcgttgcacctacaa tgttctgaaagctcatggtcatgctgttaaagtgtatcgggatctagttgcctccgggaccattgcggcag gtgaaatcggctttaaatccgatgataactacccaatcccggcccgtccagggaacgccgatgacgag gaatcagccaagcgtcacgaggcttttcgcattgggatttttgcgcaaccggtttatggtaatggcgattat ccagatgttgttaaagaaactgttggagatatgctgccggccctgacggatgaagataaaggatacatta aaggtagcggagatatttttgcgattgacgggtatcgtaccgatatttcccatgcggctctgaacgggatc gcgaattgtattcgcaaccaaagtgacccgaattggccagtgtgtgaagaagggtcagatccttttgctc atgtttacccatccgggtttgctattggtcaatcagccgatccactgtcttcatggttagtcaactcagcccc gtttatccgcgatcaactgaagtttctgacacaaacctaccctgctaagggtggtatttatttctcggaatttg gttgggctgaagacgccgaatatgatcgtcaactgctgtatcaaattacctgggatggtctgcgtacgca atacctgacggactatctgagccagctgctgttggctgtgcacaaagacgggattaatctgcgaggcgc gctgacgtggagttttgtcgataattgggagtggggtttagggatgcaacagaaattcggatttcagtttgt taatcaatcagatcccgatctgacacgcacgtttaaactgagcgctcacgcttacgcccaatttgggcgta atcatctg 15 Synthetic- TSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHH hexosyl YASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIY transferase PLGAGYVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLM (103-594) LKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRV FCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRD LVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRHEAFRIGIF AQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAIDG YRTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAI GQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAED AEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALT WSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQF GRNHL 16 Synthetic- acaagcgagattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagccattcaa hexosyl gttgaaggtgcagcaaaagccgaagggcggggcccaagtacctgggattatctgtgtcatcactatgcc transferase agcacgcagtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattggactttgcg (103-594) cgcctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccattgggcgcag gctatgttaatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtatggtctgga accagtgggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggcaagat actggtgaccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatgaagtca agacgtggtttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctgacgta tccagaaggtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggtcatgct gttaaagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatccgatga taactacccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcacgaggct tttcgcattgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaactgttgg agatatgctgccggccctgacggatgaagataaaggatacattaaaggtagcggagatatttttgcgatt gacgggtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaaccaaagtg acccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggtttgctattg gtcaatcagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactgaagtttct gacacaaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagacgccgaatatg atcgtcaactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggactatctgagccag ctgctgttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgtcgataattg ggagtggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccgatctgacac gcacgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctg 17 Synthetic- FPKGFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCN hexosyl NYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYV transferase NEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQ (111-594) DTGDQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGL PYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIA AGEIGFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGN GDYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHA ALNGIANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSS WLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLL YQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNW EWGLGMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHL 18 Synthetic- tttccaaaggggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgcagcaaaagccgaa hexosyl gggcggggcccaagtacctgggattatctgtgtcatcactatgccagcacgcagtgtaacaattatgatc transferase ccgatattacaaccaaccattactacctgtacccattggactttgcgcgcctgcaacacctaggcattaac (111-594) acttactcgttttcaatttcatggacgcgtatttatccattgggcgcaggctatgttaatgaagcagggttag cccactatgatgccgtaatccatagtgccaagaagtatggtctggaaccagtgggcaccgtttttcactgg gatacgccactgtctctgatgctgaaatacggtgcctggcaagatactggtgaccaaattgttaaggactt tgttacctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttcaatgaacca cgggttttctgttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtattaacagcacctcc gctgtatttcgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcgggatctagttgc ctccgggaccattgcggcaggtgaaatcggctttaaatccgatgataactacccaatcccggcccgtcc agggaacgccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgggatttttgcgcaacc ggtttatggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctgccggccctgacgg atgaagataaaggatacattaaaggtagcggagatatttttgcgattgacgggtatcgtaccgatatttccc atgcggctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattggccagtgtgtgaag aagggtcagatccttttgctcatgtttacccatccgggtttgctattggtcaatcagccgatccactgtcttca tggttagtcaactcagccccgtttatccgcgatcaactgaagtttctgacacaaacctaccctgctaaggg tggtatttatttctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctgtatcaaattacct gggatggtctgcgtacgcaatacctgacggactatctgagccagctgctgttggctgtgcacaaagacg ggattaatctgcgaggcgcgctgacgtggagttttgtcgataattgggagtggggtttagggatgcaaca gaaattcggatttcagtttgttaatcaatcagatcccgatctgacacgcacgtttaaactgagcgctcacgc ttacgcccaatttgggcgtaatcatctg 19 Synthetic- VTYPGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEA hexosyl QYPVQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPK transferase GFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYD (23-594) PDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEA (N289Q) GLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTG DQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYQ LTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEI GFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYP DVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNG IANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLV NSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQIT WDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGL GMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHL 20 Synthetic- GTTACTTATCCGGGAGCCATTCCTCTGTCCCTGACGAGCAATT hexosyl ACGAAACCCCAAGTCCGACAGCAATCCCGCTGGAGCCAACAC transferase CGACGGCTACCGGTACAGCAGAATTAGATGCGCTGTGGAACTT (23-594) AGTCGAAGCTCAGTACCCAGTTCAAACTGCTGCAGTGACAACT (N289Q) TTGGTGACAGTGCCCGATGATTATAAGTTTGAGGCAGATCCAC CGAGTTATGCATTAGCAGGGTATGAAACAAGCGAGATTGCCG GACTGAAGTTTCCAAAGGGGTTTAAGTTTGGTGTTGCGGGGGC AGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAAGGGCGGGG CCCAAGTACCTGGGATTATCTGTGTCATCACTATGCCAGCACG CAGTGTAACAATTATGATCCCGATATTACAACCAACCATTACT ACCTGTACCCATTGGACTTTGCGCGCCTGCAACACCTAGGCAT TAACACTTACTCGTTTTCAATTTCATGGACGCGTATTTATCCAT TGGGCGCAGGCTATGTTAATGAAGCAGGGTTAGCCCACTATGA TGCCGTAATCCATAGTGCCAAGAAGTATGGTCTGGAACCAGTG GGCACCGTTTTTCACTGGGATACGCCACTGTCTCTGATGCTGA AATACGGTGCCTGGCAAGATACTGGTGACCAAATTGTTAAGG ACTTTGTTACCTATGCCACAACTGTGTTTAAGCGTTATGGTAAT GAAGTCAAGACGTGGTTTACTTTCAATGAACCACGGGTTTTCT GTTCACAAAATAGTGGTCTGCCATACCAGCTTACGTATCCAGA AGGTATTAACAGCACCTCCGCTGTATTTCGTTGCACCTACAAT GTTCTGAAAGCTCATGGTCATGCTGTTAAAGTGTATCGGGATC TAGTTGCCTCCGGGACCATTGCGGCAGGTGAAATCGGCTTTAA ATCCGATGATAACTACCCAATCCCGGCCCGTCCAGGGAACGCC GATGACGAGGAATCAGCCAAGCGTCACGAGGCTTTTCGCATTG GGATTTTTGCGCAACCGGTTTATGGTAATGGCGATTATCCAGA TGTTGTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTGACG GATGAAGATAAAGGATACATTAAAGGTAGCGGAGATATTTTT GCGATTGACGGGTATCGTACCGATATTTCCCATGCGGCTCTGA ACGGGATCGCGAATTGTATTCGCAACCAAAGTGACCCGAATTG GCCAGTGTGTGAAGAAGGGTCAGATCCTTTTGCTCATGTTTAC CCATCCGGGTTTGCTATTGGTCAATCAGCCGATCCACTGTCTTC ATGGTTAGTCAACTCAGCCCCGTTTATCCGCGATCAACTGAAG TTTCTGACACAAACCTACCCTGCTAAGGGTGGTATTTATTTCTC GGAATTTGGTTGGGCTGAAGACGCCGAATATGATCGTCAACTG CTGTATCAAATTACCTGGGATGGTCTGCGTACGCAATACCTGA CGGACTATCTGAGCCAGCTGCTGTTGGCTGTGCACAAAGACGG GATTAATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGATAAT TGGGAGTGGGGTTTAGGGATGCAACAGAAATTCGGATTTCAGT TTGTTAATCAATCAGATCCCGATCTGACACGCACGTTTAAACT GAGCGCTCACGCTTACGCCCAATTTGGGCGTAATCATCTG 21 Synthetic- VTYPGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEA hexosyl QYPVQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPK transferase GFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYD (23-594) PDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEA (N297Q) GLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTG DQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYN LTYPEGIQSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEI GFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYP DVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNG IANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLV NSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQIT WDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGL GMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHL 22 Synthetic- GTTACTTATCCGGGAGCCATTCCTCTGTCCCTGACGAGCAATT hexosyl ACGAAACCCCAAGTCCGACAGCAATCCCGCTGGAGCCAACAC transferase CGACGGCTACCGGTACAGCAGAATTAGATGCGCTGTGGAACTT (23-594) AGTCGAAGCTCAGTACCCAGTTCAAACTGCTGCAGTGACAACT (N297Q) TTGGTGACAGTGCCCGATGATTATAAGTTTGAGGCAGATCCAC CGAGTTATGCATTAGCAGGGTATGAAACAAGCGAGATTGCCG GACTGAAGTTTCCAAAGGGGTTTAAGTTTGGTGTTGCGGGGGC AGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAAGGGCGGGG CCCAAGTACCTGGGATTATCTGTGTCATCACTATGCCAGCACG CAGTGTAACAATTATGATCCCGATATTACAACCAACCATTACT ACCTGTACCCATTGGACTTTGCGCGCCTGCAACACCTAGGCAT TAACACTTACTCGTTTTCAATTTCATGGACGCGTATTTATCCAT TGGGCGCAGGCTATGTTAATGAAGCAGGGTTAGCCCACTATGA TGCCGTAATCCATAGTGCCAAGAAGTATGGTCTGGAACCAGTG GGCACCGTTTTTCACTGGGATACGCCACTGTCTCTGATGCTGA AATACGGTGCCTGGCAAGATACTGGTGACCAAATTGTTAAGG ACTTTGTTACCTATGCCACAACTGTGTTTAAGCGTTATGGTAAT GAAGTCAAGACGTGGTTTACTTTCAATGAACCACGGGTTTTCT GTTCACAAAATAGTGGTCTGCCATACAATCTGACGTATCCAGA AGGGATCCAGAGCACCTCCGCTGTATTTCGTTGCACCTACAAT GTTCTGAAAGCTCATGGTCATGCTGTTAAAGTGTATCGGGATC TAGTTGCCTCCGGGACCATTGCGGCAGGTGAAATCGGCTTTAA ATCCGATGATAACTACCCAATCCCGGCCCGTCCAGGGAACGCC GATGACGAGGAATCAGCCAAGCGTCACGAGGCTTTTCGCATTG GGATTTTTGCGCAACCGGTTTATGGTAATGGCGATTATCCAGA TGTTGTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTGACG GATGAAGATAAAGGATACATTAAAGGTAGCGGAGATATTTTT GCGATTGACGGGTATCGTACCGATATTTCCCATGCGGCTCTGA ACGGGATCGCGAATTGTATTCGCAACCAAAGTGACCCGAATTG GCCAGTGTGTGAAGAAGGGTCAGATCCTTTTGCTCATGTTTAC CCATCCGGGTTTGCTATTGGTCAATCAGCCGATCCACTGTCTTC ATGGTTAGTCAACTCAGCCCCGTTTATCCGCGATCAACTGAAG TTTCTGACACAAACCTACCCTGCTAAGGGTGGTATTTATTTCTC GGAATTTGGTTGGGCTGAAGACGCCGAATATGATCGTCAACTG CTGTATCAAATTACCTGGGATGGTCTGCGTACGCAATACCTGA CGGACTATCTGAGCCAGCTGCTGTTGGCTGTGCACAAAGACGG GATTAATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGATAAT TGGGAGTGGGGTTTAGGGATGCAACAGAAATTCGGATTTCAGT TTGTTAATCAATCAGATCCCGATCTGACACGCACGTTTAAACT GAGCGCTCACGCTTACGCCCAATTTGGGCGTAATCATCTG 23 Synthetic- VTYPGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEA hexosyl QYPVQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPK transferase GFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYD (23-594) PDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEA (N431Q) GLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTG DQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYN LTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEI GFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYP DVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAAL NGIANCIRQQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSW LVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQ ITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEW GLGMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHL 24 Synthetic- GTTACTTATCCGGGAGCCATTCCTCTGTCCCTGACGAGCAATT hexosyl ACGAAACCCCAAGTCCGACAGCAATCCCGCTGGAGCCAACAC transferase CGACGGCTACCGGTACAGCAGAATTAGATGCGCTGTGGAACTT (23-594) AGTCGAAGCTCAGTACCCAGTTCAAACTGCTGCAGTGACAACT (N431Q) TTGGTGACAGTGCCCGATGATTATAAGTTTGAGGCAGATCCAC CGAGTTATGCATTAGCAGGGTATGAAACAAGCGAGATTGCCG GACTGAAGTTTCCAAAGGGGTTTAAGTTTGGTGTTGCGGGGGC AGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAAGGGCGGGG CCCAAGTACCTGGGATTATCTGTGTCATCACTATGCCAGCACG CAGTGTAACAATTATGATCCCGATATTACAACCAACCATTACT ACCTGTACCCATTGGACTTTGCGCGCCTGCAACACCTAGGCAT TAACACTTACTCGTTTTCAATTTCATGGACGCGTATTTATCCAT TGGGCGCAGGCTATGTTAATGAAGCAGGGTTAGCCCACTATGA TGCCGTAATCCATAGTGCCAAGAAGTATGGTCTGGAACCAGTG GGCACCGTTTTTCACTGGGATACGCCACTGTCTCTGATGCTGA AATACGGTGCCTGGCAAGATACTGGTGACCAAATTGTTAAGG ACTTTGTTACCTATGCCACAACTGTGTTTAAGCGTTATGGTAAT GAAGTCAAGACGTGGTTTACTTTCAATGAACCACGGGTTTTCT GTTCACAAAATAGTGGTCTGCCATACAATCTGACGTATCCAGA AGGTATTAACAGCACCTCCGCTGTATTTCGTTGCACCTACAAT GTTCTGAAAGCTCATGGTCATGCTGTTAAAGTGTATCGGGAT CTAGTTGCCTCCGGGACCATTGCGGCAGGTGAAATCGGCTTTA AATCCGATGATAACTACCCAATCCCGGCCCGTCCAGGGAACGC CGATGACGAGGAATCAGCCAAGCGTCACGAGGCTTTTCGCATT GGGATTTTTGCGCAACCGGTTTATGGTAATGGCGATTATCCAG ATGTTGTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTGAC GGATGAAGATAAAGGATACATTAAAGGTAGCGGAGATATTTT TGCGATTGACGGGTATCGTACCGATATTTCCCATGCGGCTCTG AACGGGATCGCGAATTGTATTCGCCAGCAATCGGATCCGAATT GGCCAGTGTGTGAAGAAGGGTCAGATCCTTTTGCTCATGTTTA CCCATCCGGGTTTGCTATTGGTCAATCAGCCGATCCACTGTCTT CATGGTTAGTCAACTCAGCCCCGTTTATCCGCGATCAACTGAA GTTTCTGACACAAACCTACCCTGCTAAGGGTGGTATTTATTTCT CGGAATTTGGTTGGGCTGAAGACGCCGAATATGATCGTCAACT GCTGTATCAAATTACCTGGGATGGTCTGCGTACGCAATACCTG ACGGACTATCTGAGCCAGCTGCTGTTGGCTGTGCACAAAGACG GGATTAATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGATAA TTGGGAGTGGGGTTTAGGGATGCAACAGAAATTCGGATTTCAG TTTGTTAATCAATCAGATCCCGATCTGACACGCACGTTTAAAC TGAGCGCTCACGCTTACGCCCAATTTGGGCGTAATCATCTG 25 Synthetic- VTYPGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEA hexosyl QYPVQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPK transferase GFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYD (23-594) PDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEA (N569Q) GLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTG DQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYN LTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEI GFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYP DVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNG IANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLV NSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQIT WDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGL GMQQKFGFQFVQQSDPDLTRTFKLSAHAYAQFGRNHL 26 Synthetic- GTTACTTATCCGGGAGCCATTCCTCTGTCCCTGACGAGCAATT hexosyl ACGAAACCCCAAGTCCGACAGCAATCCCGCTGGAGCCAACAC transferase CGACGGCTACCGGTACAGCAGAATTAGATGCGCTGTGGAACTT (23-594) AGTCGAAGCTCAGTACCCAGTTCAAACTGCTGCAGTGACAACT (N569Q) TTGGTGACAGTGCCCGATGATTATAAGTTTGAGGCAGATCCAC CGAGTTATGCATTAGCAGGGTATGAAACAAGCGAGATTGCCG GACTGAAGTTTCCAAAGGGGTTTAAGTTTGGTGTTGCGGGGGC AGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAAGGGCGGGG CCCAAGTACCTGGGATTATCTGTGTCATCACTATGCCAGCACG CAGTGTAACAATTATGATCCCGATATTACAACCAACCATTACT ACCTGTACCCATTGGACTTTGCGCGCCTGCAACACCTAGGCAT TAACACTTACTCGTTTTCAATTTCATGGACGCGTATTTATCCAT TGGGCGCAGGCTATGTTAATGAAGCAGGGTTAGCCCACTATGA TGCCGTAATCCATAGTGCCAAGAAGTATGGTCTGGAACCAGTG GGCACCGTTTTTCACTGGGATACGCCACTGTCTCTGATGCTGA AATACGGTGCCTGGCAAGATACTGGTGACCAAATTGTTAAGG ACTTTGTTACCTATGCCACAACTGTGTTTAAGCGTTATGGTAAT GAAGTCAAGACGTGGTTTACTTTCAATGAACCACGGGTTTTCT GTTCACAAAATAGTGGTCTGCCATACAATCTGACGTATCCAGA AGGTATTAACAGCACCTCCGCTGTATTTCGTTGCACCTACAAT GTTCTGAAAGCTCATGGTCATGCTGTTAAAGTGTATCGGGATC TAGTTGCCTCCGGGACCATTGCGGCAGGTGAAATCGGCTTTAA ATCCGATGATAACTACCCAATCCCGGCCCGTCCAGGGAACGCC GATGACGAGGAATCAGCCAAGCGTCACGAGGCTTTTCGCATTG GGATTTTTGCGCAACCGGTTTATGGTAATGGCGATTATCCAGA TGTTGTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTGACG GATGAAGATAAAGGATACATTAAAGGTAGCGGAGATATTTTT GCGATTGACGGGTATCGTACCGATATTTCCCATGCGGCTCTGA ACGGGATCGCGAATTGTATTCGCAACCAAAGTGACCCGAATTG GCCAGTGTGTGAAGAAGGGTCAGATCCTTTTGCTCATGTTTAC CCATCCGGGTTTGCTATTGGTCAATCAGCCGATCCACTGTCTTC ATGGTTAGTCAACTCAGCCCCGTTTATCCGCGATCAACTGAAG TTTCTGACACAAACCTACCCTGCTAAGGGTGGTATTTATTTCTC GGAATTTGGTTGGGCTGAAGACGCCGAATATGATCGTCAACTG CTGTATCAAATTACCTGGGATGGTCTGCGTACGCAATACCTGA CGGACTATCTGAGCCAGCTGCTGTTGGCTGTGCACAAAGACGG GATTAATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGATAAT TGGGAGTGGGGTTTAGGGATGCAACAGAAATTCGGATTTCAGT TTGTTCAGCAATCGGATCCCGATCTGACACGCACGTTTAAACT GAGCGCTCACGCTTACGCCCAATTTGGGCGTAATCATCTG 27 -mating MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG factorsignal DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEA sequencefrom Saccharomyces cerevisiae (MF) 28 -mating atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca factorsignal acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg sequencefrom atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg Saccharomyces ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagct cerevisiae (MF) 29 -mating MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG factorsignal DFDVAVLPFSASIAAKEEGVS sequencefrom Saccharomyces cerevisiae (MF)(57-60) 30 Invertase(IV) MLLQAFLFLLAGFAAKISA signal sequence 31 Glucoamylase MSFRSLLALSGLVCSGLA (GA)signal sequence 32 Inulinase(IN) MKLAYSLLLPLAGVSA signal sequence 33 MF- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca rBht.sub.(1-594)-HIS acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg (nucleicacid) atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagctatgatgctgcatgctgcactgc tagtagcgctgccatgtgttgttttggcgcgcccggccggagcggttacttatccgggagccattcctctg tccctgacgagcaattacgaaaccccaagtccgacagcaatcccgctggagccaacaccgacggcta ccggtacagcagaattagatgcgctgtggaacttagtcgaagctcagtacccagttcaaactgctgcagt gacaactttggtgacagtgcccgatgattataagtttgaggcagatccaccgagttatgcattagcagggt atgaaacaagcgagattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagcca ttcaagttgaaggtgcagcaaaagccgaagggcggggcccaagtacctgggattatctgtgtcatcact atgccagcacgcagtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattggact ttgcgcgcctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccattggg cgcaggctatgttaatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtatggt ctggaaccagtgggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggc aagatactggtgaccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatga agtcaagacgtggtttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctg acgtatccagaaggtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggt catgctgttaaagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatc cgatgataactacccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcac gaggcttttcgcattgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaa ctgttggagatatgctgccggccctgacggatgaagataaaggatacattaaaggtagcggagatattttt gcgattgacgggtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaacc aaagtgacccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggttt gctattggtcaatcagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactg aagtttctgacacaaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagacgcc gaatatgatcgtcaactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggactatct gagccagctgctgttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgt cgataattgggagtggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccg atctgacacgcacgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctgcaccacca ccaccaccactaa 34 MF- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG rBht.sub.(1-594)- DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEAMM HIS LHAALLVALPCVVLARPAGAVTYPGAIPLSLTSNYETPSPTAIPLE (protein) PTPTATGTAELDALWNLVEAQYPVQTAAVTTLVTVPDDYKFEAD PPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGP STWDYLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGINT YSFSISWTRIYPLGAGYVNEAGLAHYDAVIHSAKKYGLEPVGTVF HWDTPLSLMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKT WFTFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHG HAVKVYRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKR HEAFRIGIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKG SGDIFAIDGYRTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAH VYPSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFS EFGWAEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGI NLRGALTWSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLS AHAYAQFGRNHLHHHHHH 35 rBht.sub.(1-594)- atgatgctgcatgctgcactgctagtagcgctgccatgtgttgttttggcgcgcccggccggagcggtta HIS(nucleic cttatccgggagccattcctctgtccctgacgagcaattacgaaaccccaagtccgacagcaatcccgct acid) ggagccaacaccgacggctaccggtacagcagaattagatgcgctgtggaacttagtcgaagctcagt acccagttcaaactgctgcagtgacaactttggtgacagtgcccgatgattataagtttgaggcagatcca ccgagttatgcattagcagggtatgaaacaagcgagattgccggactgaagtttccaaaggggtttaagt ttggtgttgcgggggcagccattcaagttgaaggtgcagcaaaagccgaagggcggggcccaagtac ctgggattatctgtgtcatcactatgccagcacgcagtgtaacaattatgatcccgatattacaaccaacca ttactacctgtacccattggactttgcgcgcctgcaacacctaggcattaacacttactcgttttcaatttcat ggacgcgtatttatccattgggcgcaggctatgttaatgaagcagggttagcccactatgatgccgtaatc catagtgccaagaagtatggtctggaaccagtgggcaccgtttttcactgggatacgccactgtctctgat gctgaaatacggtgcctggcaagatactggtgaccaaattgttaaggactttgttacctatgccacaactg tgtttaagcgttatggtaatgaagtcaagacgtggtttactttcaatgaaccacgggttttctgttcacaaaat agtggtctgccatacaatctgacgtatccagaaggtattaacagcacctccgctgtatttcgttgcacctac aatgttctgaaagctcatggtcatgctgttaaagtgtatcgggatctagttgcctccgggaccattgcggc aggtgaaatcggctttaaatccgatgataactacccaatcccggcccgtccagggaacgccgatgacg aggaatcagccaagcgtcacgaggcttttcgcattgggatttttgcgcaaccggtttatggtaatggcgat tatccagatgttgttaaagaaactgttggagatatgctgccggccctgacggatgaagataaaggataca ttaaaggtagcggagatatttttgcgattgacgggtatcgtaccgatatttcccatgcggctctgaacggg atcgcgaattgtattcgcaaccaaagtgacccgaattggccagtgtgtgaagaagggtcagatccttttg ctcatgtttacccatccgggtttgctattggtcaatcagccgatccactgtcttcatggttagtcaactcagc cccgtttatccgcgatcaactgaagtttctgacacaaacctaccctgctaagggtggtatttatttctcggaa tttggttgggctgaagacgccgaatatgatcgtcaactgctgtatcaaattacctgggatggtctgcgtac gcaatacctgacggactatctgagccagctgctgttggctgtgcacaaagacgggattaatctgcgagg cgcgctgacgtggagttttgtcgataattgggagtggggtttagggatgcaacagaaattcggatttcagt ttgttaatcaatcagatcccgatctgacacgcacgtttaaactgagcgctcacgcttacgcccaatttggg cgtaatcatctgcaccaccaccaccaccac 36 rBht.sub.(1-594)- MMLHAALLVALPCVVLARPAGAVTYPGAIPLSLTSNYETPSPTAI HIS PLEPTPTATGTAELDALWNLVEAQYPVQTAAVTTLVTVPDDYKF (protein) EADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEG RGPSTWDYLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLG INTYSFSISWTRIYPLGAGYVNEAGLAHYDAVIHSAKKYGLEPVG TVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNE VKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLK AHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEES AKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGY IKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDPNWPVCEEGSDP FAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGI YFSEFGWAEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHK DGINLRGALTWSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTF KLSAHAYAQFGRNHLHHHHHH 37 MF- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca rBht.sub.(23-594)- acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg HIS(nucleic atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg acid) ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagctgttacttatccgggagccattc ctctgtccctgacgagcaattacgaaaccccaagtccgacagcaatcccgctggagccaacaccgacg gctaccggtacagcagaattagatgcgctgtggaacttagtcgaagctcagtacccagttcaaactgctg cagtgacaactttggtgacagtgcccgatgattataagtttgaggcagatccaccgagttatgcattagca gggtatgaaacaagcgagattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggca gccattcaagttgaaggtgcagcaaaagccgaagggcggggcccaagtacctgggattatctgtgtcat cactatgccagcacgcagtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattg gactttgcgcgcctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccatt gggcgcaggctatgttaatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtat ggtctggaaccagtgggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctg gcaagatactggtgaccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaat gaagtcaagacgtggtttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaat ctgacgtatccagaaggtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcat ggtcatgctgttaaagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaa atccgatgataactacccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgt cacgaggcttttcgcattgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaag aaactgttggagatatgctgccggccctgacggatgaagataaaggatacattaaaggtagcggagata tttttgcgattgacgggtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgca accaaagtgacccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgg gtttgctattggtcaatcagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaa ctgaagtttctgacacaaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagac gccgaatatgatcgtcaactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggacta tctgagccagctgctgttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagtttt gtcgataattgggagtggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatccc gatctgacacgacgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctgcaccacc accaccaccac 38 MF- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG rBht.sub.(23-594)- DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEAVTY HIS PGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYP (protein) VQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFK FGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDI TTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGL AHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGD QIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNL TYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIG FKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPD VVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGI ANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVN SAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITW DGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLG MQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH 39 MF-rBht.sub.(23- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca .sup.594)(N289Q)- acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg HIS(nucleic atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg acid) ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagctgttacttatccgggagccattc ctctgtccctgacgagcaattacgaaaccccaagtccgacagcaatcccgctggagccaacaccgacg gctaccggtacagcagaattagatgcgctgtggaacttagtcgaagctcagtacccagttcaaactgctg cagtgacaactttggtgacagtgcccgatgattataagtttgaggcagatccaccgagttatgcattagca gggtatgaaacaagcgagattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggca gccattcaagttgaaggtgcagcaaaagccgaagggcggggcccaagtacctgggattatctgtgtcat cactatgccagcacgcagtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattg gactttgcgcgcctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccatt gggcgcaggctatgttaatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtat ggtctggaaccagtgggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctg gcaagatactggtgaccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaat gaagtcaagacgtggtttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccataccag cttacgtatccagaaggtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatg gtcatgctgttaaagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaaa tccgatgataactacccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgtc acgaggcttttcgcattgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaaga aactgttggagatatgctgccggccctgacggatgaagataaaggatacattaaaggtagcggagatat ttttgcgattgacgggtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaa ccaaagtgacccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggt ttgctattggtcaatcagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaact gaagtttctgacacaaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagacgc cgaatatgatcgtcaactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggactatct gagccagctgctgttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgt cgataattgggagtggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccg atctgacacgcacgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctgcaccacca ccaccaccac 40 MF-rBht.sub.(23- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG .sub.594)(N289Q)- DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEAVTY HIS(protein) PGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYP VQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFK FGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDI TTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGL AHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGD QIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYQL TYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIG FKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPD VVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGI ANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVN SAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITW DGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLG MQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH 41 MF-rBht.sub.(23- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca .sub.594)(N297Q)- acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg HIS(nucleic atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg acid) ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagctgttacttatccgggagccattc ctctgtccctgacgagcaattacgaaaccccaagtccgacagcaatcccgctggagccaacaccgacg gctaccggtacagcagaattagatgcgctgtggaacttagtcgaagctcagtacccagttcaaactgctg cagtgacaactttggtgacagtgcccgatgattataagtttgaggcagatccaccgagttatgcattagca gggtatgaaacaagcgagattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggca gccattcaagttgaaggtgcagcaaaagccgaagggcggggcccaagtacctgggattatctgtgtcat cactatgccagcacgcagtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattg gactttgcgcgcctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccatt gggcgcaggctatgttaatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtat ggtctggaaccagtgggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctg gcaagatactggtgaccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaat gaagtcaagacgtggtttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaat ctgacgtatccagaagggatccagagcacctccgctgtatttcgttgcacctacaatgttctgaaagctca tggtcatgctgttaaagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggcttta aatccgatgataactacccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcg tcacgaggcttttcgcattgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaa gaaactgttggagatatgctgccggccctgacggatgaagataaaggatacattaaaggtagcggagat atttttgcgattgacgggtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgc aaccaaagtgacccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgg gtttgctattggtcaatcagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaa ctgaagtttctgacacaaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagac gccgaatatgatcgtcaactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggacta tctgagccagctgctgttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagtttt gtcgataattgggagtggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatccc gatctgacacgcacgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctgcaccacc accaccaccac 42 MF-rBht.sub.(23- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG .sub.594)(N297Q)- DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEAVTY HIS(protein) PGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYP VQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFK FGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDI TTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGL AHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGD QIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNL TYPEGIQSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIG FKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPD VVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGI ANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVN SAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITW DGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLG MQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH 43 MF-rBht.sub.(23- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgct .sub.594)(N431Q)- ccagtcaacactacaacagaagatgaaacggcacaaattccggctgaagctgtcatcggt HIS(nucleic tactcagatttagaaggggatttcgatgttgctgttttgccattttccaacagcacaaat acid) aacgggttattgtttataaatactactattgccagcattgctgctaaagaagaaggggta tctctcgagaaaagagaggctgaagctgttacttatccgggagccattcctctgtccctg acgagcaattacgaaaccccaagtccgacagcaatcccgctggagccaacaccgacggct accggtacagcagaattagatgcgctgtggaacttagtcgaagctcagtacccagttcaa actgctgcagtgacaactttggtgacagtgcccgatgattataagtttgaggcagatcca ccgagttatgcattagcagggtatgaaacaagcgagattgccggactgaagtttccaaag gggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgcagcaaaagccgaa gggcggggcccaagtacctgggattatctgtgtcatcactatgccagcacgcagtgtaac aattatgatcccgatattacaaccaaccattactacctgtacccattggactttgcgcgc ctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatcca ttgggcgcaggctatgttaatgaagcagggttagcccactatgatgccgtaatccatagt gccaagaagtatggtctggaaccagtgggcaccgtttttcactgggatacgccactgtct ctgatgctgaaatacggtgcctggcaagatactggtgaccaaattgttaaggactttgtt acctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttc aatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctgacgtatcca gaaggtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcat ggtcatgctgttaaagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaa atcggctttaaatccgatgataactacccaatcccggcccgtccagggaacgccgatgac gaggaatcagccaagcgtcacgaggcttttcgcattgggatttttgcgcaaccggtttat ggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctgccggccctg acggatgaagataaaggatacattaaaggtagcggagatatttttgcgattgacgggtat cgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgccagcaatcg gatccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatcc gggtttgctattggtcaatcagccgatccactgtcttcatggttagtcaactcagccccg tttatccgcgatcaactgaagtttctgacacaaacctaccctgctaagggtggtatttat ttctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctgtatcaaatt acctgggatggtctgcgtacgcaatacctgacggactatctgagccagctgctgttggct gtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgtcgataattgg gagtggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatccc gatctgacacgcacgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcat ctgcaccaccaccaccaccac 44 MF-rBht.sub.(23- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG .sub.594)(N431Q)- DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEAVTY HIS(protein) PGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYP VQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFK FGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDI TTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGL AHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGD QIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNL TYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIG FKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPD VVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGI ANCIRQQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVN SAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITW DGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLG MQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNH LHHHHHH 45 MF-rBht.sub.(23- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca .sub.594)(N569Q)- acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg HIS(nucleic atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg acid) ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagctgttacttatccgggagccattc ctctgtccctgacgagcaattacgaaaccccaagtccgacagcaatcccgctggagccaacaccgacg gctaccggtacagcagaattagatgcgctgtggaacttagtcgaagctcagtacccagttcaaactgctg cagtgacaactttggtgacagtgcccgatgattataagtttgaggcagatccaccgagttatgcattagca gggtatgaaacaagcgagattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggca gccattcaagttgaaggtgcagcaaaagccgaagggcggggcccaagtacctgggattatctgtgtcat cactatgccagcacgcagtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattg gactttgcgcgcctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccatt gggcgcaggctatgttaatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtat ggtctggaaccagtgggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctg gcaagatactggtgaccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaat gaagtcaagacgtggtttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaat ctgacgtatccagaaggtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcat ggtcatgctgttaaagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaa atccgatgataactacccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgt cacgaggcttttcgcattgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaag aaactgttggagatatgctgccggccctgacggatgaagataaaggatacattaaaggtagcggagata tttttgcgattgacgggtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgca accaaagtgacccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgg gtttgctattggtcaatcagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaa ctgaagtttctgacacaaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagac gccgaatatgatcgtcaactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggacta tctgagccagctgctgttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagtttt gtcgataattgggagtggggtttagggatgcaacagaaattcggatttcagtttgttcagcaatcggatcc cgatctgacacgcacgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctgcaccac caccaccaccac 46 MF-rBht.sub.(23- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG .sub.594)(N569Q)- DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEAVTY HIS(protein) PGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYP VQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFK FGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDI TTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGL AHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGD QIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNL TYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIG FKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPD VVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGI ANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVN SAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITW DGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLG MQQKFGFQFVQQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH 47 MF-rBht.sub.(32- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca .sub.594)-HIS acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg (nucleicacid) atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagcttccctgacgagcaattacgaa accccaagtccgacagcaatcccgctggagccaacaccgacggctaccggtacagcagaattagatg cgctgtggaacttagtcgaagctcagtacccagttcaaactgctgcagtgacaactttggtgacagtgcc cgatgattataagtttgaggcagatccaccgagttatgcattagcagggtatgaaacaagcgagattgcc ggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgcagcaa aagccgaagggggggcccaagtacctgggattatctgtgtcatcactatgccagcacgcagtgtaac aattatgatcccgatattacaaccaaccattactacctgtacccattggactttgcgcgcctgcaacaccta ggcattaacacttactcgttttcaatttcatggacgcgtatttatccattgggcgcaggctatgttaatgaag cagggttagcccactatgatgccgtaatccatagtgccaagaagtatggtctggaaccagtgggcaccg tttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggcaagatactggtgaccaaattg ttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttc aatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtattaac agcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcggg atctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatccgatgataactacccaatccc ggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgggatttt tgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctgccgg ccctgacggatgaagataaaggatacattaaaggtagcggagatatttttgcgattgacgggtatcgtac cgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattggcca gtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggtttgctattggtcaatcagccgatc cactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactgaagtttctgacacaaacctacc ctgctaagggtggtatttatttctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctgt atcaaattacctgggatggtctgcgtacgcaatacctgacggactatctgagccagctgctgttggctgtg cacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgtcgataattgggagtggggtttag ggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccgatctgacacgcacgtttaaactga gcgctcacgcttacgcccaatttgggcgtaatcatctgcaccaccaccaccaccac 48 MF-rBht.sub.(32- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG .sub.594)-HIS DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEASLTS (protein) NYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYPVQTAAVTTL VTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQ VEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDITTNHYYLYP LDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAVIHS AKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYA TTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTSA VFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPIP ARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDM LPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDP NWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLK FLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITWDGLRTQYLT DYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGMQQKFGFQF VNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH 49 MF-rBht.sub.(54- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca .sub.594)-HIS acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg (nucleic atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg acid) ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagctaccggtacagcagaattagat gcgctgtggaacttagtcgaagctcagtacccagttcaaactgctgcagtgacaactttggtgacagtgc ccgatgattataagtttgaggcagatccaccgagttatgcattagcagggtatgaaacaagcgagattgc cggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgcagca aaagccgaagggggggcccaagtacctgggattatctgtgtcatcactatgccagcacgcagtgtaa caattatgatcccgatattacaaccaaccattactacctgtacccattggactttgcgcgcctgcaacacct aggcattaacacttactcgttttcaatttcatggacgcgtatttatccattgggcgcaggctatgttaatgaa gcagggttagcccactatgatgccgtaatccatagtgccaagaagtatggtctggaaccagtgggcacc gtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggcaagatactggtgaccaaatt gttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttacttt caatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtattaa cagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcgg gatctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatccgatgataactacccaatcc cggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgggatt tttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctgccg gccctgacggatgaagataaaggatacattaaaggtagcggagatatttttgcgattgacgggtatcgta ccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattggcc agtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggtttgctattggtcaatcagccgat ccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactgaagtttctgacacaaacctac cctgctaagggtggtatttatttctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctg tatcaaattacctgggatggtctgcgtacgcaatacctgacggactatctgagccagctgctgttggctgt gcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgtcgataattgggagtggggttta gggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccgatctgacacgcacgtttaaactg agcgctcacgcttacgcccaatttgggcgtaatcatctgcaccaccaccaccaccac 50 MF-rBht.sub.(54- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG .sub.594)-HIS DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEATGT (protein) AELDALWNLVEAQYPVQTAAVTTLVTVPDDYKFEADPPSYALA GYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPSTWDYL CHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISW TRIYPLGAGYVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPL SLMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWFTFNE PRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKV YRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRHEAFRI GIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAI DGYRTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAHVYPSGF AIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGWA EDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGA LTWSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLSAHAYA QFGRNHLHHHHHH 51 MF-rBht.sub.(57- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca .sub.594)-HIS acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg (nucleicacid) atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagctgcagaattagatgcgctgtgg aacttagtcgaagctcagtacccagttcaaactgctgcagtgacaactttggtgacagtgcccgatgatta taagtttgaggcagatccaccgagttatgcattagcagggtatgaaacaagcgagattgccggactgaa gtttccaaaggggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgcagcaaaagccga agggcggggcccaagtacctgggattatctgtgtcatcactatgccagcacgcagtgtaacaattatgat cccgatattacaaccaaccattactacctgtacccattggactttgcgcgcctgcaacacctaggcattaa cacttactcgttttcaatttcatggacgcgtatttatccattgggcgcaggctatgttaatgaagcagggtta gcccactatgatgccgtaatccatagtgccaagaagtatggtctggaaccagtgggcaccgtttttcactg ggatacgccactgtctctgatgctgaaatacggtgcctggcaagatactggtgaccaaattgttaaggac tttgttacctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttcaatgaacc acgggttttctgttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtattaacagcacctc cgctgtatttcgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcgggatctagttg cctccgggaccattgcggcaggtgaaatcggctttaaatccgatgataactacccaatcccggcccgtc cagggaacgccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgggatttttgcgcaac cggtttatggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctgccggccctgacg gatgaagataaaggatacattaaaggtagcggagatatttttgcgattgacgggtatcgtaccgatatttcc catgcggctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattggccagtgtgtgaa gaagggtcagatccttttgctcatgtttacccatccgggtttgctattggtcaatcagccgatccactgtctt catggttagtcaactcagccccgtttatccgcgatcaactgaagtttctgacacaaacctaccctgctaag ggtggtatttatttctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctgtatcaaatta cctgggatggtctgcgtacgcaatacctgacggactatctgagccagctgctgttggctgtgcacaaag acgggattaatctgcgaggcgcgctgacgtggagttttgtcgataattgggagtggggtttagggatgca acagaaattcggatttcagtttgttaatcaatcagatcccgatctgacacgcacgtttaaactgagcgctca cgcttacgcccaatttgggcgtaatcatctgcaccaccaccaccaccac 52 MF-rBht.sub.(57- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG .sub.594)-HIS DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEAAEL (protein) DALWNLVEAQYPVQTAAVTTLVTVPDDYKFEADPPSYALAGYE TSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHH YASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIY PLGAGYVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLM LKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRV FCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRD LVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRHEAFRIGIF AQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAIDG YRTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAI GQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAED AEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALT WSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQF GRNHLHHHHHH 53 MF-rBht.sub.(82- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca .sub.594)-HIS acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg (nucleicacid) atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagctacagtgcccgatgattataagt ttgaggcagatccaccgagttatgcattagcagggtatgaaacaagcgagattgccggactgaagtttcc aaaggggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgcagcaaaagccgaagggc ggggcccaagtacctgggattatctgtgtcatcactatgccagcacgcagtgtaacaattatgatcccgat attacaaccaaccattactacctgtacccattggactttgcgcgcctgcaacacctaggcattaacacttac tcgttttcaatttcatggacgcgtatttatccattgggcgcaggctatgttaatgaagcagggttagcccact atgatgccgtaatccatagtgccaagaagtatggtctggaaccagtgggcaccgtttttcactgggatac gccactgtctctgatgctgaaatacggtgcctggcaagatactggtgaccaaattgttaaggactttgttac ctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttcaatgaaccacgggtt ttctgttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtattaacagcacctccgctgta tttcgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcgggatctagttgcctccg ggaccattgcggcaggtgaaatcggctttaaatccgatgataactacccaatcccggcccgtccaggga acgccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgggatttttgcgcaaccggttta tggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctgccggccctgacggatgaa gataaaggatacattaaaggtagcggagatatttttgcgattgacgggtatcgtaccgatatttcccatgcg gctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattggccagtgtgtgaagaaggg tcagatccttttgctcatgtttacccatccgggtttgctattggtcaatcagccgatccactgtcttcatggtta gtcaactcagccccgtttatccgcgatcaactgaagtttctgacacaaacctaccctgctaagggtggtat ttatttctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctgtatcaaattacctgggat ggtctgcgtacgcaatacctgacggactatctgagccagctgctgttggctgtgcacaaagacgggatt aatctgcgaggcgcgctgacgtggagttttgtcgataattgggagtggggtttagggatgcaacagaaat tcggatttcagtttgttaatcaatcagatcccgatctgacacgcacgtttaaactgagcgctcacgcttacg cccaatttgggcgtaatcatctgcaccaccaccaccaccac 54 MF-rBht.sub.(82- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG .sub.594)-HIS DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEATVP (protein) DDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGA AKAEGRGPSTWDYLCHHYASTQCNNYDPDITTNHYYLYPLDFAR LQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAVIHSAKKYG LEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYATTVFK RYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCT YNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPIPARPGN ADDEESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDMLPALT DEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDPNWPV CEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQT YPAKGGIYFSEFGWAEDAEYDRQLLYQITWDGLRTQYLTDYLSQ LLLAVHKDGINLRGALTWSFVDNWEWGLGMQQKFGFQFVNQS DPDLTRTFKLSAHAYAQFGRNHLHHHHHH 55 MF-rBht.sub.(95- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca .sub.594)-HIS acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg (nucleicacid) atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagctagttatgcattagcagggtatg aaacaagcgagattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagccattca agttgaaggtgcagcaaaagccgaagggcggggcccaagtacctgggattatctgtgtcatcactatgc cagcacgcagtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattggactttgc gcgcctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccattgggcgca ggctatgttaatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtatggtctgg aaccagtgggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggcaaga tactggtgaccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatgaagtc aagacgtggtttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctgacgt atccagaaggtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggtcatg ctgttaaagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatccgat gataactacccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcacgag gcttttcgcattgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaactgt tggagatatgctgccggccctgacggatgaagataaaggatacattaaaggtagcggagatatttttgcg attgacgggtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaaccaaag tgacccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggtttgctatt ggtcaatcagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactgaagttt ctgacacaaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagacgccgaatat gatcgtcaactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggactatctgagcca gctgctgttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgtcgataatt gggagtggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccgatctgaca cgcacgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctgcaccaccaccaccacc ac 56 MF-rBht.sub.(95- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG .sub.594)-HIS DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEASYA (protein) LAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPSTWD YLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSI SWTRIYPLGAGYVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWD TPLSLMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWFT FNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAV KVYRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRHEA FRIGIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKGSGDI FAIDGYRTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAHVYP SGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFG WAEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINL RGALTWSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLSAH AYAQFGRNHLHHHHHH 57 MF-rBht.sub.(103- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca .sub.594)-HIS acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg (nucleicacid) atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagctacaagcgagattgccggact gaagtttccaaaggggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgcagcaaaagc cgaagggcggggcccaagtacctgggattatctgtgtcatcactatgccagcacgcagtgtaacaattat gatcccgatattacaaccaaccattactacctgtacccattggactttgcgcgcctgcaacacctaggcat taacacttactcgttttcaatttcatggacgcgtatttatccattgggcgcaggctatgttaatgaagcaggg ttagcccactatgatgccgtaatccatagtgccaagaagtatggtctggaaccagtgggcaccgtttttca ctgggatacgccactgtctctgatgctgaaatacggtgcctggcaagatactggtgaccaaattgttaag gactttgttacctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttcaatga accacgggttttctgttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtattaacagca cctccgctgtatttcgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcgggatct agttgcctccgggaccattgcggcaggtgaaatcggctttaaatccgatgataactacccaatcccggcc cgtccagggaacgccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgggatttttgcg caaccggtttatggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctgccggccct gacggatgaagataaaggatacattaaaggtagcggagatatttttgcgattgacgggtatcgtaccgat atttcccatgcggctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattggccagtgt gtgaagaagggtcagatccttttgctcatgtttacccatccgggtttgctattggtcaatcagccgatccact gtcttcatggttagtcaactcagccccgtttatccgcgatcaactgaagtttctgacacaaacctaccctgc taagggtggtatttatttctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctgtatcaa attacctgggatggtctgcgtacgcaatacctgacggactatctgagccagctgctgttggctgtgcaca aagacgggattaatctgcgaggcgcgctgacgtggagttttgtcgataattgggagtggggtttagggat gcaacagaaattcggatttcagtttgttaatcaatcagatcccgatctgacacgcacgtttaaactgagcg ctcacgcttacgcccaatttgggcgtaatcatctgcaccaccaccaccaccac 58 MF-rBht.sub.(103- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG .sub.594)-HIS DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEATSEI (protein) AGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYAS TQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLG AGYVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKY GAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCS QNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVA SGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQP VYGNGDYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRT DISHAALNGIANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQS ADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEY DRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSF VDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGR NHLHHHHHH 59 MF-rBht.sub.(111- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca .sub.594)-HIS acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg (nucleicacid) atgttgctgttttgccattttccaacagcacaaataacgggttattgtttataaatactactattgccagcattg ctgctaaagaagaaggggtatctctcgagaaaagagaggctgaagcttacgtagaattcatgtttccaaa ggggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgcagcaaaagccgaagggcggg gcccaagtacctgggattatctgtgtcatcactatgccagcacgcagtgtaacaattatgatcccgatatta caaccaaccattactacctgtacccattggactttgcgcgcctgcaacacctaggcattaacacttactcgt tttcaatttcatggacgcgtatttatccattgggcgcaggctatgttaatgaagcagggttagcccactatg atgccgtaatccatagtgccaagaagtatggtctggaaccagtgggcaccgtttttcactgggatacgcc actgtctctgatgctgaaatacggtgcctggcaagatactggtgaccaaattgttaaggactttgttacctat gccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttcaatgaaccacgggttttct gttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtattaacagcacctccgctgtatttc gttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcgggatctagttgcctccggga ccattgcggcaggtgaaatcggctttaaatccgatgataactacccaatcccggcccgtccagggaacg ccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgggatttttgcgcaaccggtttatggt aatggcgattatccagatgttgttaaagaaactgttggagatatgctgccggccctgacggatgaagata aaggatacattaaaggtagcggagatatttttgcgattgacgggtatcgtaccgatatttcccatgcggctc tgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattggccagtgtgtgaagaagggtcag atccttttgctcatgtttacccatccgggtttgctattggtcaatcagccgatccactgtcttcatggttagtca actcagccccgtttatccgcgatcaactgaagtttctgacacaaacctaccctgctaagggtggtatttattt ctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctgtatcaaattacctgggatggtc tgcgtacgcaatacctgacggactatctgagccagctgctgttggctgtgcacaaagacgggattaatct gcgaggcgcgctgacgtggagttttgtcgataattgggagtggggtttagggatgcaacagaaattcgg atttcagtttgttaatcaatcagatcccgatctgacacgcacgtttaaactgagcgctcacgcttacgccca atttgggcgtaatcatctgcaccaccaccaccaccac 60 MF-rBht.sub.(111- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG .sub.594)-HIS DFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKREAEAYVE (protein) FMFPKGFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQ CNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAG YVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGA WQDTGDQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNS GLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGT IAAGEIGFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYG NGDYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISH AALNGIANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPL SSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQL LYQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDN WEWGLGMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHLH HHHHH 61 IV- atgcttttgcaagctttccttttccttttggctggttttgcagccaagatatctgcaaccggtacagcagaatt rBht.sub.(54-594)- agatgcgctgtggaacttagtcgaagctcagtacccagttcaaactgctgcagtgacaactttggtgaca HIS(nucleic gtgcccgatgattataagtttgaggcagatccaccgagttatgcattagcagggtatgaaacaagcgaga acid) ttgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgc agcaaaagccgaagggggggcccaagtacctgggattatctgtgtcatcactatgccagcacgcagt gtaacaattatgatcccgatattacaaccaaccattactacctgtacccattggactttgcgcgcctgcaac acctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccattgggcgcaggctatgttaat gaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtatggtctggaaccagtgggc accgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggcaagatactggtgacca aattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggttta ctttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtat taacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtat cgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatccgatgataactacccaa tcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgg gatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctg ccggccctgacggatgaagataaaggatacattaaaggtagcggagatatttttgcgattgacgggtatc gtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattg gccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggtttgctattggtcaatcagc cgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactgaagtttctgacacaaac ctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagacgccgaatatgatcgtcaact gctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggactatctgagccagctgctgttgg ctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgtcgataattgggagtggg gtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccgatctgacacgcacgttta aactgagcgctcacgcttacgcccaatttgggcgtaatcatctgcaccaccaccaccaccac 62 IV- MLLQAFLFLLAGFAAKISATGTAELDALWNLVEAQYPVQTAAVT rBht.sub.(54-594)- TLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAGAA HIS(protein) IQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDITTNHYYLY PLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAVIH SAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTY ATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTS AVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPI PARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGD MLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSD PNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQL KFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITWDGLRTQYL TDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGMQQKFGFQ FVNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH 63 GA- atgtcttttagatccttgctagctttgtctggtttggtttgttctggtttggctaccggtacagcagaattagatg rBht.sub.(54-594)- cgctgtggaacttagtcgaagctcagtacccagttcaaactgctgcagtgacaactttggtgacagtgcc HIS(nucleic cgatgattataagtttgaggcagatccaccgagttatgcattagcagggtatgaaacaagcgagattgcc acid) ggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgcagcaa aagccgaagggggggcccaagtacctgggattatctgtgtcatcactatgccagcacgcagtgtaac aattatgatcccgatattacaaccaaccattactacctgtacccattggactttgcgcgcctgcaacaccta ggcattaacacttactcgttttcaatttcatggacgcgtatttatccattgggcgcaggctatgttaatgaag cagggttagcccactatgatgccgtaatccatagtgccaagaagtatggtctggaaccagtgggcaccg tttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggcaagatactggtgaccaaattg ttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttc aatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtattaac agcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcggg atctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatccgatgataactacccaatccc ggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgggatttt tgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctgccgg ccctgacggatgaagataaaggatacattaaaggtagcggagatatttttgcgattgacgggtatcgtac cgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattggcca gtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggtttgctattggtcaatcagccgatc cactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactgaagtttctgacacaaacctacc ctgctaagggtggtatttatttctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctgt atcaaattacctgggatggtctgcgtacgcaatacctgacggactatctgagccagctgctgttggctgtg cacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgtcgataattgggagtggggtttag ggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccgatctgacacgcacgtttaaactga gcgctcacgcttacgcccaatttgggcgtaatcatctgcaccaccaccaccaccac 64 GA- MSFRSLLALSGLVCSGLATGTAELDALWNLVEAQYPVQTAAVTT rBht.sub.(54-594)- LVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAI HIS(protein) QVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDITTNHYYLY PLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAVIH SAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTY ATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTS AVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPI PARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGD MLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSD PNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQL KFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITWDGLRTQYL TDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGMQQKFGFQ FVNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH 65 IN- atgaagttagcatactccttgttgcttccgctagcaggagtcagtgctaccggtacagcagaattagatgc rBht.sub.(54-594)- gctgtggaacttagtcgaagctcagtacccagttcaaactgctgcagtgacaactttggtgacagtgccc HIS(nucleic gatgattataagtttgaggcagatccaccgagttatgcattagcagggtatgaaacaagcgagattgccg acid) gactgaagtttccaaaggggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgcagcaaa agccgaagggcggggcccaagtacctgggattatctgtgtcatcactatgccagcacgcagtgtaaca attatgatcccgatattacaaccaaccattactacctgtacccattggactttgcgcgcctgcaacacctag gcattaacacttactcgttttcaatttcatggacgcgtatttatccattgggcgcaggctatgttaatgaagca gggttagcccactatgatgccgtaatccatagtgccaagaagtatggtctggaaccagtgggcaccgttt ttcactgggatacgccactgtctctgatgctgaaatacggtgcctggcaagatactggtgaccaaattgtt aaggactttgttacctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttca atgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtattaaca gcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcggga tctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatccgatgataactacccaatcccg gcccgtccagggaacgccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgggattttt gcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctgccggc cctgacggatgaagataaaggatacattaaaggtagcggagatatttttgcgattgacgggtatcgtacc gatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattggccag tgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggtttgctattggtcaatcagccgatcc actgtcttcatggttagtcaactcagccccgtttatccgcgatcaactgaagtttctgacacaaacctaccct gctaagggtggtatttatttctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctgtat caaattacctgggatggtctgcgtacgcaatacctgacggactatctgagccagctgctgttggctgtgc acaaagacgggattaatctgcgaggcgcgctgacgtggagttttgtcgataattgggagtggggtttag ggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccgatctgacacgcacgtttaaactga gcgctcacgcttacgccaatttgggcgtaatcatctcaccaccaccaccaccac 66 IN- MKLAYSLLLPLAGVSATGTAELDALWNLVEAQYPVQTAAVTTL rBht.sub.(54-594)- VTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQ HIS(protein) VEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDITTNHYYLYP LDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAVIHS AKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYA TTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTSA VFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPIP ARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDM LPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDP NWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLK FLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITWDGLRTQYLT DYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGMQQKFGFQF VNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH 67 MF.sub.(57-70)- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca rBht.sub.(23-594)-HIS acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg (nucleicacid) atgttgctgttttgccattttccgccagcattgctgctaaagaagaaggggtatctctcgagaaaagagag gctgaagctgttacttatccgggagccattcctctgtccctgacgagcaattacgaaaccccaagtccga cagcaatcccgctggagccaacaccgacggctaccggtacagcagaattagatgcgctgtggaactta gtcgaagctcagtacccagttcaaactgctgcagtgacaactttggtgacagtgcccgatgattataagtt tgaggcagatccaccgagttatgcattagcagggtatgaaacaagcgagattgccggactgaagtttcc aaaggggtttaagtttggtgttgcgggggcagccattcaagttgaaggtgcagcaaaagccgaagggc ggggcccaagtacctgggattatctgtgtcatcactatgccagcacgcagtgtaacaattatgatcccgat attacaaccaaccattactacctgtacccattggactttgcgcgcctgcaacacctaggcattaacacttac tcgttttcaatttcatggacgcgtatttatccattgggcgcaggctatgttaatgaagcagggttagcccact atgatgccgtaatccatagtgccaagaagtatggtctggaaccagtgggcaccgtttttcactgggatac gccactgtctctgatgctgaaatacggtgcctggcaagatactggtgaccaaattgttaaggactttgttac ctatgccacaactgtgtttaagcgttatggtaatgaagtcaagacgtggtttactttcaatgaaccacgggtt ttctgttcacaaaatagtggtctgccatacaatctgacgtatccagaaggtattaacagcacctccgctgta tttcgttgcacctacaatgttctgaaagctcatggtcatgctgttaaagtgtatcgggatctagttgcctccg ggaccattgcggcaggtgaaatcggctttaaatccgatgataactacccaatcccggcccgtccaggga acgccgatgacgaggaatcagccaagcgtcacgaggcttttcgcattgggatttttgcgcaaccggttta tggtaatggcgattatccagatgttgttaaagaaactgttggagatatgctgccggccctgacggatgaa gataaaggatacattaaaggtagcggagatatttttgcgattgacgggtatcgtaccgatatttcccatgcg gctctgaacgggatcgcgaattgtattcgcaaccaaagtgacccgaattggccagtgtgtgaagaaggg tcagatccttttgctcatgtttacccatccgggtttgctattggtcaatcagccgatccactgtcttcatggtta gtcaactcagccccgtttatccgcgatcaactgaagtttctgacacaaacctaccctgctaagggtggtat ttatttctcggaatttggttgggctgaagacgccgaatatgatcgtcaactgctgtatcaaattacctgggat ggtctgcgtacgcaatacctgacggactatctgagccagctgctgttggctgtgcacaaagacgggatt aatctgcgaggcgcgctgacgtggagttttgtcgataattgggagtggggtttagggatgcaacagaaat tcggatttcagtttgttaatcaatcagatcccgatctgacacgcacgtttaaactgagcgctcacgcttacg cccaatttgggcgtaatcatctgcaccaccaccaccaccac 68 MF.sub.(57-70)- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG rBht.sub.(23-594)-HIS DFDVAVLPFSASIAAKEEGVSLEKREAEAVTYPGAIPLSLTSNYET (protein) PSPTAIPLEPTPTATGTAELDALWNLVEAQYPVQTAAVTTLVTVP DDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGA AKAEGRGPSTWDYLCHHYASTQCNNYDPDITTNHYYLYPLDFAR LQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAVIHSAKKYG LEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYATTVFK RYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCT YNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPIPARPGN ADDEESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDMLPALT DEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDPNWPV CEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQT YPAKGGIYFSEFGWAEDAEYDRQLLYQITWDGLRTQYLTDYLSQ LLLAVHKDGINLRGALTWSFVDNWEWGLGMQQKFGFQFVNQS DPDLTRTFKLSAHAYAQFGRNHLHHHHHH 69 MF.sub.(57-70)- atgagatttccttcaatttttactgcagttttattcgcagcatcctccgcattagctgctccagtcaacactaca rBht.sub.(23-594)-HIS acagaagatgaaacggcacaaattccggctgaagctgtcatcggttactcagatttagaaggggatttcg (nucleicacid) atgttgctgttttgccattttccgccagcattgctgctaaagaagaaggggtatctctcgagaaaagagag gctgaagctgcagaattagatgcgctgtggaacttagtcgaagctcagtacccagttcaaactgctgcag tgacaactttggtgacagtgcccgatgattataagtttgaggcagatccaccgagttatgcattagcaggg tatgaaacaagcgagattgccggactgaagtttccaaaggggtttaagtttggtgttgcgggggcagcc attcaagttgaaggtgcagcaaaagccgaagggcggggcccaagtacctgggattatctgtgtcatcac tatgccagcacgcagtgtaacaattatgatcccgatattacaaccaaccattactacctgtacccattggac tttgcgcgcctgcaacacctaggcattaacacttactcgttttcaatttcatggacgcgtatttatccattggg cgcaggctatgttaatgaagcagggttagcccactatgatgccgtaatccatagtgccaagaagtatggt ctggaaccagtgggcaccgtttttcactgggatacgccactgtctctgatgctgaaatacggtgcctggc aagatactggtgaccaaattgttaaggactttgttacctatgccacaactgtgtttaagcgttatggtaatga agtcaagacgtggtttactttcaatgaaccacgggttttctgttcacaaaatagtggtctgccatacaatctg acgtatccagaaggtattaacagcacctccgctgtatttcgttgcacctacaatgttctgaaagctcatggt catgctgttaaagtgtatcgggatctagttgcctccgggaccattgcggcaggtgaaatcggctttaaatc cgatgataactacccaatcccggcccgtccagggaacgccgatgacgaggaatcagccaagcgtcac gaggcttttcgcattgggatttttgcgcaaccggtttatggtaatggcgattatccagatgttgttaaagaaa ctgttggagatatgctgccggccctgacggatgaagataaaggatacattaaaggtagcggagatattttt gcgattgacgggtatcgtaccgatatttcccatgcggctctgaacgggatcgcgaattgtattcgcaacc aaagtgacccgaattggccagtgtgtgaagaagggtcagatccttttgctcatgtttacccatccgggttt gctattggtcaatcagccgatccactgtcttcatggttagtcaactcagccccgtttatccgcgatcaactg aagtttctgacacaaacctaccctgctaagggtggtatttatttctcggaatttggttgggctgaagacgcc gaatatgatcgtcaactgctgtatcaaattacctgggatggtctgcgtacgcaatacctgacggactatct gagccagctgctgttggctgtgcacaaagacgggattaatctgcgaggcgcgctgacgtggagttttgt cgataattgggagtggggtttagggatgcaacagaaattcggatttcagtttgttaatcaatcagatcccg atctgacacgcacgtttaaactgagcgctcacgcttacgcccaatttgggcgtaatcatctgcaccacca ccaccaccac 70 MF.sub.(57-70)- MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEG rBht.sub.(23-594)-HIS DFDVAVLPFSASIAAKEEGVSLEKREAEAAELDALWNLVEAQYP (protein) VQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFK FGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDI TTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGL AHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGD QIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNL TYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIG FKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPD VVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGI ANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVN SAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITW DGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLG MQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH 71 NotI-rBht- 5-aaggaaaaaaGCGGCCGCTTAGTGGTGGTGGTGGTGGTG (JBB5) 6XHIS CAGATGATTACGCCCAAATTG-3 Reverse 72 XhoI-MF- 5- (JBB21) rBht.sub.(32-594) GAAGAAGGGGTATCTCTCGAGAAAAGAGAGGCTGAAGCTTCC Forward CTGACGAGCAATTACG-3 73 XhoI-MF- 5- (JBB22) rBht.sub.(54-594) GAAGAAGGGGTATCTCTCGAGAAAAGAGAGGCTGAAGCTACC Forward GGTACAGCAGAATTAG-3 74 XhoI-MF- 5-GAAGAAGGGGTATCTCTCGAG (JBB23) rBht.sub.(57-594) AAAAGAGAGGCTGAAGCTGCAGAATTAGATGCGCTGTG-3 Forward 75 XhoI-MF- 5- (JBB24) rBht.sub.(82-594) GAAGAAGGGGTATCTCTCGAGAAAAGAGAGGCTGAAGCTACA Forward GTGCCCGATGATTATAAG-3 76 XhoI-MF- 5- (JBB25) rBht.sub.(95-594) GAAGAAGGGGTATCTCTCGAGAAAAGAGAGGCTGAAGCTAGT Forward TATGCATTAGCAGGGTATG-3 77 XhoI-MF- 5- (JBB26) rBht.sub.(103-594) GAAGAAGGGGTATCTCTCGAGAAAAGAGAGGCTGAAGCTACA Forward AGCGAGATTGCCGGAC-3 78 XhoI-MF- 5- (JBB27) rBht.sub.(23- TCACAAAATAGTGGTCTGCCATACCAGCTTACGTATCCAGAAG .sub.594)(N289Q) GTATTAACAG-3 Forward 79 XhoI-MF- 5- (JBB28) rBht.sub.(23- CTGTTAATACCTTCTGGATACGTAAGCTGGTATGGCAGACCAC .sub.594)(N289Q) TATTTTGTGA-3 Reverse 80 XhoI-MF- 5-CAATCTGACGTATCCAGAAGGGATCCAGAGCACCTCCGCTG- (JBB29) rBht.sub.(23- 3 .sub.594)(N297Q) Forward 81 XhoI-MF- 5-CAGCGGAGGTGCTCTGGATCCCTTCTGGATACGTCAGATTG- (JBB30) rBht.sub.(23- 3 .sub.594)(N297Q) Reverse 82 XhoI-MF- 5- (JBB31) rBht.sub.(23- GAAATTCGGATTTCAGTTTGTTCAGCAATCGGATCCCGATCTG .sub.594)(N569Q) ACAC-3 Forward 83 XhoI-MF- 5- (JBB32) rBht.sub.(23- GTGTCAGATCGGGATCCGATTGCTGAACAAACTGAAATCCGA .sub.594)(N569Q) ATTTC-3 Reverse 84 XhoI-MF- 5- (JBB33) rBht(23- GAAATTCGGATTTCAGTTTGTTCAGCAATCGGATCCCGATCTG 594)(N569Q) ACAC-3 Forward 85 XhoI-MF- 5- (JBB34) rBht(23- GTGTCAGATCGGGATCCGATTGCTGAACAAACTGAAATCCGA 594)(N569Q) ATTTC-3 Reverse 86 MF.sub.(57-70) 5-TTAGCAGCAATGCTGGCGGAAAATGGCAAAACAGC-3 (JBB35) Forward 87 MF.sub.(57-70) 5-GCTGTTTTGCCATTTTCCGCCAGCATTGCTGCTAA-3 (JBB36) Reverse 88 BamHI-IV- 5-CGCGGATCCAAACGATGCTTTTGC (JBB37) rBht.sub.(54-594) AAGCTTTCCTTTTCCTTTTGGCTG Forward GTTTTGCAGCCAAGATATCTGCAACCGGTACAGCAGAATTAG- 3 89 BamHI-GA- 5-CGCGGATCCAAACGATGTCTTTTA (JBB38) rBht.sub.(54-594) GATCCTTGCTAGCTTTGTCTGGTT Forward TGGTTTGTTCTGGTTTGGCTACCGGTACAGCAGAATTAGATG- 3 90 BamHI-IN- 5-CGCGGATCCAAACGATGAAGT (JBB39) rBht.sub.(54-594) TAGCATACTCCTTGTTGCTTCCGC Forward TAGCAGGAGTCAGTGCTACCGGTACAGCAGAATTAGATGC-3 91 rBhtForward 5-ATCACTATGCCAGCACGCAGTGTA-3 (JBB3) internal sequencing 92 rBhtReverse 5-TTTAAAGCCGATTTCACCTGCCGC-3 (JBB4) internal sequencing 93(5 AOX1 5-GACTGGTTCCAATTGACAAGC-3 AOX1) 94(3 AOX1 5-GCAAATGGCATTCTGACATCC-3 AOX1) 95(- MF 5-TACTATTGCCAGCATTGCTGC-3 factor) 96 2E3Z-A LALMSAAKLPKSFVWGYATAAYQIEGSPDKDGREPSIWDTFCKA PGKIADGSSGDVATDSYNRWREDVQLLKSYGVKAYRFSLSWSRII PKGGRSDPVNGAGIKHYRTLIEELVKEGITPFVTLYHWDLPQALD DRYGGWLNKEEAIQDFTNYAKLCFESFGDLVQNWITFNEPWVIS VMGYGNGIFAPGHVSNTEPWIVSHHIILAHAHAVKLYRDEFKEK QGGQIGITLDSHWLIPYDDTDASKEATLRAMEFKLGRFANPIYKG EYPPRIKKILGDRLPEFTPEEIELVKGSSDFFGLNTYTTHLVQDGGS DELAGFVKTGHTRADGTQLGTQSDMGWLQTYGPGFRWLLNYL WKAYDKPVYVTENGFPVKGENDLPVEQAVDDTDRQAYYRDYT EALLQAVTEDGADVRGYFGWSLLDNFEWAEGYKVRFGVTHVD YETQKRTPKKSAEFLSRWFKEHIEE 97 3AHY-A MHHHHHHMLPKDFQWGFATAAYQIEGAVDQDGRGPSIWDTFCA QPGKIADGSSGVTACDSYNRTAEDIALLKSLGAKSYRFSISWSRIIP EGGRGDAVNQAGIDHYVKFVDDLLDAGITPFITLFHWDLPEGLH QRYGGLLNRTEFPLDFENYARVMFRALPKVRNWITFNEPLCSAIP GYGSGTFAPGRQSTSEPWTVGHNILVAHGRAVKAYRDDFKPASG DGQIGIVLNGDFTYPWDAADPADKEAAERRLEFFTAWFADPIYL GDYPASMRKQLGDRLPTFTPEERALVHGSNDFYGMNHYTSNYIR HRSSPASADDTVGNVDVLFTNKQGNCIGPETQSPWLRPCAAGFR DFLVWISKRYGYPPIYVTENGTSIKGESDLPKEKILEDDFRVKYYN EYIRAMVTAVELDGVNVKGYFAWSLMDNFEWADGYVTRFGVT YVDYENGQKRFPKKSAKSLKPLFDELI 98 5BWF-A MGSSHHHHHHSSGLVPRGSHMLPKDFQWGFATAAYQIEGAIDK DGRGPSIWDTFCAIPGKIADGTSGVTACDSYNRTAEDIALLKSLG AKSYRFSISWSRIIPKGGRDDPVNQLGIDHYAQFVDDLLEAGITPFI TLFHWDLPEELHQRYGGLLNRTEFPLDFENYARVMFKALPKVRN WITFNEPLCSAIPGYGSGTFAPGRQSTTEPWIVGHNLLVAHGRAV KVYRDEFKDLNDGQIGIVLNGDFTYPWDSSDPLDREAAERRLEFF TAWYADPIYLGDYPASMRKQLGDRLPEFTPEEKAFVLGSNDFYG MNHYTSNYIRHRTSPATADDTVGNVDVLFYNKEGQCIGPETESS WLRPCPAGFRDFLVWISKRYNYPKIYVTENGTSLKGENDLPKEKI LEDDFRVNYYNEYIRAMFTAATLDGVNVKGYFAWSLMDNFEW ADGYVTRFGVTYVDYENGQQRFPKKSAKSLKPLFDELI 99 4MDO-A MGSSHHHHHHSSGLVPRGSHMASMSLPPDFKWGFATAAYQIEGSV NEDGRGPSIWDTFCAIPGKIADGSSGAVACDSYKRTKEDIALLKE LGANSYRFSISWSRIIPLGGRNDPINQKGIDHYVKFVDDLIEAGITP FITLFHWDLPDALDKRYGGFLNKEEFAADFENYARIMFKAIPKCK HWITFNEPWCSAILGYNTGYFAPGHTSDRSKSPVGDSAREPWIVG HNILIAHARAVKAYREDFKPTQGGEIGITLNGDATLPWDPEDPAD IEACDRKIEFAISWFADPIYFGKYPDSMRKQLGDRLPEFTPEEVAL VKGSNDFYGMNHYTANYIKHKTGVPPEDDFLGNLETLFYNKYG DCIGPETQSFWLRPHAQGFRDLLNWLSKRYGYPKIYVTENGTSLK GENDMPLEQVLEDDERVKYFNDYVRAMAAAVAEDGCNVRGYL AWSLLDNFEWAEGYETRFGVTYVDYANDQKRYPKKSAKSLKPL FDSLI 100 5JBO-A MMSESLSLPKDFEWGFATAAYQIEGAVKEGGRGPSIWDTYCHLE PSRTNGANGDVACDHYHRYDEDFDLLTKYGAKAYRFSLSWSRII PLGGRLDPINEEGIQFYSNLIDALLKRGVTPWVTLYHWDLPQALH DRYGGWLNVKEVQLDFERYARLCFERFGDRVKNWITINEPWIQS IYGYATGSNAPGRSSINKHSTEGDTTTEPWLAGKAQIMSHARAV AVYSKDFRASQKGQIGISLNGDYYEPWDSSDPRDKEAAERRMEF HIGWYANPIFLKKDYPASMRKQLGDRLPALTPADFAILNAGETDF YGMNYYTSQFARHYEGPVPKTDFLGAIHEHQENKDGSPVGEESG IFWLRSCPDMFRKHLARVHGLYGKPIYITENGCPCPGEDKMTCEE AINDPFRIQYFDSHLDSISKAISQDGVVVKGYFAWALLDNLEWSD GYGPRFGVTYTDYTTLKRTPKKSALVLKDMFADRQ .sup.a, Coding regions are capitalized, restriction sites have been underlined; mutated nucleotides are bold and italicized; MF, alpha-factor pre-pro sequence; IN, Inulinase leader (Kluyveromyces maxianus); GA, Glucoamylase leader (Aspergillus awamori); IV, Invertase leader (S. cerevisiae).
(123) Strains and plasmids relevant to the embodiments of the present disclosure are provided in the table below.
(124) TABLE-US-00006 TABLE 4B Stains and Plasmids. Strains/ Plasmids .sup.aDescription or genotype Source or Reference E. coli XL1-Blue recA1 endA1 gyrA96 thi-1 hsdR17 supE44 relA1 lac [F Agilent proAB lacI.sup.qZM15 Tn10 (Tet.sup.R)] K. pastoris GS115 his4 (his.sup. mut.sup.+) Invitrogen JB210 GS115::MF-rBht.sub.(1-594)-HIS (his.sup.+ mut.sup.+) (Dagher and Bruno- Brcena 2016) JB212 GS115:MF-rBht.sub.(23-594)-HIS (his.sup.+ mut.sup.+) (Dagher and Bruno- Brcena 2016) JB216 GS115::MF-rBht.sub.(111-594)-HIS (his.sup.+ mut.sup.+) (Dagher and Bruno- Brcena 2016) JB223 GS115::MF-rBht.sub.(32-594)-HIS (his.sup.+ mut.sup.+) Present disclosure JB224 GS115::MF-rBht.sub.(54-594)-HIS (his.sup.+ mut.sup.+) Present disclosure JB225 GS115::MF-rBht.sub.(57-594)-HIS (his.sup.+ mut.sup.+) Present disclosure JB226 GS115::MF-rBht.sub.(82-594)-HIS (his.sup.+ mut.sup.+) Present disclosure JB227 GS115::MF-rBht.sub.(95-594)-HIS (his.sup.+ mut.sup.+) Present disclosure JB228 GS115::MF-rBht.sub.(103-594)-HIS (his.sup.+ mut.sup.+) Present disclosure JB229 GS115::MF-rBht.sub.(23-594)(N289Q)-HIS (his.sup.+ mut.sup.+) Present disclosure JB230 GS115::MF-rBht.sub.(23-594)(N297Q)-HIS (his.sup.+ mut.sup.+) Present disclosure JB231 GS115::MF-rBht.sub.(23-594)(N431Q)-HIS (his.sup.+ mut.sup.+) Present disclosure JB232 GS115::MF-rBht.sub.(23-594)(N569Q)-HIS (his.sup.+ mut.sup.+) Present disclosure JB233 GS115::MF.sub.(57-70)-rBht.sub.(23-594)-HIS (his.sup.+ mut.sup.+) Present disclosure JB234 GS115::IV-rBht.sub.(54-594)-HIS (his.sup.+ mut.sup.+) Present disclosure JB235 GS115::GA-rBht.sub.(54-594)-HIS (his.sup.+ mut.sup.+) Present disclosure JB236 GS115::IN-rBht.sub.(54-594)-HIS (his.sup.+ mut.sup.+) Present disclosure JB237 GS115::pPIC9 (his.sup.+ mut.sup.+) control Present disclosure JB240 GS115::MF.sub.(57-70)-rBht.sub.(57-594)-HIS (his.sup.+ mut.sup.+) Present disclosure Plasmids K. pastoris pPIC9 K. pastoris integrative vector carrying AOX1 promoter Invitrogen and transcription terminator, HIS4, Amp.sup.r in E. coli, pBR322 ori, alpha factor pre-pro leader from S. cerevisiae (MF) pJB110 pPIC9-MF-rBht.sub.(1-594)-HIS (Dagher and Bruno- Brcena 2016) pJB112 pPIC9-MF-rBht.sub.(23-594)-HIS (Dagher and Bruno- Brcena 2016) pJB116 pPIC9-MF-rBht.sub.(111-594)-HIS (Dagher and Bruno- Brcena 2016) pJB123 pPIC9-MF-rBht.sub.(32-594)-HIS Present disclosure pJB124 pPIC9-MF-rBht.sub.(54-594)-HIS Present disclosure pJB125 pPIC9-MF-rBht.sub.(57-594)-HIS Present disclosure pJB126 pPIC9-MF-rBht.sub.(82-594)-HIS Present disclosure PJB127 pPIC9-MF-rBht.sub.(95-594)-HIS Present disclosure PJB128 pPIC9-MF-rBht.sub.(103-594)-HIS Present disclosure PJB129 pPIC9-MF-rBht.sub.(23-594)(N2890)-HIS Present disclosure pJB130 pPIC9-MF-rBht.sub.(23-594)(N297Q)-HIS Present disclosure pJB131 pPIC9-MF-rBht.sub.(23-594)(N4310)-HIS Present disclosure pJB132 pPIC9-MF-rBht.sub.(23-594)(N569Q)-HIS Present disclosure pJB133 pPIC9-MF.sub.(57-70)-rBht.sub.(23-594)-HIS Present disclosure pJB134 pPIC9-IV-rBht.sub.(54-594)-HIS Present disclosure pJB135 pPIC9-GA-rBht.sub.(54-594)-HIS Present disclosure pJB136 pPIC9-IN-rBht.sub.(54-594)-HIS Present disclosure pJB137 pPIC9-MF.sub.(57-70)-rBht.sub.(57-594)-HIS Present disclosure .sup.aMF, S. cerevisiae alpha factor pre-pro secretion leader found in pPIC9 vector is indicated in constructions to help differentiate between alternative signal sequences; IN, Inulinase leader (Kluyveromyces maxianus); GA, Glucoamylase leader (Aspergillus awamori); IV, Invertase leader (S. cerevisiae).
(125) It is understood that the foregoing detailed description and accompanying examples are merely illustrative and are not to be taken as limitations upon the scope of the disclosure, which is defined solely by the appended claims and their equivalents.
(126) All publications and patents mentioned in the above specification are herein incorporated by reference as if expressly set forth herein. Various changes and modifications to the disclosed embodiments will be apparent to those skilled in the art and may be made without departing from the spirit and scope thereof.