Modified epoxy resin immobilized enzyme, preparation method therefor and application thereof

20230104206 · 2023-04-06

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed are a modified epoxy resin immobilized enzyme, a preparation method therefor and an application thereof. Herein, the preparation method includes the following steps: modifying an epoxy resin, adding a polyethyleneimine to a modified epoxy resin for further modification, and then adding an enzyme to be immobilized and a glutaraldehyde for immobilization, to obtain the modified epoxy resin immobilized enzyme. The epoxy resin is modified, the polyethyleneimine is added to the modified epoxy resin for the further modification, and an aldehyde group in the resin and an amino group in the polyethyleneimine are covalently bound to each enzyme, then it is activated by the bifunctional reagent glutaraldehyde.

    Claims

    1. A preparation method for a modified epoxy resin immobilized enzyme, comprising the following steps: modifying an epoxy resin, adding a polyethyleneimine to a modified epoxy resin for further modification, and then adding an enzyme to be immobilized and a glutaraldehyde for immobilization, to obtain the modified epoxy resin immobilized enzyme.

    2. The preparation method according to claim 1, wherein the step of modifying the epoxy resin comprises using a sodium periodate to oxidize the epoxy resin or using an iminodiacetic acid to react with the epoxy resin.

    3. The preparation method according to claim 2, wherein while the step of modifying the epoxy resin is to use the sodium periodate to oxidize the epoxy resin, before the sodium periodate is added, an acetic acid is firstly used to treat the epoxy resin, and after the enzyme to be immobilized and the glutaraldehyde are added for immobilization, it further comprises a step of adding a cross-linking agent glutaraldehyde or dextran aldehyde for secondary cross-linking.

    4. The preparation method according to claim 2, wherein while the step of modifying the epoxy resin is to use the iminodiacetic acid to react with the epoxy resin, after the polyethyleneimine is added to the modified epoxy resin for further modification, it further comprises a step of adding metal ion solution for treatment, and the enzyme to be immobilized has a his tag.

    5. The preparation method according to claim 1, wherein the adding sequence of the enzyme to be immobilized and the glutaraldehyde is the enzyme to be immobilized and the glutaraldehyde, or the glutaraldehyde and the enzyme to be immobilized.

    6. The preparation method according to claim 3, wherein in the step of adding the polyethyleneimine to the modified epoxy resin for further modification, it further comprises adding a cofactor, and the cofactor is a nicotinamide adenine dinucleotide (NAD+), a nicotinamide adenine dinucleotide phosphate (NADP+) or a pyridoxal phosphate (PLP).

    7. The preparation method according to claim 6, wherein in the step of treating the epoxy resin with the acetic acid, the acetic acid used is acetic acid solution, and the concentration of the acetic acid in the acetic acid solution is 0.5˜3 M, preferably 1˜2 M; and the volume-to-mass ratio of the acetic acid solution to the epoxy resin is 5˜20:1, preferably 10˜15:1; preferably, the mass ratio of the enzyme to the modified epoxy resin is 0.05˜0.3:1; and preferably, in the step of using the iminodiacetic acid to react with the epoxy resin, the iminodiacetic acid used is iminodiacetic acid aqueous solution, the concentration of the iminodiacetic acid aqueous solution is 0.5˜3 M, preferably 1˜2 M, and the volume-to-mass ratio of the iminodiacetic acid aqueous solution to the epoxy resin is 5˜20:1, preferably 10˜15:1; and pH of the iminodiacetic acid aqueous solution is 6.0˜10.0, preferably 7.0˜9.0.

    8. The preparation method according to claim 7, wherein the treatment time after the acetic acid is mixed with the epoxy resin is 6˜24 h, preferably 10˜15 h; preferably, the reaction time after the sodium periodate solution is mixed with the epoxy resin is 1˜6 h, preferably 2˜3 h; preferably, the reaction time after the polyethyleneimine aqueous solution is mixed with the epoxy resin is 1˜20 h, preferably 3˜6 h; preferably, the reaction time after the enzyme is mixed with the modified epoxy resin is 2˜24 h, preferably 15˜20 h; preferably, after the cross-linking agent is added, the reaction time is 10˜120 min, preferably 20˜60 min; preferably, the action time after the iminodiacetic acid aqueous solution is mixed with the epoxy resin is 0.5˜6 h, preferably 1˜2 h; and preferably, the action time after the polyethyleneimine aqueous solution is mixed with a support is 1˜20 h, further, it is 3˜6 h; after the metal containing solution are added, the action time is 1˜6 h, further, it is 1˜3 h; and the action time after the enzyme solution is mixed with the support is 4˜48 h, and further, the action time is 15˜20 h.

    9. The preparation method according to claim 1, wherein the epoxy resin is selected from one or more in a group consisting of Purolite®Lifetech™ECR8285, ECR8204, ECR8209, SEPLITE®LX1000EA, LX1000EP, LX103B, EP200, LX1000HFA, HFA001, LX107S, LX1000SW, LX1000SD, HECHENG®ES1, ES103, ES105, ES108 or ES109.

    10. The preparation method according to claim 1, wherein the enzyme to be immobilized is selected from one or more in a group consisting of a transaminase derived from Chromobacterium violaceum DSM30191, a transaminase derived from Aspergillus fumigatus, a transaminase derived from Vibrio fluvialis strain JS17, a ketoreductase derived from Acetobacter sp. CCTCC M209061, a ketoreductase derived from Candida macedoniensis AKU4588, a cyclohexanone monooxygenase derived from Rhodococcus sp. Phi1, a cyclohexanone monooxygenase derived from Brachymonas petroleovorans, a monooxygenase derived from Rhodococcus ruber-SD1, an ammonia lyase derived from photorhabdus luminescens, an ammonia lyase derived from Solenostemon scutellarioides, an Ene reductase derived from Saccharomyces cerevisiae, an Ene reductase derived from ChrySEQbacterium sp. CA49, an imine reductase derived from Streptomyces sp or Bacillus cereus, a leucine dehydrogenase derived from Bacillus cereus, a phenylalanine dehydrogenase derived from Bacillus sphaericus, a nitrilase derived from Aspergillus niger CBS 513.88 or a nitrilase derived from Neurospora crassa OR74A; and preferably, the transaminase derived from Chromobacterium violaceum DSM30191 is a mutant having a sequence of SEQ ID NO: 2 or SEQ ID NO: 3; the transaminase derived from Arthrobacter citreus is a mutant having a sequence of SEQ ID NO: 5 or SEQ ID NO: 6; the ketoreductase derived from Acetobacter sp. CCTCC M209061 is a mutant having a sequence of SEQ ID NO: 8 or SEQ ID NO: 9; the cyclohexanone monooxygenase derived from Rhodococcus sp. Phi1 is a mutant having a sequence of SEQ ID NO: 11 or SEQ ID NO: 12; and the cyclohexanone monooxygenase derived from Rhodococcus ruber-SD1 is a mutant having a sequence of SEQ ID NO: 14 or SEQ ID NO: 15.

    11. A modified epoxy resin immobilized enzyme, wherein the immobilized enzyme is prepared by the preparation method according to any one of claims 1 to 10.

    12. The modified epoxy resin immobilized enzyme according to claim 11 for use in an aqueous buffer reaction system or an organic solvent reaction system.

    13. The modified epoxy resin immobilized enzyme according to claim 12, wherein the aqueous buffer reaction system or the organic solvent reaction system is reacted in a packed bed reactor or a continuous stirred tank reactor.

    14. The preparation method according to claim 4, wherein the metal ion solution is selected from one or more of a cobalt chloride, a cobalt sulfate, a nickel chloride, a copper sulfate, a ferrous chloride or a ferrous sulfate.

    15. The preparation method according to claim 4, wherein the concentration of the metal ion solution is 5˜100 mmol/L, preferably 10˜50 mmol/L.

    16. The preparation method according to claim 6, wherein the polyethyleneimine participates in the reaction in the form of polyethyleneimine aqueous solution, and the final concentration of the cofactor in the polyethyleneimine aqueous solution is 1˜10 mg/mL, preferably 3˜6 mg/mL.

    17. The preparation method according to claim 6, wherein before the cross-linking agent glutaraldehyde or dextran aldehyde is used, it further comprises a step of modifying the cross-linking agent with a polyethylene glycol (PEG), and the PEG modification of the cross-linking agent glutaraldehyde or dextran aldehyde comprises dissolving the cross-linking agent with water, adding the PEG, and stirring at 20˜30° C. for 1˜6 h, wherein the PEG is selected from PEG400˜PEG2000, and the mass ratio of PEG to the cross-linking agent is 1:1˜10:1, further preferably 2:1˜4:1.

    18. The preparation method according to claim 7, wherein in the step of oxidizing the epoxy resin with the sodium periodate, the concentration of the sodium periodate in sodium periodate solution used is 50˜500 mM, preferably 100˜200 mM; and the volume-to-mass ratio of the sodium periodate solution to the epoxy resin is 5˜20:1, preferably 5˜15:1.

    19. The preparation method according to claim 7, wherein the molecular weight of the polyethyleneimine is 3 KDa˜70 KDa, and the concentration of the polyethyleneimine aqueous solution is 0.5%˜3%, preferably 1%˜2%; and pH of the polyethyleneimine aqueous solution is 6˜11, further preferably 7˜10.

    20. The preparation method according to claim 7, wherein preferably, the volume/mass final concentration of the cross-linking agent glutaraldehyde or dextran aldehyde is 0.1%˜3%, preferably 0.3%˜2%.

    Description

    DETAILED DESCRIPTION OF THE EMBODIMENTS

    [0032] It should be noted that embodiments in the present application and features of the embodiments may be combined with each other in the case without conflicting. The present disclosure is described in detail below in combination with the embodiments.

    EXPLANATION OF TERMS AND ABBREVIATIONS

    [0033] IDA: Iminodiacetic acid disodium salt hydrate.

    [0034] GA: Glutaraldehyde

    [0035] PEI: Polyethyleneimine

    [0036] PEG: Polyethylene glycol

    [0037] In most cases, biocatalysis can rely on efficient biological catalysts. Enzymes are versatile biological catalysts with high stereoselectivity and regioselectivity and a high turnover rate. However, free enzymes are relatively sensitive and unstable, and they cannot be recovered and reused efficiently. To overcome these limitations and broaden their applicability, before use, free enzymes are usually attached to an inert, insoluble material via immobilization.

    [0038] Epoxy resins have been used in immobilization of several kinds of enzymes like lipase, acylases, the process is very simple and easy to handle, but enzyme should be purified before immobilization to get positive activity recovery, and activity recovery is still not as good as other immobilization protocols even pure enzyme is used. In view of this, the present application proposes the following technical solution.

    [0039] According to a typical embodiment of the present disclosure, a preparation method for a modified epoxy resin immobilized enzyme is provided. The preparation method includes the following steps: modifying an epoxy resin, adding a polyethyleneimine to a modified epoxy resin for further modification, and then adding an enzyme to be immobilized and a glutaraldehyde for immobilization, to obtain the modified epoxy resin immobilized enzyme.

    [0040] By applying the technical scheme of the present disclosure, the epoxy resin is modified, the polyethyleneimine is added to the modified epoxy resin for the further modification, and an aldehyde group in the resin and an amino group in the polyethyleneimine are covalently bound to each enzyme, then it is activated by the bifunctional reagent glutaraldehyde. In this way, a steric resin arm is increased, to form a network structure, it may be more easily bound to the enzyme by covalent binding, and the enzyme load may also be improved because the steric inhibition is reduced.

    [0041] In a typical embodiment of the present disclosure, the step of modifying the epoxy resin includes using a sodium periodate to oxidize the epoxy resin or using an iminodiacetic acid to react with the epoxy resin, as to obtain the epoxy resin with the improved performance. Preferably, while the step of modifying the epoxy resin is to use the sodium periodate to oxidize the epoxy resin, before the sodium periodate is added, an acetic acid is firstly used to treat the epoxy resin, and after the enzyme to be immobilized and the glutaraldehyde are added for immobilization, it further includes a step of adding a cross-linking agent glutaraldehyde or dextran aldehyde for secondary cross-linking, so that the immobilization is stronger.

    [0042] In the present application, the modification of the epoxy resin with iminodiacetic acid and metal is modified. After the epoxy resin is reacted with the iminodiacetic acid, PEI is added and bound to the resin by ionic attachment, and then it is treated with the suitable metal. After that, a His-tagged enzyme is added, and then glutaraldehyde cross-linking is performed so that the attachment is stronger. PEI may bind to the metal stronger than the iminodiacetic acid, and may also cross-link with the glutaraldehyde, so that the enzyme leakage is much reduced. According to a typical embodiment of the present disclosure, while the step of modifying the epoxy resin is to use the iminodiacetic acid to react with the epoxy resin, after the polyethyleneimine is added to the modified epoxy resin for further modification, it further includes a step of adding metal ion solution for treatment, and the enzyme to be immobilized has a his tag; preferably, the metal ion solution is selected from one or more of a cobalt chloride, a cobalt sulfate, a nickel chloride, a copper sulfate, a ferrous chloride or a ferrous sulfate; and preferably, the concentration of the metal ion solution is 5˜100 mmol/L, preferably 10˜50 mmol/L.

    [0043] Preferably, the adding sequence of the enzyme to be immobilized and the glutaraldehyde is the enzyme to be immobilized and the glutaraldehyde, or the glutaraldehyde and the enzyme to be immobilized successively.

    [0044] According to a typical embodiment of the present disclosure, in the step of adding the polyethyleneimine to the modified epoxy resin for further modification, it further includes adding a cofactor, and the cofactor is NAD+, NADP+ or PLP; preferably, the polyethyleneimine participates in the reaction in the form of polyethyleneimine aqueous solution, and the final concentration of the cofactor in the polyethyleneimine aqueous solution is 1˜10 mg/mL, preferably 3˜6 mg/mL; and preferably, before the cross-linking agent glutaraldehyde or dextran aldehyde is used, it further comprises a step of modifying the cross-linking agent with PEG, and the PEG modification of the cross-linking agent glutaraldehyde or dextran aldehyde includes dissolving the cross-linking agent with water, adding the PEG, and stirring at 20˜30° C. for 1˜6 h, herein the PEG is selected from PEG400˜PEG2000, and the mass ratio of PEG to the cross-linking agent is 1:1˜10:1, the reusability is good, and further preferably it is 2:1˜4:1.

    [0045] According to a typical embodiment of the present disclosure, in the step of treating the epoxy resin with the acetic acid, the acetic acid used is acetic acid solution, and the concentration of the acetic acid in the acetic acid solution is 0.5˜3 M, preferably 1˜2 M; and the volume-to-mass ratio of the acetic acid solution to the epoxy resin is 5˜20:1, preferably 10˜15:1; preferably, in the step of oxidizing the epoxy resin with the sodium periodate, the concentration of the sodium periodate in sodium periodate solution used is 50˜500 mM, preferably 100˜200 mM; and the volume-to-mass ratio of the sodium periodate solution to the epoxy resin is 5˜20:1, preferably 5˜15:1; preferably, the molecular weight of the polyethyleneimine is 3 KDa˜70 KDa, and the concentration of the polyethyleneimine aqueous solution is 0.5%˜3%, preferably 1%˜2%; and pH of the polyethyleneimine aqueous solution is 6˜11, further preferably 7˜10; preferably, the volume/mass final concentration of the cross-linking agent glutaraldehyde or dextran aldehyde is 0.1%˜3%, preferably 0.3%˜2%; preferably, the mass ratio of the enzyme to the modified epoxy resin is 0.05˜0.3:1; and preferably, in the step of using the iminodiacetic acid to react with the epoxy resin, the iminodiacetic acid used is iminodiacetic acid aqueous solution, the concentration of the iminodiacetic acid aqueous solution is 0.5˜3 M, preferably 1˜2 M, and the volume-to-mass ratio of the iminodiacetic acid aqueous solution to the epoxy resin is 5˜20:1, preferably 10˜15:1; and pH of the iminodiacetic acid aqueous solution is 6.0˜10.0, preferably 7.0˜9.0, the stability is best.

    [0046] According to a typical embodiment of the present disclosure, the treatment time after the acetic acid is mixed with the epoxy resin is 6˜24 h, preferably 10˜15 h; preferably, the reaction time after the sodium periodate solution is mixed with the epoxy resin is 1˜6 h, preferably 2˜3 h; preferably, the reaction time after the polyethyleneimine aqueous solution is mixed with the epoxy resin is 1˜20 h, preferably 3˜6 h; preferably, the reaction time after the enzyme is mixed with the modified epoxy resin is 2˜24 h, preferably 15˜20 h; preferably, after the cross-linking agent is added, the reaction time is 10˜120 min, preferably 20˜60 min; preferably, the action time after the iminodiacetic acid aqueous solution is mixed with the epoxy resin is 0.5˜6 h, preferably 1˜2 h; and preferably, the action time after the polyethyleneimine aqueous solution is mixed with a support is 1˜20 h, further, it is 3˜6 h; after the metal containing solution are added, the action time is 1˜6 h, further, it is 1˜3 h; and the action time after the enzyme solution is mixed with the support is 4˜48 h, and further, the action time is 15˜20 h.

    [0047] According to a typical embodiment of the present disclosure, the epoxy resin is selected from one or more in a group consisting of Purolite®Lifetech™ECR8285, ECR8204, ECR8209, SEPLITE®LX1000EA, LX1000EP, LX103B, EP200, LX1000HFA, HFA001, LX107S, LX1000SW, LX1000SD, HECHENG®ES1, ES103, ES105, ES108 or ES109.

    [0048] According to a typical embodiment of the present disclosure, the enzyme to be immobilized is selected from one or more in a group consisting of a transaminase derived from Chromobacterium violaceum DSM30191, a transaminase derived from Aspergillus fumigatus, a transaminase derived from Vibrio fluvialis strain JSI7, a ketoreductase derived from Acetobacter sp. CCTCC M209061, a ketoreductase derived from Candida macedoniensis AKU4588, a cyclohexanone monooxygenase derived from Rhodococcus sp. Phi1, a cyclohexanone monooxygenase derived from Brachymonas petroleovorans, a monooxygenase derived from Rhodococcus ruber-SD1, an ammonia lyase derived from photorhabdus luminescens, an ammonia lyase derived from Solenostemon scutellarioides, an Ene reductase derived from Saccharomyces cerevisiae, an Ene reductase derived from ChrySEQbacterium sp. CA49, an imine reductase derived from Streptomyces sp or Bacillus cereus, a leucine dehydrogenase derived from Bacillus cereus, a phenylalanine dehydrogenase derived from Bacillus sphaericus, a nitrilase derived from Aspergillus niger CBS 513.88 and a nitrilase derived from Neurospora crassa OR74A; and the transaminase derived from Chromobacterium violaceum DSM30191 is a mutant having a sequence of SEQ ID NO: 2 or SEQ ID NO: 3; the transaminase derived from Arthrobacter citreus is a mutant having a sequence of SEQ ID NO: 5 or SEQ ID NO: 6; the ketoreductase derived from Acetobacter sp. CCTCC M209061 is a mutant having a sequence of SEQ ID NO: 8 or SEQ ID NO: 9; the cyclohexanone monooxygenase derived from Rhodococcus sp. Phi1 is a mutant having a sequence of SEQ ID NO: 11 or SEQ ID NO: 12; and the cyclohexanone monooxygenase derived from Rhodococcus ruber-SD1 is a mutant having a sequence of SEQ ID NO: 14 or SEQ ID NO: 15.

    [0049] The chemical processes involved in the reactions of the above enzymes is briefly described as follows:

    ##STR00001##

    [0050] R, R.sub.1 and R.sub.2 in the above reaction formulas may be each independently selected from H, a substituted or unsubstituted alkyl, a substituted or unsubstituted cycloalkyl, a substituted or unsubstituted aralkyl, a substituted or unsubstituted heterocyclyl, a substituted or unsubstituted heterocycloalkyl, or a fused ring system formed by R.sub.1 and its linked heterocycle.

    [0051] According to a typical embodiment of the present disclosure, a modified epoxy resin immobilized enzyme is provided. The immobilized enzyme is prepared by any one of the above preparation methods.

    [0052] According to a typical embodiment of the present disclosure, an application of the modified epoxy resin immobilized enzyme in an aqueous buffer reaction system or an organic solvent reaction system is provided. Preferably, the aqueous buffer reaction system or the organic solvent reaction system is reacted in a packed bed reactor or a continuous stirred tank reactor.

    [0053] In a typical embodiment of the present disclosure, the epoxy resins (for example, the epoxy resins shown in Table 2, herein Epoxy is an epoxy group) are modified, thereby the reusability of the epoxy resin immobilized enzyme is improved.

    TABLE-US-00002 TABLE 2 Resin name Resin functional group ECR8285 Epoxy/C4 ECR8204 Epoxy ECR8209 Epoxy LX1000EA Epoxy LX1000EP Epoxy EP200 Epoxy LX1000HFA Amino-Epoxy HFA001 Amino-Epoxy LX103B Epoxy LX107S Epoxy LX1000SW Epoxy LX1000SD Epoxy ES1 Epoxy ES103 Epoxy ES105 Epoxy ES108 Epoxy ES109 Epoxy

    [0054] Typically, the properties of the epoxy resins are changed by oxidizing the epoxy resins with the sodium periodate or modifying the epoxy resins with the iminodiacetic acid. The specific description is as follows:

    [0055] I. Immobilization of Enzymes on Sodium Periodate Oxidized Epoxy Resins

    [0056] After oxidation by sodium periodate, oxidized epoxy resins were further modified by PEI or PEI along with cofactors for each enzyme accordingly through covalent binding between aldehyde group in resin and amino group in PEI, followed by activation by bifunctional reagent glutaraldehyde, through this way, space arm of resin increased and net structure formed, and enzyme can be combined much easier by covalent binding because of reduced steric inhibition, and enzyme loading could also be improved. To make immobilization stronger, extra linker like glutaraldehyde or dextran aldehyde was added for secondary cross-linking.

    [0057] Enzyme also can be combined on PEI modified oxidized epoxy resin by ionic adsorption primarily, followed by adding glutaraldehyde to perform crosslinking between enzyme, PEI and resin to form net structure and strong combination.

    [0058] II. Immobilization of Enzymes on Iminodiacetic Modified Epoxy Resins

    [0059] It is previously reported to immobilize the His-tagged enzyme on the metal-modified epoxy resin. The epoxy resin was first reacted with iminodiacetic acid to convert part of the epoxides on the surface of the beads and then treated with a suitable metal ion solution for the complexation on the resin. His-tagged enzyme was then added and a selective interaction between the poly-histidine tag and the metal allowed for a quick complexation, followed by a reaction between nucleophilic residues on the protein surface (Lys, Cys, or Ser) and the unreacted epoxy residues on the beads to give a successful along with covalent immobilization. The metal ion was then removed by washing with an EDTA solution. To ensure that no reactive epoxide remained, the beads were finally treated with glycine as capping agent. Main enzyme can be specifically bound onto resin, but stability was still not very good, after 6 cycles, less than 10% residual activity left. Complexation of metal and iminodiacetic acid modified resin was not strong enough, and enzyme can be easily leaked out.

    [0060] In the present application, modification of epoxy by iminodiacetic acid and metal was revised. After reaction with iminodiacetic acid, PEI was added and combined with resin by ionic attachment, and then treated with suitable metal. Then His-tagged enzyme was added, and followed by glutaraldehyde crosslinking to make the attachment stronger. PEI can bind metal stronger than iminodiacetic acid, along with cross linking by glutaraldehyde, made enzyme leaking out reduce a lot.

    [0061] To make the technical solution suitable for enzymes without His-tag, metal was not used after PEI modification, glutaraldehyde was added and form covalent binding with PEI and residual hydroxyl residual on surface of epoxy resin, then enzyme was added and bounded with covalent attachment.

    [0062] In both methods, Enzyme also can be added before glutaraldehyde addition, and ionic adsorbed primarily with PEI and affinity adsorption, followed by adding glutaraldehyde to perform crosslinking between enzyme, PEI and resin to form net structure and strong combination.

    [0063] The beneficial effects of the present disclosure are further described below in combination with the embodiments.

    [0064] The enzymes used in the following embodiments and its sources are shown in Tables 3˜8 below.

    TABLE-US-00003 TABLE 3 Enzyme Short name Species origin D-amino acid TA-Bt B. thuringiensis transaminase Pyruvate TA-Vf Vibrio fluvialis strain JS17 aminotransferase Ketoreductase KRED-Ss Sporobolomyces salmonicolor KRED-Cm Candida macedoniensis. AKU4588 Alcohol ADH-Tb Thermoanaerobium brockii dehydrogenase D-lactate D-LDH Lactobacillus helveticus dehydrogenase Ammonium formate FDH Candida boidinii dehydrogenase Glucose GDH Lysinibacillus sphaericus G10 1-dehydrogenase Cyclohexanone CHMO-Rs Rhodococcus sp. Phi1 monooxygenase CHMO-Bp Brachymonas petroleovorans CHMO-Rr Rhodococcus ruber-SD1 Ene reductase ERED-Sc Saccharomyces cerevisiae ERED-Chr ChrySEQbacterium sp. CA49 Imine reductase IRED-Str Streptomyces sp. IRED-Bc Bacillus cereus Leucine AADH-Bc Bacillus cereus dehydrogenase Phenylalanine AADH-Bs Bacillus sphaericus dehydrogenase

    TABLE-US-00004 TABLE 4 Sequence TA-Cv number Sequence Female SEQ ID NO: 1 MQKQRTTSQWRELDAAHHLHPFTDTASLNQAGARVMTR parent GEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARR QMEELPFYNTFFKTTHPAVVELSSLLAEVTPAGFDRVFYTN SGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGS TIGGASLGGMKYMHEQGDLPIPGMAHIEQPWWYKHGKD MTPDEFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGVI VPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQ HFGFQPDLFTAAKGLSSGYLPIGAVFVGKRVAEGLIAGGDF NHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDDIGPYM QKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKRELFP DFGEIGTLCRDIFFRNNLIMRACGDHIVSAPPLVMTRAEVD EMLAVAERCLEEFEQTLKARGLA Mutant 1 SEQ ID NO: 2 R416T + T7C + S47C + Q380L (TA-Cv-V1) Mutant 2 SEQ ID NO:  3 R416T + T7C + S47C + R405E + K90G + A95P +  (TA-CV-V2) 304D + Q380L + I297L

    TABLE-US-00005 TABLE 5 Sequence TA-Ac number Sequence Female SEQ ID NO: 4 MGLTVQKINWEQVKEWDRKYLMRTFSTQNEYQPVPIESTE parent GDYLITPGGTRLLDFFNQLCCVNLGQKNQKVNAAIKEALDRY GFVWDTYATDYKAKAAKIIIEDILGDEDWPGKVRFVSTGSEA VETALNIARLYTNRPLVVTREHDYHGWTGGAATVTRLRSFRS GLVGENSESFSAQIPGSSCSSAVLMAPSSNTFQDSNGNYLK DENGELLSVKYTRRMIENYGPEQVAAVITEVSQGVGSTMPP YEYVPQIRKMTKELGVLWISDEVLTGFGRTGKWFGYQHYGV QPDIITMGKGLSSSSLPAGAVVVSKEIAAFMDKHRWESVSTY AGHPVAMAAVCANLEVMMEENLVEQAKNSGEYIRSKLELLQ EKHKSIGNFDGYGLLWIVDIVNAKTKTPYVKLDRNFRHGMNP NQIPTQIIMEKALEKGVLIGGAMPNTMRIGASLNVSRGDIDKA MDALDYALDYLESGEWQQS Mutant SEQ ID NO: 5 L3S + V5S + C60Y + F164L + A178L + S187A + I180V + L370A + 1 (TA-Ac- G411D + S186G + Y384F + I389F + V252I + L404Q + E171D V1) Mutant 2 SEQ ID NO: 6 L3S + V5S + C60Y + F164L + A178L + S187A + I180V + L370A + (TA-Ac- G411D + S186G + Y384F + I389F + V252I + E424Q + M423K V2)

    TABLE-US-00006 TABLE 6 Sequence KRED-Ac number Sequence Female SEQ ID NO: 7 MARVAGKVAIVSGAANGIGKATAQLLAKEGAKVVIGDLKEED parent GQKAVAEIKAAGGEAAFVKLNVTDEAAWKAAIGQTLKLYGRL DIAVNNAGINYSGSVESTSLEDWRRVQSINLDGVFLGTQVAI EAMKKSGGGSIVNLSSISGLIGDPMLAAYVASKGGVRLFTKS AALHCAKSGYKIRVNSVHPGYIWTPMVAGLTKEDAAARQKLV DLHPIGHLGEPNDIAYGILYLASDESKFVTGSELVIDGGYTAQ Mutant 1 SEQ ID NO: 8 E144S + A94N + N156V (KRED-Ac- V1) Mutant 2 SEQ ID NO: 9 E144S + A94T + N156T (KRED-Ac- V2)

    TABLE-US-00007 TABLE 7 Sequence CHMO-Rs number Sequence Female SEQ ID NO: 10 MTAQISPTVVDAVVIGAGFGGIYAVHKLHNEQGLTVVGFDK parent ADGPGGTWYWNRYPGALSDTESHLYRFSFDRDLLQDGTW KTTYITQPEILEYLESVVDRFDLRRHFRFGTEVTSAIYLEDEN LWEVSTDKGEVYRAKYVVNAVGLLSAINFPDLPGLDTFEGE TIHTAAWPEGKNLAGKRVGVIGTGSTGQQVITALAPEVEHLT VFVRTPQYSVPVGNRPVTKEQIDAIKADYDGIWDSVKKSAV AFGFEESTLPAMSVSEEERNRIFQEAWDHGGGFRFMFGTF GDIATDEAANEAAASFIRSKIAEIIEDPETARKLMPTGLYAKR PLCDNGYYEVYNRPNVEAVAIKENPIREVTAKGVVTEDGVL HELDVLVFATGFDAVDGNYRRIEIRGRNGLHINDHWDGQPT SYLGVTTANFPNWFMVLGPNGPFTNLPPSIETQVEWISDTV AYAERNEIRAIEPTPEAEEEWTQTCTDIANATLFTRGDSWIF GANVPGKKPSVLFYLGGLGNYRNVLAGVVADSYRGFELKS AVPVTA Mutant 1 SEQ ID NO: 11 F508Y + F435N + L438A + T436S + F280V + S441V (CHMO-Rs- Cv-V1) Mutant 2 SEQ ID NO: 12 F508Y + F435N + L438A + T436S + F280V + S441V + L510V (CHMO-Rs- V2)

    TABLE-US-00008 TABLE 8 Sequence CHMO-Rr number Sequence Female SEQ ID NO: 13 MTTSIDREALRRKYAEERDKRIRPDGNDQYIRLDHVDGWS parent HDPYMPITPREPKLDHVTFAFIGGGFSGLVTAARLRESGVE SVRIIDKAGDFGGVWYWNRYPGAMCDTAAMVYMPLLEET GYMPTEKYAHGPEILEHCQRIGKHYDLYDDALFHTEVTDLV WQEHDQRWRISTNRGDHFTAQFVGMGTGPLHVAQLPGIP GIESFRGKSFHTSRWDYDYTGGDALGAPMDKLADKRVAVI GTGATAVQCVPELAKYCRELYVVQRTPSAVDERGNHPIDEK WFAQIATPGWQKRWLDSFTAIWDGVLTDPSELAIEHEDLVQ DGWTALGQRMRAAVGSVPIEQYSPENVQRALEEADDEQM ERIRARVDEIVTDPATAAQLKAWFRQMCKRPCFHDDYLPAF NRPNTHLVDTGGKGVERITENGVVVAGVEYEVDCIVYASGF EFLGTGYTDRAGFDPTGRDGVKLSEHWAQGTRTLHGMHT YGFPNLFVLQLMQGAALGSNIPHNFVEAARVVAAIVDHVLS TGTSSVETTKEAEQAWVQLLLDHGRPLGNPECTPGYYNNE GKPAELKDRLNVGYPAGSAAFFRMMDHWLAAGSFDGLTFR Mutant SEQ ID NO: 14 P190L  +  Y559M  +  C249V  +  C393V  +  1(CHMO-Rr C257A  +  M45T -V1) Mutant 2 SEQ ID NO: 15 Y559M  +  P190L  +  P504V (CHMO-Rr- V2)

    Embodiment 1

    [0065] Immobilization of Enzymes on Sodium Periodate Oxidized Epoxy Resins

    [0066] 5 g of an epoxy resin ECR8285 or LX1000EP is added to 20 mL of 1 M acetic acid respectively, it is mild stirred at a room temperature for 12 h, a support treated with the acetic acid is washed for 3 times with 20 mL of distilled water, and the treated support is suspended in 20 mL of 50 mM sodium periodate. It is mild stirred at the room temperature for 2 h, filtered and washed with the distilled water.

    [0067] 5 g of a modified epoxy resin is resuspended in 0.1 M phosphate buffer (PB), PEI is added, the final concentration is 1%, and pH is adjusted to pH 7.0. After being mild stirred for 2 h, 50-100 mM glutaraldehyde is added, and it is mild stirred at the room temperature for 1-2 h. Then the support resin is filtered and washed with 10 ml of water. The washed support is added to enzyme solution (10 ml of an enzyme, containing 5 mg/mL of a cofactor, dissolved in 40 mL of 100 mM PB, pH 7.0), it is stirred at 10-25° C. for 4 h, and overnights in a refrigerator. After standing overnight, the enzyme is filtered, and washed with 0.1 M PB (pH 7.0). Optionally, after standing overnight, excess glutaraldehyde (20-50 mM) or dextran aldehyde (10-50 mM) is added to solution, it is mild stirred for 1 h at 10-25° C., then filtered and washed with 0.1 M PB (pH 7.0).

    Embodiment 2

    [0068] Immobilization of enzymes on sodium periodate oxidized epoxy resins

    [0069] 5 g of epoxy beads are added to 50 mL of 1 M acetic acid, it is mild stirred at a room temperature for 12 h, a support treated with the acetic acid is washed for 3 times with 50 mL of distilled water, it is mild stirred for 10 minutes each time, and the treated support is suspended in 100 mL of a sodium periodate. It is mild stirred at the room temperature for 2 h, filtered and washed with the distilled water.

    [0070] 5 g of a modified epoxy resin is resuspended in 0.1 M PB, PEI is added, the final concentration is 1%, pH is adjusted to pH 7.0, and it is mild stirred for 2 h. Then the support is filtered and washed with 10 ml of water. The washed support is added to enzyme solution (10 ml of an enzyme, containing 5 mg/mL of a cofactor, dissolved in 40 mL of 100 mM PB, pH 7.0), it is stirred at the room temperature for 4 h, and overnights in a refrigerator. After standing overnight, 20-100 mM of a glutaraldehyde is added to solution, it is mild stirred at 10-25° C. for 1 h, then then filtered and washed with 0.1 M PB (pH 7.0).

    Embodiment 3

    [0071] Immobilization of enzyme on iminodiacetic modified epoxy resin

    [0072] 4 g of a support is added to 8 mL of a support modification buffer (0.1 M sodium borate, 1 M iminodiacetic acid, pH 8.5), and it is shaken at a room temperature for 2 h. After 2 h, the support is filtered to remove the support modification buffer and washed with double distilled water, then resuspended with PB, and PEI is added so that the final concentration of PEI is 1%, pH is adjusted to 8.0-11.0, and it is mixed and mild stirred for 3 h. The support is filtered and washed for 3 times with 30 mL of water, then resuspended in 20 mL of PB, and metal containing solution are added, so that the concentration of the metal ions is 10-30 mM. The metal ions are selected from CoCl.sub.2 or NiCl.sub.2.6H.sub.2O or CuSO.sub.4.5H.sub.2O or FeCl.sub.2 or FeCl.sub.2.

    [0073] It is shaken for 2 h at the room temperature. The resin is rinsed again with the double distilled water and washed with 0.1 M PB (pH 8.0). It is resuspended again (pretreated with a cofactor according to each enzyme) in a buffer containing 50 mM glutaraldehyde (0.1 M PB pH=8.0), and mild stirred for 1 h at the room temperature. It is filtered and washed for 3 times with 0.1M PB (pH=7.0).

    [0074] The pretreated resin is resuspended with 16 mL of 0.1 M PB (pH=7.0), 4-8 mL of enzyme solution (50-100 mg/mL of the protein content, and 3-10 mg/mL of the cofactor) is added, it is mild stirred for 30 minutes, and filtered after overnight. It is washed twice with 20 ml of 0.05 M PB (pH 7.5, it contains 0.05 M EDTA and 0.5 M NaCl), and mild stirred for 10 minutes each time. Subsequently, it is washed for 3 times with 20 ml of water, and then washed with 0.1 M PB (pH 7.5).

    Embodiment 4

    [0075] Immobilization of Enzyme on Iminodiacetic Modified Epoxy Resin

    [0076] 4 g of a support is added to 8 mL of a support modification buffer (0.1 M sodium borate, 1 M iminodiacetic acid, pH 8.5), and it is shaken at a room temperature for 2 h. After 2 h, the support is filtered to remove the support modification buffer and washed with double distilled water, then resuspended with PB, and PEI is added so that the final concentration of PEI is 1%, pH is adjusted to 8.0-11.0, and it is mixed and mild stirred for 3 h. The support is filtered and washed for 3 times with 30 mL of water, then resuspended in 20 mL of PB, and metal containing solution are added, so that the concentration of the metal ions is 10-30 mM. The metal ions are selected from CoCl.sub.2 or NiCl.sub.2.6H.sub.2O or CuSO.sub.4.5H.sub.2O or FeCl.sub.2 or FeCl.sub.2.

    [0077] It is shaken for 2 h at the room temperature. The resin is rinsed again with the double distilled water and washed with 0.1 M PB (pH 8.0). It is resuspended again with 16 mL of a buffer (0.1 M PB pH=8.0), 4-8 mL of enzyme solution (50-100 mg/mL of the protein content, and 3-10 mg/mL of the cofactor) is added, it is continuously mild stirred for 30 minutes, and filtered after overnight. It is washed twice with 20 ml of 0.05 M PB (pH 7.5, it contains 0.05 M EDTA and 0.5 M NaCl), and mild stirred for 10 minutes each time. Subsequently, it is washed for 3 times with 20 ml of water, and then washed with 0.1 M PB (pH 7.5).

    Embodiment 5

    [0078] Immobilization of Enzyme on Iminodiacetic Modified Epoxy Resin

    [0079] 4 g of a support is added to 8 mL of a support modification buffer (0.1 M sodium borate, 1 M iminodiacetic acid, pH 8.5), and it is shaken at a room temperature for 2 h. After 2 h, the support is filtered to remove the support modification buffer and washed with double distilled water, then resuspended with PB, and PEI is added so that the final concentration of PEI is 1%, pH is adjusted to 8.0-11.0, and it is suspended and mild stirred for 3 h. The support is filtered and washed for 3 times with 30 mL of water, then resuspended in 20 mL of PB, and metal containing solution are added, so that the concentration of the metal ions is 10-30 mM. The metal ions are selected from CoCl.sub.2 or NiCl.sub.2.6H.sub.2O or CuSO.sub.4.5H.sub.2O or FeCl.sub.2 or FeCl.sub.2.

    [0080] The support is filtered and washed for 3 times with 30 ml of water, and then resuspended in 16 mL of PB (0.1 M pH=8.0), 4-8 mL of enzyme solution (50-100 mg/mL of the protein content, and 3-10 mg/mL of the cofactor) is added, it is continuously mild stirred for 30 minutes, and filtered after overnight. 16 mL of 0.1 M PB (pH=8.0, 5 mg/ml of the cofactor and 50 mM glutaraldehyde) is added, and it is shaken gently for 30 minutes at the room temperature. It is washed twice with 20 ml of 0.05 M PB (pH 7.5, it contains 0.05 M EDTA and 0.5 M NaCl), and mild stirred for 10 minutes each time. Subsequently, it is washed for 3 times with 20 ml of water, and then washed with 0.1 M PB (pH 7.5).

    Embodiment 6

    [0081] Immobilization of Enzyme on Iminodiacetic Modified Epoxy Resin

    [0082] 4 g of a support is added to 8 mL of a support modification buffer (0.1 M sodium borate, 1 M iminodiacetic acid, pH 8.5), and it is shaken at a room temperature for 2 h. After 2 h, the support is filtered to remove the support modification buffer and washed with double distilled water, then resuspended with PB, and PEI is added so that the final concentration of PEI is 1%, pH is adjusted to 8.0-11.0, and it is mild stirred for 3 h. The support is filtered and washed for 3 times with 30 mL of water, then resuspended in 20 mL of PB, and metal containing solution are added, so that the concentration of the metal ions is 10-30 mM. The metal ions are selected from CoCl.sub.2 or NiCl.sub.2.6H.sub.2O Or CuSO.sub.4.5H.sub.2O or FeCl.sub.2 or FeCl.sub.2.

    [0083] The support is filtered and washed for 3 times with 30 ml of water, the pretreated support is resuspended in 16 mL of PB (0.1 M pH=8.0), 4-8 mL of enzyme solution (50-100 mg/mL of the protein content, and 3-10 mg/mL of the cofactor) is added, it is continuously mild stirred for 30 minutes, and filtered after overnight. 16 mL of 0.1 M PB (pH=8.0, 5 mg/ml of the cofactor and 50 mM glutaraldehyde) is added, and it is shaken gently for 30 minutes at the room temperature. It is washed twice with 20 ml of 0.05 M PB (pH 7.5, it contains 0.05 M EDTA and 0.5 M NaCl), and mild stirred for 10 minutes each time. Subsequently, it is washed for 3 times with 20 ml of water, and then washed with 0.1 M PB (pH 7.5).

    [0084] Or the pretreated resin is resuspended with 16 mL of 0.1 M PB (pH=7.0), 4-8 mL of enzyme solution (50-100 mg/mL of the protein content, and 3-10 mg/mL of the cofactor) is added, it is mild stirred for 30 minutes, and filtered after overnight. It is washed twice with 20 ml of 0.05 M PB (pH 7.5, it contains 0.05 M EDTA and 0.5 M NaCl), and mild stirred for 10 minutes each time. Subsequently, it is washed for 3 times with 20 ml of water, and then washed with 0.1 M PB (pH 7.5).

    Embodiment 7

    [0085] As in Embodiment 2, the glutaraldehyde is changed to a PEI-modified glutaraldehyde, the molecular weight of PEG is 6000 Da, and the mass ratio of PEG to the glutaraldehyde is 1:1.

    Embodiment 8

    [0086] As in Embodiment 1, the glutaraldehyde is changed to aldehyde dextran.

    Embodiment 9

    [0087] As in Embodiment 5, the glutaraldehyde is changed to a PEI-modified glutaraldehyde, the molecular weight of PEG is 6000 Da, and the mass ratio of PEG to the glutaraldehyde is 1:1.

    Embodiment 10

    [0088] Conversion and reusability test of immobilized transaminase

    ##STR00002##

    [0089] In a 10 mL reaction bulb, 0.3 mL of MeOH is added, 0.1 g of a main raw material 1 or a main raw material 2 is dissolved, 4 eq of isopropylamine hydrochloride and 1.0 mg of pyridoxal-5′-phosphate (PLP) are added, and 0.1 M PB 7.0 is supplemented until the final volume of reaction solution is 1 mL, then 5 mg of enzyme powder or cross-linked enzyme aggregate wet enzyme or cross-linked enzyme aggregate lyophilized powder prepared from 20 mg of the enzyme powder is added, and it is stirred at 30° C. for 16-20 h. The conversion rate in the system is detected by a high performance liquid chromatography (HPLC), and reaction data is shown in Table 9 below:

    TABLE-US-00009 TABLE 9 Support modifi- Conversion Enzyme Support cation material (%) Cycles TA-Af Free enzyme −/− >97 1 LX1000EP No modification <50 2 IDA* 75-80 4 IDA.sup.1 80 12 IDA.sup.2 80 14 IDA.sup.3 80 14 IDA.sup.4 80 16 SP.sup.1 80 8 SP.sup.2 80 11 SP.sup.3 80 7 SP.sup.4 80 9 ECR8285 No modification <60 3 IDA.sup.1 80 10 IDA.sup.2 90 16 IDA.sup.3 80 13 IDA.sup.4 80 11 SP.sup.2 80 13 SP.sup.3 80 14 ECR8204 IDA* 75 4 IDA.sup.1 80 7 IDA.sup.2 80 8 SP.sup.2 75 7 SP.sup.3 75 6 ECR8209 IDA* 70 4 IDA.sup.1 80 8 IDA.sup.2 80 8 IDA.sup.4 80 9 SP.sup.2 75 8 ES1 IDA* 75-80 5 IDA.sup.1 80 9 IDA.sup.2 80 9 IDA.sup.4 75 8 SP.sup.2 75 8 SP.sup.3 75 6 ES103 IDA* 70 3 IDA.sup.1 80 9 IDA.sup.2 80 8 IDA.sup.4 80 8 SP.sup.2 80 6 SP.sup.3 75 6 TA-Ac Free enzyme −/− >97 1 LX1000EP No modification 85 2 IDA* >97 4 IDA.sup.1 >97 9 IDA.sup.2 >97 8 IDA.sup.4 >97 8 SP.sup.2 >97 9 SP.sup.3 >97 7 ECR8285 IDA* 85 3 IDA.sup.1 >97 7 IDA.sup.2 >97 11 IDA.sup.4 >97 13 SP.sup.2 >97 13 SP.sup.3 >97 15 ES1 IDA* 80 4 IDA.sup.1 >97 6 IDA.sup.2 >97 13 IDA.sup.4 >97 14 SP.sup.2 >97 12 SP.sup.3 >97 14 TA-Ac-V1 ECR8285 IDA.sup.2 >97 19 SP.sup.3 >97 19 TA-Ac-V2 ECR8285 IDA.sup.2 >97 18 SP.sup.3 >97 20 TA-Cv ECR8285 IDA.sup.1 >97 9 IDA.sup.2 >97 12 SP.sup.3 >97 13 TA-Cv-V1 ECR8285 SP.sup.3 >97 21 TA-Cv-V2 ECR8285 SP.sup.3 >97 24 IDA*-epoxy resin was modified by iminodiacitic-metal, it adsorbs and binds to the enzyme in affinity. IDA.sup.1-epoxy resin was modified by iminodiacitic, followed by PEI and metal, and treated with a cross-linking agent before addition of enzyme; IDA.sup.2-epoxy resin was modified by iminodiacitic, followed by PEI and metal, enzyme was added before a cross-linking agent; IDA.sup.3-epoxy resin was modified by iminodiacitic, followed by PEI and metal, and treated with a PEG-treated cross-linking agent before addition of enzyme; IDA.sup.4-epoxy resin was modified by iminodiacitic, followed by PEI and metal, enzyme was added before a PEG-treated cross-linking agent; SP.sup.1-epoxy resin was oxidized by sodium periodate, followed by PEI modification, and treated with a cross-linking agent before addition of enzyme SP.sup.2-epoxy resin was oxidized by Sodium periodate, followed by PEI modification, and treated with a cross-linking agent before addition of enzyme, extra the cross-linking agent was added at last; SP.sup.3-epoxy resin was oxidized by sodium periodate, followed by PEI modification, enzyme was added before a cross-linking agent; SP.sup.4-epoxy resin is oxidized by the sodium periodate, followed byPEI and metal, combined with the enzyme, and then further cross-linked with a PEG-treated cross-linking agent.

    Embodiment 11

    [0090] Conversion and Reusability Test of Immobilized Ketoreductase

    ##STR00003##

    [0091] In a 10 mL reaction bulb, 0.5 mL of isopropanol (IPA) is added, 0.1 g of a main raw material 3 or 4 is dissolved, 0.5 mL of 0.1 M PB 7.0 and 1-10 mg of NAD+ are added, then 5 mg of enzyme powder or the immobilized enzyme prepared from 10 mg of the enzyme powder is added, it is stirred at 30° C. for 16-20 h. The conversion rate of the system is detected by a gas chromatography (GC), and reaction data is shown in Table 10 below:

    TABLE-US-00010 TABLE 10 Support modifi- Conversion Enzyme Support cation material (%) Cycles KRED-Ac Free enzyme −/− >99 1 LX1000EA IDA* 60 2 IDA.sup.1 85 6 IDA.sup.2 85 5 IDA.sup.4 85 5 SP.sup.2 80 5 SP.sup.3 80 5 ECR8285 IDA* 90 4 IDA.sup.1 90 8 IDA.sup.2 90 9 IDA.sup.3 85 11 SP.sup.2 85 8 SP.sup.3 80 10 LX1000HFA IDA* 90 5 IDA.sup.3 90 11 SP.sup.2 90 12 ES1 IDA* 90 3 IDA.sup.1 85 6 IDA.sup.2 85 6 IDA.sup.4 80 6 SP.sup.2 80 7 SP.sup.3 80 6 ES105 IDA* 85 2 IDA.sup.1 85 5 IDA.sup.2 85 4 IDA.sup.4 80 6 SP.sup.2 80 5 SP.sup.3 80 5 KRED-Ac-V1 LX1000HFA SP.sup.2 90 15 KRED-Ac-V2 LX1000HFA SP.sup.2 90 18 KRED-Am Free enzyme −/− 90 1 LX1000EP IDA* 70 5 IDA.sup.1 85 9 IDA.sup.2 85 13 IDA.sup.4 80 10 SP.sup.2 90 11 SP.sup.3 85 12

    Embodiment 12

    [0092] Conversion and Reusability Test of Immobilized CHMOs

    [0093] The activity of the CHMO epoxy support immobilized enzyme is detected by performing a reaction on the following substrate 5:

    ##STR00004##

    [0094] 0.3 mL of isopropanol is loaded into a 10 mL reaction bulb, subsequently 100 mg of a substrate 5 is added, 3 mL of 0.1 M PB (pH 8.0) containing 5 mg of NADP+ is added, and then 2 mg of alcohol dehydrogenase ADH-Tb free enzyme and 20 mg of cyclohexanone monooxygenase free enzyme immobilized enzyme prepared from 50 mg of the free enzyme are added. It is reacted at 30° C. for 16-20 h to test the conversion rate. After each round of the reaction, the immobilized enzyme is separated and reused in the next round of the reaction, and the number of reuses is investigated. The conversion rate of the system is detected by GC, and reaction data is shown in Table 11 below:

    TABLE-US-00011 TABLE 11 Support modifi- Conversion Enzyme Support cation material (%) Cycles CHMO-Bp Free enzyme −/− >99 1 HFA001 IDA* 60 4 IDA.sup.1 85 5 IDA.sup.2 85 7 IDA.sup.4 85 7 SP.sup.2 80 6 SP.sup.4 80 7 LX1000HFA IDA* 90 6 IDA.sup.1 90 8 IDA.sup.2 90 8 IDA.sup.4 90 9 SP.sup.2 85 6 SP.sup.3 80 7 ECR8209 IDA.sup.1 85 5 IDA.sup.2 85 7 IDA.sup.4 80 8 SP.sup.2 80 6 SP.sup.4 80 7 LX103B IDA* 85 4 IDA.sup.1 85 6 IDA.sup.4 80 7 SP.sup.3 80 6 SP.sup.4 80 6 CHMO-Bp-V1 CHMO-Rr Free enzyme −/− 90 1 LX1000EP IDA* 70 5 IDA.sup.1 85 7 IDA.sup.2 85 9 IDA.sup.4 80 9 SP.sup.2 90 7 SP.sup.3 85 8 EP200 IDA.sup.2 80 7 LX1000HFA IDA.sup.2 90 10 HFA001 IDA.sup.2 85 8 LX103B IDA.sup.2 85 6 LX107S IDA.sup.2 85 7 LX1000SW IDA.sup.2 85 9 ES1 IDA.sup.2 85 7 CHMO-Rr-V1 LX1000HFA IDA.sup.2 90 15 CHMO-Rr-V2 LX1000HFA IDA.sup.2 90 18 CHMO-Rs Free enzyme −/− 90 1 LX1000HFA IDA.sup.1 85 8 IDA.sup.4 85 10 SP.sup.1 85 8 SP.sup.3 85 9 LX1000SD IDA.sup.2 85 6 ES105 IDA.sup.2 85 7 ES108 IDA.sup.2 85 7 ES109 IDA.sup.2 85 8 CHMO-Rs-V1 LX1000HFA IDA.sup.4 90 18 CHMO-Rs-V2 LX1000HFA IDA.sup.4 90 16

    Embodiment 13

    [0095] Conversion and Reusability Test of Immobilized ERED

    [0096] The activity of the ERED epoxy support immobilized enzyme is detected by performing a reaction on the following substrate 6:

    ##STR00005##

    [0097] 3 mL of 0.1 M PB (pH 7.0-8.0) is loaded into a 10 mL reaction bulb, subsequently 100 mg of a substrate 6 is added, then 10 mg of NAD(P)+, 80 mg of an ammonium formate, 2 mg of FDH, and 10 mg of a ERED free enzyme or immobilized enzyme prepared from 30 mg of the free enzyme are added. It is reacted at 30° C. for 16-20 h to test the conversion rate. After each round of the reaction, the immobilized enzyme is separated and reused in the next round of the reaction, and the number of reuses is investigated. The conversion rate of the system is detected by GC, and reaction data is shown in Table 12 below:

    TABLE-US-00012 TABLE 12 Support modifi- Conversion Enzyme Support cation material (%) Cycles ERED-Sc Free enzyme −/− >99 1 LX1000HFA IDA* 99 6 IDA.sup.1 99 8 IDA.sup.2 99 9 IDA.sup.4 99 9 SP.sup.2 99 7 SP.sup.3 99 6 HFA001 IDA* 99 4 IDA.sup.1 99 6 IDA.sup.2 99 7 IDA.sup.4 99 7 SP.sup.2 99 6 SP.sup.3 99 5 ECR8285 IDA* 99 6 IDA.sup.1 99 9 IDA.sup.2 99 8 IDA.sup.4 99 8 SP.sup.2 99 7 SP.sup.3 99 6 ERED-Chr Free enzyme −/− 99 1 LX1000EP IDA* 99 5 IDA.sup.1 99 9 IDA.sup.2 99 11 IDA.sup.4 99 8 SP.sup.2 99 8 LX1000HFA IDA.sup.1 99 7 IDA.sup.2 99 9 SP.sup.1 99 8 SP.sup.2 99 9

    Embodiment 14

    [0098] Conversion and Reusability Test of Immobilized NITs

    [0099] The activity of the NIT amino support immobilized enzyme is detected by performing a reaction on the following substrate 7:

    ##STR00006##

    [0100] 2 mL of 0.1 M PB (pH 7.0-8.0) is added to a 10 mL reaction bulb, and 100 mg of the above substrate 9 is added, then 20 mg of NIT free enzyme or the immobilized enzyme prepared from 30 mg of the free enzyme is added. After 16 h of the reaction at 30° C., the conversion rate is detected. After each round of the reaction, the immobilized enzyme is separated and reused in the next round of the reaction, and the number of reuses is investigated. The conversion rate of the system is detected by GC, and reaction data is shown in Table 13 below:

    TABLE-US-00013 TABLE 13 Support modifi- Conversion Enzyme Support cation material (%) Cycles NIT-An Free enzyme −/− >99 1 LX1000HFA IDA* >99 6 IDA.sup.2 >99 8 SP.sup.3 >99 8 LX1000EP IDA* >99 5 IDA.sup.1 >99 8 SP.sup.3 >99 7 ECR8285 IDA* >99 6 IDA.sup.2 >99 9 ES103 IDA.sup.2 >99 7 SP.sup.3 >99 7 NIT-Nc Free enzyme −/− >99 1 LX1000EP IDA* >99 8 IDA.sup.2 >99 10 LX1000HFA SP.sup.2 >99 10 IDA.sup.2 >99 11 HFA001 IDA.sup.2 >99 13 ECR8285 IDA.sup.2 >99 12 LX103B IDA.sup.2 >99 9 ES1 IDA.sup.2 >99 9

    Embodiment 15

    [0101] Conversion and Reusability Test of Immobilized IREDs, which are Detected by the Following Substrate 8.

    [0102] 2 mL of 0.1 M PB (pH 7.0-8.0) is added to a 10 mL reaction ball, and then 100 mg of the substrate 8, 10 mg of NAD+, 60 mg of an ammonium formate, 10 mg of FDH, and 10 mg of IRED free enzyme or immobilized enzyme prepared from 30 mg of the free enzyme are added. After 20 h of the reaction at 30° C., the conversion rate is detected. After each round of the reaction, the immobilized enzyme is separated and reused in the next round of the reaction, and the number of reuses is investigated.

    ##STR00007##

    [0103] The conversion rate of the system is detected by HPLC, and reaction data is shown in Table 14 below:

    TABLE-US-00014 TABLE 14 Support modifi- Conversion Enzyme Support cation material (%) Cycles IRED-Str Free enzyme −/− >99 1 LX1000HFA IDA* >99 3 IDA.sup.1 >99 6 IDA.sup.2 >99 8 SP.sup.2 >99 6 SP.sup.3 >99 7 HFA001 IDA.sup.2 >99 7 SP.sup.2 >99 7 ECR8285 IDA.sup.2 >99 8 SP.sup.2 >99 7 SP.sup.3 >99 7 IRED-Bc Free enzyme −/− >99 1 LX1000HFA IDA* >99 5 IDA.sup.1 >99 8 IDA.sup.2 >99 10 SP.sup.2 >99 10 ES108 IDA.sup.2 >99 8 LX1000SW IDA.sup.2 >99 9 LX107S IDA.sup.2 >99 8 EP200 SP.sup.2 >99 9

    Embodiment 16

    [0104] Conversion and Reusability Test of Immobilized PAL

    [0105] The activity and number of reuses of the immobilized enzyme are tested by performing a reaction on the following substrate 9:

    ##STR00008##

    [0106] 8 mL of 4 M ammonium carbamate aqueous solution (pH 9.0˜9.5) is added into a 10 mL reaction bulb, and 100 mg of the above substrate 9 is added, then 10 mg of ammonia lyase free enzyme or immobilized enzyme prepared from 40 mg of the free enzyme is added. After 16-20 of the reaction at 30° C., the conversion rate is detected. After each round of the reaction, the immobilized enzyme is separated and reused in the next round of the reaction, and the number of reuses is investigated.

    [0107] The conversion rate of the system is detected by HPLC, and reaction data is shown in Table 15 below:

    TABLE-US-00015 TABLE 15 Support modifi- Conversion Enzyme Support cation material (%) Cycles PAL-An Free enzyme −/− 80 1 LX1000HFA IDA* 80 4 IDA.sup.2 80 6 SP.sup.3 80 7 HFA001 IDA* 80 5 IDA.sup.1 80 8 IDA.sup.2 80 9 IDA.sup.4 80 9 SP.sup.2 80 8 SP.sup.3 80 9 ECR8285 IDA* 80 4 IDA.sup.1 80 7 IDA.sup.2 80 9 ES103 IDA.sup.4 80 8 SP.sup.2 80 8 SP.sup.3 80 7 IDA.sup.2 80 7 ES109 IDA.sup.2 80 6 EP200 IDA.sup.2 80 8 LX1000SW IDA.sup.4 80 7 PAL-Ss Free enzyme −/− 80 1 LX1000EP IDA* 80 6 IDA.sup.2 80 9 LX1000HFA IDA.sup.2 80 10 EP200 IDA.sup.2 80 8 ES108 IDA.sup.2 80 9

    Embodiment 17

    [0108] Conversion and Reusability Test of Immobilized AADH

    ##STR00009##

    [0109] In a 10 mL reaction bulb, 5 mL of 0.1 M Tris-CI buffer (pH 8.0-9.0) is added, 100 mg of a main raw material 10, a main raw material 11 or a main raw material 12 is added, 108 mg of ammonium chloride is added, and pH is adjusted to 7.5-8.0, then 10-50 mg of NAD.sup.+, 150 mg of glucose, 5 mg of GDH, 10 mg of AADH or immobilized AADH prepared from 30 mg of the free enzyme are added. It is stirred at 30° C. for 16-20 h. The conversion rate of the system is detected by HPLC, and reaction data is shown in Table 16 below:

    TABLE-US-00016 TABLE 16 Support modifi- Conversion Enzyme Support cation material (%) Cycles AADH-Bc Free enzyme −/− >99 1 LX1000EP IDA* >99 5 IDA.sup.1 >99 8 IDA.sup.2 >99 8 IDA.sup.4 >99 9 SP.sup.2 >99 8 SP.sup.3 >99 7 ECR8285 IDA* >99 5 IDA.sup.1 >99 12 IDA.sup.2 >99 10 IDA.sup.4 >99 9 SP.sup.2 >99 9 SP.sup.3 >99 9 ECR8204 IDA* >99 5 IDA.sup.1 >99 7 IDA.sup.2 >99 6 IDA.sup.4 >99 8 SP.sup.2 >99 7 SP.sup.3 >99 5 ES1 IDA* >99 7 IDA.sup.1 >99 9 IDA.sup.2 >99 9 IDA.sup.4 >99 8 SP.sup.2 >99 9 SP.sup.3 >99 9 AADH-Bs Free enzyme −/− >99 1 ECR8285 IDA* 90 3 IDA.sup.1 90 5 IDA.sup.2 90 7 IDA.sup.4 90 8 SP.sup.2 80 7 SP.sup.3 85 6 LX1000EP IDA* 85 4 IDA.sup.1 90 9 IDA.sup.2 90 8 IDA.sup.4 6 6 SP.sup.2 80 6 SP.sup.3 90 8

    Embodiment 18

    [0110] Conversion and Reusability Test of Immobilized FDH

    [0111] In a 10 mL reaction bulb, 5 mL of 0.1 M Tris-CI buffer (pH 8.0-9.0) is added, 100 mg of a main raw material 12 is dissolved, and 108 mg of ammonium chloride and 80 mg of ammonium fomate are added, pH is adjusted to 7.5-8.0, then 10-50 mg of NAD.sup.+, 100 mg of AADH-Bc free enzyme, 5 mg of FDH or the immobilized FDH prepared from 10 mg of the free enzyme are added. It is stirred at 30° C. for 16-20 h. The conversion rate of the system is detected by HPLC, and reaction data is shown in Table 17 below:

    TABLE-US-00017 TABLE 17 Support modifi- Conversion Enzyme Support cation material (%) Cycles FDH Free enzyme −/− >99 1 LX1000EP No modification <60 2 IDA* 85 3 IDA.sup.1 >99 8 IDA.sup.2 >99 8 IDA.sup.4 >99 7 SP.sup.2 >99 7 SP.sup.3 >99 6 ECR8285 No modification <80 2 IDA* 85 4 IDA.sup.1 >99 12 IDA.sup.2 >99 13 IDA.sup.4 >99 11 SP.sup.2 >99 12 SP.sup.3 >99 9 ECR8204 IDA* >99 2 IDA.sup.1 >99 5 IDA.sup.2 >99 5 IDA.sup.4 >99 4 SP.sup.2 >99 5 SP.sup.3 >99 4 ECR8209 IDA* >99 2 IDA.sup.1 >99 4 IDA.sup.2 >99 4 IDA.sup.4 >99 4 SP.sup.2 >99 3 SP.sup.3 >99 3 ES1 IDA* >99 3 IDA.sup.1 >99 5 IDA.sup.2 >99 5 IDA.sup.4 >99 5 SP.sup.2 >99 5 SP.sup.3 >99 5 ES103 IDA* >99 2 IDA.sup.1 >99 4 IDA.sup.2 >99 3 IDA.sup.4 >99 3 SP.sup.2 >99 3 SP.sup.3 >99 2

    Embodiment 19

    [0112] Use of Transferase Amino Support Immobilized Enzyme in Packed Bed Continuous Reaction

    [0113] The transaminase TA-Cv-V1 in the embodiment is immobilized on a support ECR8285, and immobilized by IDA.sup.1. The obtained immobilized enzyme is filled into a columnar reactor with a column volume of 120 mL, and the amount of the immobilized enzyme is 72 g.

    [0114] 500 g of a substrate 1 is dissolved in 1.5 L of methanol, and 4 eq of isopropylamine hydrochloride (1.8 L of 6 M isopropylamine hydrochloride aqueous solution) and 5 g of PLP are added without PB (0.1 M, pH 8.0), and the volume is fixed to 5 L.

    [0115] The flow rate is set to 0.6 mL/min, namely the retention time is 200 min, and the continuous reaction is performed. Effluent at an outlet is detected for the conversion rate. The conversion rate is >98%. After 260 h of the continuous operation, the conversion rate is not decreased. After 280 h of the operation, the conversion rate is decreased to 90%. It is specifically shown in Table 18.

    TABLE-US-00018 TABLE 18 Amount of immo- Reten- Opera- bilized Column tion tion Conver- Enzyme Support enzyme volume time time sion TA-Cv-V1 LX1000HA 72 g 120 mL 200 min 260 h 97.5% 280 h   90%

    Embodiment 20

    [0116] Use of transferase immobilized enzyme in continuous stirred tank reaction

    [0117] The same immobilized enzyme TA-Ac-V1 in Embodiment 1 is used, the support is LX1000HFA, and it is immobilized by a mode of SP.sup.2. 50 g of the immobilized enzyme of the transaminase TA-Ac-V1 is added to a 200 mL reactor, and 150 mL of PB is added.

    [0118] 3.2 L of PB (0.1 M, pH 7.0), 1.8 L of isopropylamine hydrochloride aqueous solution (6 M) and 5 g of PLP are added to 500 g of a substrate 1, and it is prepared into a suspension by beating.

    [0119] The substrate suspension is continuously added to a reaction bulb at a rate of 0.4 mL/min (namely the retention time is 500 min), and at the same time, the reaction system is extracted at an outlet at the same flow rate (a filter head is additionally installed at a tail end of a pipe, to prevent the immobilized enzyme from being extracted). Under this condition, the conversion rate may reach more than 90%, and the conversion rate is not decreased basically after 2000 h of the continuous operation. Results are shown in Table 19.

    TABLE-US-00019 TABLE 19 Amount of immo- Reten- Opera- bilized Column tion tion Conver- Enzyme Support enzyme volume time time sion TA-Cv-V1 ECR8409 50 g 200 mL 250 min 200 h >90% 210 h  84%

    Embodiment 21

    [0120] It is an ammonia lyase PAL-Ss immobilized enzyme, the support is HFA001, and it is immobilized by a mode of IDA.sup.4. 6 g of the obtained immobilized enzyme is filled into a 10 mL columnar reactor.

    [0121] 500 g of a substrate 9 is dissolved in 4.5 L of ammonium carbamate aqueous solution (4 M, pH 9.0˜9.5).

    [0122] The flow rate is set to 0.03 mL/min, namely the retention time is 330 min, and the continuous reaction is performed. Effluent at an outlet is detected for the conversion rate, and the conversion rate is 80%. After 300 h of the continuous operation, the conversion rate is not decreased. After 310 h of the operation, the conversion rate is decreased to 70%. It is shown in Table 20.

    TABLE-US-00020 TABLE 20 Amount of immo- Reten- Opera- bilized Column tion tion Conver- Enzyme Support enzyme volume time time sion PAL-Ss LX1000EPN 6 g 10 mL 100 min 300 h 80% 310 h 70%

    Embodiment 22

    [0123] It is the ketoreductase KRED-Ac-V1 immobilized enzyme prepared in the embodiment, the support is LX1000EP, and it is immobilized by a mode of IDA.sup.4. 6 g of the obtained immobilized enzyme is filled into a 10 mL columnar reactor.

    [0124] 100 g of the substrate 3 is dissolved in 0.3 L of isopropanol, 0.7 L of PB (0.1 M, pH 7.0) is added for dissolution, and then 0.1 g of NAD.sup.+ is added.

    [0125] The flow rate is set to 0.05 mL/min, namely the retention time is 200 min, and the continuous reaction is performed. Effluent at an outlet is detected for the conversion rate. The conversion rate is >90%. After 200 h of the continuous operation, the conversion rate is not decreased. After 210 h of the operation, the conversion rate is decreased to 80%. It is shown in Table 21.

    TABLE-US-00021 TABLE 21 Reaction results of KRED-AC immobilized enzyme in packed bed continuous reaction Amount of immo- Reten- Opera- bilized Column tion tion Conver- Enzyme Support enzyme volume time time sion KRED-Ac-V LX1000EP 6 g 10 mL 100 min 220 h 90% 210 h 80%

    Embodiment 23

    [0126] Investigation of Various Parameters of Epoxy Resin Immobilization by Sodium Periodate Oxidation

    [0127] The concentration and amount of an acetic acid, the concentration and amount of a sodium periodate, and the concentration of a cross-linking agent are investigated.

    [0128] FDH is immobilized on the LX1000HFA support by the method in Embodiment 4, the concentration of IDA is set to 0.2˜3 mol/L, the volume/mass ratio of IDA solution and support is 2˜25:1, the concentration of the metal ions is set to 5˜100 mmol/L, and the range of the cross-linking agent dextran aldehyde (DA) is investigated. Herein, the IDA concentration of 1-2 mol/L is best, and it is best while the volume/mass ratio to the support is 10-20:1; the activity is better while the metal ion concentration is 10-100 mmol/L, in view of the cost, a concentration of 10˜50 mmol/L may be used; and the cross-linking agent DA is best in the range of 0.5%˜2%. The specific parameters and results are shown in Table 22.

    TABLE-US-00022 TABLE 22 Ratio of IDA solution Cross- volume Metal linking IDA to ion agent and Number concen- support concen- its of tration, mass tration, concentra- Conver- reuses, Enzyme Support mol/L (v/m) mmol/L tion, % sion, % times FDH LX1000HFA 1 10 20 0.05 DA 99 8 1 10 20  0.1 DA 99 10 1 10 20  0.2 DA 99 10 1 10 20  0.5 DA 99 12 1 10 20   1 DA 99 12 1 10 20   2 DA 99 12 1 10 20  2.5 DA 99 10 1 10 5   1 DA 99 9 1 10 10   1 DA 99 11 1 10 30   1 DA 99 11 1 10 50   1 DA 99 12 1 10 70   1 DA 99 12 1 10 100   1 DA 99 12 2 2 20   1 DA 99 5 2 5 20   1 DA 99 8 2 10 20   1 DA 99 12 2 15 20   1 DA 99 12 2 20 20   1 DA 99 12 2 25 20   1 DA 99 11 0.2 10 20   1 DA 99 7 0.5 10 20   1 DA 99 10 1 10 20   1 DA 99 12 2 10 20   1 DA 99 12 3 10 20   1 DA 99 10

    [0129] The acetic acid concentration, the volume/mass ratio of the acetic acid solution to the support, the concentration of sodium periodate, the volume/mass ratio of the sodium periodate solution to the support, and the concentration of the cross-linking agent GA are investigated.

    [0130] By the same method in Embodiment 3, FDH is immobilized to the support HFA, the different acetic acid concentrations, volume/mass ratios of acetic acid solution to the support, concentrations of sodium periodate, volume/mass ratios of sodium periodate solution to the support, and concentrations of the cross-linking GA are set. Results show that the optimal concentration of the acetic acid is 1-2 mol/L; the optimal volume/mass ratio of the acetic acid solution to the support is 10˜15:1; the optimal concentration of the sodium periodate is 0.1˜0.2 mol/L, and the effects are all better while the volume-to-mass ratio of the support is 5˜25, in view of cost saving, it may be 5˜15:1 preferably; and it is better while the concentration of the cross-linking agent is 0.5%˜2%. The specific parameters and results are shown in Table 23.

    TABLE-US-00023 TABLE 23 Ratio Ratio of of acetic sodium acid periodate solution solution volume volume to Sodium to Cross-linking Number Acetic acid support periodate support agent and its of concentra- mass concentra- mass concentra- Conver- reuses, Enzyme Support tion, mol/L (v/m) tion, mol/L (v/m) tion, % sion, % times FDH HFA001 1 5 0.1 5 0.05 GA 99 4 1 5 0.1 5  0.1 GA 99 7 1 5 0.1 5  0.5 GA 99 11 1 5 0.1 5   1 GA 99 11 1 5 0.1 5  1.5 GA 99 12 1 5 0.1 5   2 GA 99 12 1 5 0.1 5  2.5 GA 99 10 1 5 0.1 5   3 GA 99 9 1 5 0.1 5   4 GA 99 5 0.3 5 0.1 5   2 GA 99 6 0.5 4 0.1 5   2 GA 99 10 0.5 5 0.1 5   2 GA 99 11 0.5 10 0.1 5   2 GA 99 11 0.5 15 0.1 5   2 GA 99 11 0.5 20 0.1 5   2 GA 99 9 1 5 0.05 5   2 GA 99 8 1 5 0.2 5   2 GA 99 12 1 5 0.3 5   2 GA 99 12 1 5 0.5 5   2 GA 99 12 1 5 0.7 5   2 GA 99 6 1 5 0.1 3   2 GA 99 6 1 5 0.1 10   2 GA 99 11 1 5 0.1 15   2 GA 99 12 1 5 0.1 20   2 GA 99 12 1 5 0.1 25   2 GA 99 12 2 5 0.1 5   2 GA 99 11 3 5 0.1 5   2 GA 99 8

    [0131] Investigation of Amount of PEI

    [0132] By the same methods in Embodiment 2 (IDA4) and Embodiment 5 (SP3), FDH is immobilized to the support ECR8285, PEIs with different molecular weights are selected, and different PEI concentrations are set, to investigate the appropriate amount of PEI, and investigate the effects of different pH values on the immobilized enzyme. Results show that the PEIs have the similar effects while the molecular weight is from 3 KDa to 70 KDa, and the optimal concentration range of PEI is 1%˜2%; and while pH is 6.0˜10.0, the effect on the immobilized enzyme activity is not large, while pH is 7˜9, the stability is the best. The specific parameters and results are shown in Table 24.

    TABLE-US-00024 TABLE 24 Number PEI PEI of molecular concen- Conversion, reuses, Enzyme Support Method weight tration, % PH % times FDH ECR8285 IDA2  3 KDa 0.5 7.0 99 9 1 7.0 99 12 2 7.0 99 11 3 7.0 99 10 4 7.0 99 7 20 KDa 0.2 7.0 99 7 0.5 7.0 99 12 2 7.0 99 11 3 7.0 99 9 4 7.0 99 6 50 KDa 1 7.0 99 13 2 7.0 99 11 70 KDa 0.5 7.0 99 12 1 6.0 99 5 1 6.5 99 7 1 7.0 99 11 1 8.0 99 11 1 9.0 99 11 1 10.0 99 10 1 11.0 80 2 2 7.0 99 11 3 7.0 99 8 SP3  3 KDa 0.5 7.0 99 7 1 7.0 99 10 1 9.0 99 10 1 11.0 80 3 2 7.0 99 11 70 KDa 0.5 7.0 99 10 1 7.0 99 12 1 8.0 99 12 1 10.0 99 10 1 11.0 80 3 2 7.0 99 11 3 8.0 99 9

    [0133] Investigation of Proportion of PEG-Modified Cross-Linking Agent

    [0134] By the same methods in Embodiment 7 (SP4) and Embodiment 9 (IDA4), FDH is immobilized on the support ECR8285, and the range of PEG and the ratio of PEG to GA in the methods of PEG-modified glutaraldehyde are investigated. Results show that PEG200, PEG2000 and PEG6000 may all modify the glutaraldehyde. While the ratio of PEG to GA is in the range of 1:1˜10:1, the reusability of the enzyme is better, and is best while the ratio is 2:1˜4:1. The specific parameters and results are shown in Table 25.

    TABLE-US-00025 TABLE 25 Number PEG and of re- cross-linking Conver- uses, Enzyme Support Method proportion sion, % times FDH ECR8285 IDA4 PEG200:GA = 1:1 99 10 PEG200:GA = 3:1 99 11 PEG200:GA = 5:1 99 10 PEG200:GA = 7:1 99 10 PEG200:GA = 10:1 99 9 PEG200:GA = 12:1 99 8 PEG2000:GA = 3:1 99 11 PEG2000:GA = 5:1 99 11 PEG2000:GA = 7:1 99 10 PEG2000:GA = 10:1 99 10 PEG6000:GA = 3:1 99 12 PEG6000:GA = 5:1 99 12 PEG6000:GA = 7:1 99 11 SP4 PEG200:GA = 5:1 99 12 PEG200:GA = 7:1 99 12 PEG200:GA = 10:1 99 11 PEG2000:GA = 3:1 99 13 PEG2000:GA = 5:1 99 12 PEG2000:GA = 7:1 99 11 PEG2000:GA = 10:1 99 10 PEG6000:GA = 3:1 99 13 PEG6000:GA = 5:1 99 13 PEG6000:GA = 7:1 99 10

    [0135] The above are only preferred embodiments of the present disclosure, and are not intended to limit the present disclosure. For those skilled in the art, the present disclosure may have various modifications and changes. Any modifications, equivalent replacements, improvements and the like made within the spirit and principle of the present disclosure shall be included within a scope of protection of the present disclosure.