CRA4S1 gene, encoded CRA4S1 protein, and application

12552841 ยท 2026-02-17

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided are a cra4S1 gene, an encoded cra4S1 protein, and a vaccine or drug containing the cra4S1 protein or a fragment thereof. A nucleotide sequence of the cra4S1 gene is represented by SEQ ID NO. 1. The vaccine combines the specific target of an outer membrane protein of Porphyromonas gingivalis and the antigen component of the bacterial conserved region, which has an immune prevention and protection effect on the body.

Claims

1. A synthetic cra4S1 gene consisting of a nucleotide sequence as shown in SEQ ID No.1.

2. An expression cassette, a recombinant vector or a cell comprising the synthetic cra4S1 gene of claim 1, wherein the synthetic cra4S1 gene encodes a Cra4S1 protein consisting of an amino acid sequence as shown in SEQ ID NO.2.

3. A composition for immune protection comprising the Cra4S1 protein of claim 2 and one or more W50ragB proteins, thairagB protein, QMLragB protein and 381ragB protein of P. gingivalis.

4. The composition of claim 3, wherein a mass ratio of Cra4S1 protein to W50ragB protein is in the range of 1:2 to 1:8, or a mass ratio of Cra4S1 protein to ThairagB protein is in the range of 1:1 to 1:6, or a mass ratio of Cra4S1 protein to QMLragB protein is in the range of 1:1 to 1:6, or a mass ratio of Cra4S1 protein to 381ragB protein is in the range of 1:2 to 1:9.

5. An antibody comprising an antibody against the Cra4S1 protein of claim 2, and an antibody against one or more W50ragB proteins, thairagB protein, QMLragB protein and 381ragB protein of P. gingivalis.

6. A method of preventing or treating a medical condition associated with Porphyromonas gingivalis infection, comprising administering to a subject in need, an effective amount of the composition of claim 3.

7. A method of preventing or treating a medical condition associated with Porphyromonas gingivalis infection, comprising administering to a subject in need, an effective amount of the antibody combination of claim 5.

8. A method of preventing or treating a medical condition with Porphyromonas gingivalis infection, comprising administering to a subject in need, an effective amount of the composition of claim 4.

9. The composition of claim 3, wherein the composition is a vaccine or medicine used to prevent occurrence or relapse or treating periodontitis or peri-implantitis inflammation or an infection related to Porphyromonas gingivalis.

10. The composition of claim 4, wherein the composition is a vaccine or medicine used to prevent occurrence or relapse or treating periodontitis or peri-implantitis inflammation or an infection related to Porphyromonas gingivalis.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 shows P. gingivalis W50 major outer membrane protein receptor antigen gene (rag) locus.

(2) FIG. 2 shows construction of recombinant plasmid vector in which: C5361BH150-1 is the target gene cra4S1.

(3) FIGS. 3A-3B show identification of recombinant plasmid by enzyme digestion. FIG. 3A shows recombinant plasmid cra4S1-pet-30a (+) in lane 1, and enzyme digestion reaction in lane 2, and 1 Kb DNA ladder (Genescript) in lane M. There are plasmid DNA and cra4S1 gene bands. FIG. 3B shows comparison of 1 Kb DNA ladder and DL3000 molecular weight scale (Genescript).

(4) FIG. 4 shows that the amino acid sequence of the cloned target gene is consistent with the theoretical amino acid sequence of bacteria P. gingivalis. Figure discloses SEQ ID NOS 2, 2 and 2, respectively, in order of appearance.

(5) FIG. 5 shows the detection of recombinant protein expression after induction. Lane M: protein molecular weight scale (15-120 kDa); lane 9: total protein of bacteria before induction (colony 1); lane 10: total protein of bacteria after induction (colony 1); lane 11: total protein of bacteria before induction (colony 2); lane 12: total protein of bacteria after induction (colony 2).

(6) FIG. 6 shows the detection of recombinant protein expression after induction. Lane M: protein molecular weight scale (15-120 kDa); lane 1: centrifugal supernatant; lane 2: whole bacterial lysate; lane 3: bacterial lysate supernatant.

(7) FIG. 7 shows collection of purified protein by affinity chromatography. Lane M: protein molecular weight scale (15-120 kDa); prior column: flow through; lane 1-10 is collected protein fluid.

(8) FIGS. 8A-8B show subcutaneous and skin soft tissue lesions in animal model mouse. FIG. 8A: lesion display; FIG. 8B: the lesion area is circled with a white line, and calculate with ImageJ, the detail of which is described in Example 4.

(9) FIGS. 9A-9B show the correlation between bacterial attack doses and local soft tissue injury, the details of which are described in Example 5, the injury recorded here being 15 days post-challenge. FIG. 9A: Investigation of virulence among subtypes of P. gingivalis strain as attack bacteria, the abscissa being the different P. gingivalis subtypes with different concentration at the time of challenge, and the ordinate being the areas of skin and soft tissue lesions in square millimetre mm.sup.2. FIG. 9B: The doses are positively correlated with the lesion area, the abscissa being the different subtypes of P. gingivalis, and the ordinate being the area of skin and soft tissue lesions (mm.sup.2). The doses are arranged in order. The larger the attack dose is, the larger the lesion area is.

(10) FIG. 10 shows association between animal ages and bacterial susceptibility, abscissa being time, days post-challenge, and ordinate being the areas of skin and soft tissue lesions (mm.sup.2), details of which are described in Example 6. G1 (4 weeks old), G2 (8 weeks old), G3 (12 weeks old), G4 (16 weeks old) and G5 (20 weeks old) represent animals of different age groups, respectively.

(11) FIGS. 11A-11C show the damage caused by multiple infections of P. gingivalis, the details of which are described in Example 7. FIG. 11A shows local lesions, comparison of the areas of soft tissue damage between the first infection and repeated infections, the abscissa being the days after the attack, the ordinate being the area of skin and soft tissue damage mm2. FIG. 11 B presents a screenshot from a video recorded on the 24th day of a recovery time period from repeatedly infected animals (group G148). FIG. 11 C shows a screenshot from a video recorded on the 24th day of a recovery time period from one of infected animals (group g148.1).

(12) FIG. 12 shows an immune protective function of combined vaccine, the details of which are described in Example 8, the abscissa being the days after challenge, and the ordinate being the area of skin and soft tissue lesions (mm.sup.2).

(13) FIG. 13 shows a local immune protection effect of vaccine to pre-infected animals, the details of which are described in Example 9, the abscissa being the days after challenge, and the ordinate being the area of skin and soft tissue lesions (mm.sup.2).

(14) FIGS. 14A and 14B show systemic immune protective effect of vaccine to pre-infected animals, the details of which are described in Example 9, screenshots from a video recorded on the 24th day and 42th day post-challenge animals, G154 immunized with monovalent vaccine W50ragB, G155 immunized with mixed vaccine W50ragB+Cra4S1, G156 immunized with monovalent vaccine Cra4S1, G1547 was as pre-infected animal control, G158 was a primary infection control.

(15) FIGS. 15A and 15B show the study on passive immune function of combination of two targeted specific antibodies, the details of which are described in Example 10. FIG. 15 A: G370, G371, G372, G373 and G374 had no pre-infection by P. gingivalis, and the animal mortality of post bacterial challenge was investigated. The antibodies were injected as follows: G370 injected with anti-ThairagB serum, G371 injected with combined antibody anti-ThairagB and anti-Cra4S1 serum, G372 injected with anti-Cra4S1 serum, G373 injected with normal mouse serum, G374 injected with PBS as a control. FIG. 15 B: G361, G362, G363, G364 and G369 groups had pre-infection history, and the animal mortality of post bacterial challenge was investigated. The antibodies were injected as follows: G361 injected with anti-ThairagB serum, G362 injected with combined antibody anti-ThairagB and anti-Cra4S1 serum, G363 injected with anti-Cra4S1 serum, G364 injected with normal mouse serum, G369 injected with PBS as a control.

(16) FIGS. 16A and 16B show the local immune protection of antibodies against two targets on animals with and without bacterial infection, FIG. 16A: G371, G372, G373 and G374 were normal animals that were not infected by P. gingivalis, the usage of antibody is the same as described in FIG. 15, the abscissa being the days post-challenge, the ordinate being the area of skin and soft tissue lesions (mm.sup.2); FIG. 16B: the mice in G361, G362, G363, G364 and G369 had a pre-infection history, the usage of antibody is the same as described in FIG. 15, the abscissa being the days post-challenge, the ordinate being the area of skin and soft tissue lesions (mm.sup.2).

DETAILED DESCRIPTION OF THE INVENTION

Principle and Method of the Invention

(17) The rag locus of P. gingivalis, which is composed of ragA and ragB genes with irregular insertion sequence at the both ends (FIG. 1). The open reading frames of ragA and ragB genes are independent, but there is a co-transcription relationship between them according to experimental studies. For example, when ragA gene is artificially mutated, RagB protein cannot be normally expressed, or when the downstream ragB gene is artificially mutated, RagA protein cannot be normally expressed in bacteria (PCT/GB2005/001976 is incorporated here for reference).

(18) Utilizing the patented technology obtained by the company (PCT/GB2005/001976 is incorporated here for reference), through sequence analysis of ragB gene encoding bacterial outer membrane protein, four different subtypes of pathogens were predominantly detected in clinical samples. The outer membrane proteins corresponding to the four different subtypes of P. gingivalis were named W50ragB protein, ThairagB protein, QMLragB protein and 381ragB protein, respectively. The laboratory has completed the pilot production process of recombinant subunit monovalent and multivalent vaccines.

(19) In fact, ragA gene has also a high degree of genetic polymorphism, but there is no published literature about the coding protein corresponding to the DNA polymorphism of ragA gene. The applicant attempted to clone and express ragA gene from genomic DNA by conventional methods, but with no success. On the basis of PCT/GB2005/001976 patent technology, the applicant found that there was a conserved amino acid sequence fragment in the protein encoded by ragA gene through protein sequence comparison analysis, but the cloning and, expression of, this conserved sequence fragment, by conventional methods were not successful.

(20) In order to obtain the expression of RagA conserved region protein molecules, the applicant designed a new artificial synthesis of nucleotide sequence by codon optimization, the sequence was named cra4S1 (SEQ ID No 1), which means that there is a conservative amino acid sequence in the RagA protein of P. gingivalis, and that the four major bacterial subtypes all have this common protein sequence.

(21) In the invention, the cra4S1 gene was successfully cloned into the expression vector, and the recombinant protein is generated under the induction condition. The purified recombinant protein (Example 3, FIGS. 2, 3A&313, 5, 6 and 7) was obtained using chromatography and molecular sieve principle. The recombinant Cra4S1 protein, with a molecular weight of about 15 kDa, recombinant constructed vector DNA was sequenced in accordance with the design scheme, the encoded protein sequence was consistent with the theoretical sequence of conserved region (FIG. 4), and the molecular weight meets the expected theoretical value.

(22) The recombinant Cra4S1 protein shows strong antigenicity. Animals immunized with low doses can produce high titers of antibodies (Example 8 for details). However, animals immunized with only cra4s1 protein do not show immune protection.

(23) It was observed that the antibodies raised by Cra4S1 protein were not reacting with P. gingivalis or bacterial lysates in vitro. It was also shown that there was no obvious immunological reaction to recombinant Cra4S1 protein in neither RagB antiserum nor whole bacteria antiserum. These results suggest that Cra4S1 protein seemed not the major antigen on the surface of the bacteria.

(24) Interestingly, if animals were challenged with P. gingivalis after being vaccinated with RagB protein, their serum antibodies show immune cross reaction with the recombinant Cra4S1 protein in different degrees. This phenomenon shows that when RagB antibody binds to the outer membrane protein RagB of P. gingivalis, the original spatial structure of Cra4S1 protein is changed, and the hidden antigenicity is exposed.

(25) In an experiment, when recombinant protein Cra4S1 and RagB were mixed together, unexpected results are observed, and the new formula enhances the immune protection against P. gingivalis challenge (Example 8, FIG. 12). This phenomenon reveals that when the antibodies bind to RagB antigen on the bacteria surface, the spatial structure of the Rag protein changes, exposing Cra4S1 protein and let it recognized by the antibody. Thus, the double targets on the surface of the bacteria are captured by specific antibodies at the same time, which limits the function of main outer membrane proteins, so as to achieve the effect of inhibiting and eliminating the bacteria.

(26) The new vaccine formula also shows the improvement on product performance stability, which is reflected in the low level of data standard deviation. Said data standard deviation is an indicator for measuring the dispersion of the average value of a group of data. A smaller standard deviation represents that the group of data are closer to the average value, indicating a reduced risk of accidental dispersion. This phenomenon further proves that the immune effect of antibody and antigen double target reaction corresponding to RagA and RagB is more stable.

(27) The innovation of the invention is to use the multi-target characteristics of bacterial surface antigen to prepare stable and efficient biological products.

(28) Another innovation of the invention is that the mixed vaccine is not only beneficial to healthy mice, but also applied to animals pre-infected with P. gingivalis. The experimental results show that the mixed vaccine has significant immune protective effect on infected animals (Example 9). Periodontal disease/peri-implant inflammation caused by P. gingivalis infection is a chronic, intermittent and progressive process. It was observed in animal experiments that after multiple infections, not only the local pathological conditions became more serious, but also the general condition of animals showed weakness (Example 7). Clinically, there are many people suffering from periodontal disease. Therefore, if the invention can control chronic infection, it will prevent the harm of chronic infection to general health, and the product is expected to have broad market prospects.

(29) In addition to the improvement of the immune efficacy and stability by the mixed vaccine, the passive immune experiment also verified that the combined antibody contains the antibodies against Cra4S1 protein and RagB protein, and thei immune protection is stronger than that of the experimental group using a single antibody, respectively (Example 10).

(30) Both mixed vaccine and combined antibody and their protection on active and passive immunity on pre-infected animals are also included in this manual.

(31) Beneficial effect: compared with the prior art, the invention has the following advantages: 1. The invention discloses the cra4S1 gene related to P. gingivalis for the first time and cloned and successfully expressed the Cra4S1 protein in E. coli for the first time. The combined vaccine and combined antibody of the invention have significant immune protection in pre-infection animals, indicating that the invention has broad application prospects and can be used for both healthy people and patients with chronic infection. 2. The vaccine of the invention contains the target of P. gingivalis specific outer membrane protein and the newly discovered conserved region antigen component, which is immune efficacy than the vaccine prepared using the outer membrane protein alone or the newly discovered antigen alone. The combined application of the antibody, produced by animals immunized with the conserved region antigen, and outer membrane protein of P. gingivalis, significantly improved the immune protective effect of the antibody. In addition, the product of the invention including combinational vaccine and mixed antibody against separate two targets show that the standard deviation of the experimental data is kept at a low level in animal experiment, suggesting that the product of the invention can provide better stability in vivo experiments. 3. The invention points out that with respect to the anti-infective immunity, when specific antibody reacts to the interrelated targets on bacterial surface to conservative region antigen and bacterial subtype specific antigen, they can stably and effectively give full play to the effect of the antibody, inhibit and eliminate the pathogenic bacteria, and achieve the purpose of both preventing and treating diseases.

(32) Further examples of the invention will be described below, including foreground predictions, but they are not limited to the invention.

(33) The invention is further described below in combination with the accompanying drawings.

Example 1

(34) cra4S1 Gene Nucleotide Sequence Design

(35) Zhenjiang Yangtze Green Biotechnology provided DNA sequence and design requirements, and Nanjing Genscript Biotech Corporation (GenScript) provided nucleotide synthesis services.

(36) The idea of creating cra4S1 gene was derived from ragA gene of P. gingivalis. The rag locus is composed of ragA (encoding outer membrane protein, molecular weight about 115 kda) and ragB (encoding outer membrane protein immune source region, molecular weight about 55 kDa protein), and ragA and ragB are co-transcripted (FIG. 1). The inventor's previous invention patents and published literatures have disclosed that ragA and ragB genes have the characteristics of genetic polymorphism. However, the research on ragA gene and its coding protein has not been reported publicly.

(37) The applicant's research results show that there is a relatively conservative stable region sequence in the protein encoded by ragA gene. In the following RagA sequence, the underlined part is the common amino acid sequence of four major P. gingivalis subtypes.

(38) TABLE-US-00001 W50ragA2334-5387 (SEQIDNO:3) MKRMTLFFLCLLTSIGWAMAQNRTVKGTVI SSEDNEPLIGANVVVVGNTTIGAATDLDGN FTLSVPANAKMLRVSYSGMTTKEVAIANVM KIVLDPDSKVLEQVVVLGYGTGQKLSTVSGS VAKVSSEKLAEKPVANIMDALQGQVAGMQ VMTTSGDPTAVASVEIHGTGSLGASSAPLY IVDGMQTSLDVVATMNPNDFESMSVLKDAS ATSIYGARAANGVVFIQTKKGKMSERGRIT FNASYGISQILNTKPLDNMMTGDELLDFQVK AGFWGNNQTVQKVKDMILAGAEDLYGNYDSLK DEYGKTLFPVDFNHDADWLKALFKTAP TSQGDISFSGGSQGTSYYAS.

(39) Different subtypes of the same bacteria have the same protein sequence, which indicates the prospect of broad-spectrum vaccine protection against the bacteria, but the attempt to extract target gene fragments from bacterial genomic DNA by conventional methods has not been successful.

(40) The present invention modifies the nucleotide sequence by using the codon preference of the host itself. After the nucleotide sequence is improved, the encoded protein sequence must be consistent with the target gene to achieve the goal of accurate expression of the target protein. The synthetic gene sequence is named cra4S1, which means that there is a stable and conservative amino acid sequence in the ragA gene of P. gingivalis and the four major bacterial subtypes all have this common protein sequence. In the invention, all intellectual property rights of the artificially designed nucleotide sequence obtained by the gene synthesis method exclusively owned by Zhenjiang Yangtze Green Biotechnology, and GenScript provides only the nucleotide synthesis service.

(41) The nucleotide sequence of the synthesized cra4S1 gene is as follows

(42) TABLE-US-00002 (SEQIDNO:4) CATATGCAGAACCGTACCGTTAAGGGCACCGTG ATCAGCAGCGAGGACAACGAACCGCTGATTGGT GCGAACGTGGTTGTGGTTGGCAACACCACCATC GGTGCGGCGACCGACCTGGATGGCAACTTCACC CTGAGCGTTCCGGCGAACGCGAAGATGCTGCGT GTGAGCTACAGCGGTATGACCACCAAAGAGGTT GCGATCGCGAACGTTATGAAGATTGTGCTGGAC CCGGATAGCAAAGTGCTGGAACAGGTGGTTGTG CTGGGTTATGGCACCGGTCAAAAGCTGAGCACC GTTAGCGGCAGCGTTGCGAAAGTGAGCAGCGAG AAGCTGGCGGAAAAACCGGTGGCGAACATTATG GATGCGCTGCAGGGCCAAGTTGCGGGTATGCAA GTGTGACTCGAG.

(43) The fragment length of cra4S1 gene is 408 bp, including 393 bp target gene. NdeI (underlined CATATG) was designed for 5 end restriction endonuclease, the starting code is ATG in restriction endonuclease, and XhoI (underlined CTCGAG) was designed for 3 end restriction endonuclease. When the translation of the target gene is completed, the TGA (bold type) termination codon is specially set to terminate the translation immediately to ensure the correct expression of the target gene. The accuracy of the synthetic target gene needs to be tested after the plasmid DNA is transformed into the host cell.

Example 2

(44) Construction and Identification of cra4S1 Gene Expression Vector

(45) Construction method of prokaryotic expression vector containing Cra4S1 protein open reading frame: ligation of the synthetic cra4S1 gene fragment of Example 1 to the vector plasmid pET-30a (+) (purchased from Genscript), and the construction of the recombinant plasmid is shown in FIG. 2. The restriction endonuclease NdeI and XhoI were designed to cut the plasmid and target gene. The restriction endonuclease reaction solution is as follow: 2 l for each restriction endonuclease, 4 l of 10 buffer, 1 g of pet-30a (+) and cra4S1 each, ddH2O was used to supplement 40 l, incubate the reaction solution in a water bath at 37 C. for 2 hours. DNA fragments were extracted and purified from electrophoresis agarose gel, and then, vectors and target genes were ligated. The ligation system was: 200 ng vector, 280 ng cra4S1 gene fragment, T4 DNA ligase 1 l, 10 buffer 2 l, add ddH2O to supplement to 20 l, incubated at 16 C. 1216 h. The expression vector cra4s1-pet-30a (+) was then transformed into E. coli.

(46) Transformation: 1 l (100 ng) of cra4s1-pet-30a (+) plasmid add to 100 l competent E. coli BL21 (DE3) plyss (purchased from Genscript), place in ice bath for 20 minutes; heat shock at 42 C. for 90 seconds, quickly place in ice for 5 minutes, and add 600 l LB culture medium; shake at 37 C. and 220 rpm for 1 hour. After centrifugation, the culture was spread on LB plate with 50 g/ml kanamycin at 37 C. overnight. A single colony was randomly selected on the LB plate with transformed bacteria. After plasmid DNA was extracted and purified, enzyme digestion test was used to confirm that the plasmid contains the gene fragment (FIG. 3), plasmid DNA was sent for sequencing.

(47) The sequencing results are as follows:

(48) TABLE-US-00003 (SEQIDNO:5) TAGTAGGTTGAGGCCGTTGAGCACCGCCGCCGCA AGGAATGGTGCATGCAAGGAGATGGCGCCCAAC AGTCCCCCGGCCACGGGGCCTGCCACCATACCC ACGCCGAAACAAGCGCTCATGAGCCCGAAGTGG CGAGCCCGATCTTCCCCATCGGTGATGTCGGCG ATATAGGCGCCAGCAACCGCACCTGTGGCGCCG GTGATGCCGGCCACGATGCGTCCGGCGTAGAGG ATCGAGATCGATCTCGATCCCGCGAAATTAATA CGACTCACTATAGGGGAATTGTGAGCGGATAAC AATTCCCCTCTAGAAATAATTTTGTTTAACTTT AAGAAGGAGATATACATATGCAGAACCGTACCG TTAAGGGCACCGTGATCAGCAGCGAGGACAACG AACCGCTGATTGGTGCGAACGTGGTTGTGGTTG GCAACACCACCATCGGTGCGGCGACCGACCTGG ATGGCAACTTCACCCTGAGCGTTCCGGCGAACG CGAAGATGCTGCGTGTGAGCTACAGCGGTATGA CCACCAAAGAGGTTGCGATCGCGAACGTTATGA AGATTGTGCTGGACCCGGATAGCAAAGTGCTGG AACAGGTGGTTGTGCTGGGTTATGGCACCGGTC AAAAGCTGAGCACCGTTAGCGGCAGCGTTGCGA AAGTGAGCAGCGAGAAGCTGGCGGAAAAACCGG TGGCGAACATTATGGATGCGCTGCAGGGCCAAG TTGCGGGTATGCAAGTGTGACTCGAGCACCACC ACCACCACCACTGAGATCCGGCTGCTAACAAAG CCCGAAAGGAAGCTGAGTTGGCTGCTGCCACCG CTGAGCAATAACTAGCATAACCCCTTGGGGCCT CTAAACGGGTCTTGAGGGGTTTTTTGCTGAAAG GAGGAACTATATCCGGATTGGCGAATGGGACGC GCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGT GGTGGTTACGCGCAGCGTGACCGCTACACTTGC CAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTT CCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCC CCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGG GTTCCGATTTAGTGCTTTACGG.

(49) The 393 bp bases in bold shown above are the cloned cra4s1 gene sequence, the underlined bases are the restriction endonuclease cut point, and the TGA stop codon is at the end; the 352-744 nucleotide sequence of the recombinant gene sequence is 100% identical with the designed nucleotide sequence.

(50) The theoretical amino acid sequence is as follows:

(51) Conservative RagA amino acid sequence (leading peptide 20AA removed):

(52) TABLE-US-00004 (SEQIDNO:2) QNRTVKGTVISSEDNEPLIGANVVVVGNTT IGAATDLDGNFTLSVPANAKMLRVSYSGMT TKEVAIANVMKIVLDPDSKVLEQVVVLGYG TGQKLSTVSGSVAKVSSEKLAEKPVANIMD ALQGQVAGMQV.

(53) The amino acid sequence corresponding to the translated protein of the above SEQ ID No.1. is compared with the theoretical amino acid sequence, and the comparison results are shown in FIG. 4.

(54) Results: the DNA sequence of the target gene in the recombinant plasmid was 100% consistent with the optimized design of cra4S1 gene pairing, and the expected protein sequence was 100% consistent with the target theoretical amino acid sequence.

Example 3

(55) Induction, Expression and Purification of Cra4S1 Protein

(56) IPTG induction: select two single colonies on the transformation plate of Example 2 and inoculate them in a tube containing 3 ml LB culture medium with 50 g/ml kanamycin respectively, shake them overnight at 37 C., 200 rpm. Then inoculate 1 ml culture from the 3 ml LB culture in 100 ml LB culture medium containing 50 g/ml kanamycin, shake at 220 rpm until OD reach to 0.6-0.8 (about 4 h) at 37 C. Afterward, take out 1 ml culture, centrifugation it at room temperature 10000 g 5 minutes. Following the centrifugation discard the supernatant and suspend the bacteria with 100 l PBS for sedimentation. Add IPTG to the remaining culture making the final concentration 1 mM, shaking at 37 C. and 220 rpm for 4 hours to induce the expression of recombinant protein. Next take 1 ml of the culture, and centrifuge at room temperature of 10000 g for 5 minutes. After centrifugation, discard the supernatant, and suspend the bacteria with 100 l PBS for sedimentation. After centrifugation and precipitation, supernatant were discarded, and cell pellets were weighed and recorded, and stored in 20 C. refrigerator.

(57) Protein expression detection: take the bacterial suspension before and after induction in the previous step, add 2SDS sample buffer of equal volume, mix and heat them at 100 C. for 5 minutes, and then SDS-PAGE electrophoresis and Coomassie Brilliant blue staining were conducted to detect the recombinant protein (FIG. 5). The results presented in FIG. 5 showed that the transformed bacteria produced the target protein under the induction of IPTG and showed strong protein bands at the molecular weight of 15 kDa, which was in line with the theoretical value of the target protein. Non-induced bacteria produce no such protein.

(58) Purification of recombinant protein by affinity chromatography: firstly, the IPTG induced bacteria were broken by ultrasound, and 30 ml Tris HCl (PH8.0)/1 g of bacteria wet weight was added to the IPTG induced bacteria, evenly suspended, then centrifuge this suspension at 4 C. and 10000 rpm for 30 minutes. After cleaning the bacterial sediment three times, the bacteria were resuspended. The bacteria were broken by ultrasonic (Ningbo Xinzhi ultrasonic crusher Y-92III). A glass beaker containing the bacterial solution was placed in an ice bath. The ultrasonic time was 3 seconds, the interval time was 5 seconds, and the total ultrasonic working time was 8 minutes. After ultrasound, the culture then is centrifuged at 4 C. and 10000 rpm for 15 minutes, supernatant and sediment were collected on which SDS-PAGE was preformed (FIG. 6). The results presented in FIG. 6 showed that the recombinant protein mainly appeared in the supernatant after centrifugation, indicating that the recombinant protein was synthesized in the form of soluble in the cell, avoiding the subsequent refolding process of inclusion bodies.

(59) The recombinant protein was purified by affinity chromatography with AKTA purifier (GE company), DEAE column was selected (Huiyuan). The supernatant solution of bacterial lysate containing the recombinant protein was added to the purification column. The volume of the sample could be 40 ml-100 ml (1-5 mg/ml) at one time, and the flow rate of sample was 1.5 ml/minute. The mobile phase solution A was 50 mM Tris HCl, PH8, when the OD280 value of the effluent reaches the baseline, and then mobile phase solution B was used, which is 50 mM Tris HCl company with 1M NaCl, PH8.0, elute the target protein with different gradient B solution, 10% B, 18% B, 100% B at the flow rate of 4 ml/minute. The effluent was collected and labeled. The purified protein was detected by SDS-PAGE electrophoresis. FIG. 7 shows the protein collected by the first step elution. The further purification was carried out with Phenyl Sepharose FF column. After removing impurities, stored the recombinant protein at 20 C.

(60) Conclusion: the recombinant protein can be produced in the cells after IPTG induction of plasmid transformed bacteria, and it is found that the recombinant protein mainly exists in the supernatant of lysate, indicating that Cra4S1 exists in the form of soluble protein. The purified Cra4S1 protein was obtained by affinity chromatography. The molecular weight of the recombinant protein was about 15 kDa, which is in line with the expected theoretical value.

Example 4

(61) Calculation Method of Lesion Area in Soft Tissue in Mouse Distraction Model

(62) In order to detect the pathogenicity and virulence of P. gingivalis, a mouse model of epidermis and subcutaneous soft tissue lesions was established.

(63) It is summarized as follows: P. gingivalis, including various subtypes (P. gingivalis W50, Thai, QML and 381), are all grown on the Fastidious Anaerobic Agar (FAA) plate containing 5% defibrinated horse blood and placed in an anaerobic incubator at 37 C., containing 80% nitrogen, 10% hydrogen and 10% carbon dioxide. The bacterial colonies were transferred to the freshly prepared BHI culture medium (Brain Heart extract culture medium) containing 5 g/ml hemin, grown for 18-24 hours, until the OD600 nm reached 1-1.2, and then the culture was centrifuged and washed twice, and following the washing, make bacterial suspension at different concentrations (2-810.sup.10 CFU/ml) using BHI culture medium for animal experiments (Balb/c, purchased from Yangzhou University Animal Centre). Mice were divided into groups according to different experimental plans. Those mice are generally 6-8 weeks old, 18-22 g in weight, 8-12 in each group. Each mouse was inoculated with 200 l of bacterial suspension, subcutaneously injected on both sides of the vertebrae on the back. After the bacterial challenge, the weight changes, behaviours, and actions of the mice were recorded, and the lesions of skin and subcutaneous soft tissue were recorded.

(64) Specifically, when using P. gingivalis W50 subtype to challenge Balb/c mice, prepare 3*10.sup.10 CFU/ml bacterial suspension, and inject 0.2 ml of the bacteria suspension into the subcutaneous on both sides of the back spine of mice.

(65) Results: FIG. 8 showed that animal skin and subcutaneous soft tissue distraction after bacteria challenge, and the white line circle marks the lesion area. It originally started with manually measuring the longest longitudinal diameter and the corresponding transverse diameter of the lesion, multiplied by the diameter to calculate the lesion area, and all handwritten data are stored. In April 2019, the method of identifying and calculating the lesion area was improved. A fixed camera was used to take pictures, the distance between the camera and the lesion area remained unchanged, and then the lesion area within the circle was calculated using image J (computer software name).

(66) Summary: The model of soft tissue injury on the surface of the mouse used in this embodiment is to dynamically observe the local pathological changes, including the pathological characteristics of the wound, the progress of the course of the disease, the wound healing and the prognosis of the disease, and to comprehensively determine the harm caused by the infection of P. gingivalis in combination with the indicators such as the weight change, mental state and behaviour characteristics of the mouse. The photographing and computer software are used to locate and calculate the lesion area, to reduce human errors, to keep image records, and to trace and further study the original data. The animal experimental model used in this embodiment is recognized in the industry according to international general methods and standards.

Example 5

(67) Correlation between Dose of P. gingivalis Infection and Soft Tissue Lesions in Mice

(68) The purpose of this embodiment is to investigate the subtypes of P. gingivalis corresponding to the four major outer membrane proteins, their virulence differences, and the correlation between the dose of bacterial infection and lesions.

(69) Specifically, the four different subtypes of P. gingivalis include W50 subtype, Thai subtype, QML subtype and 381 subtype, referring to the method described in Example 4. Three bacterial suspensions with different concentrations were made, namely, 510.sup.9 CFU/ml, 210.sup.10 CFU/ml, and 810.sup.10 CFU/ml, Balb/c. Mice. 6-8 weeks old, weight 18-24 g, 8-12 in each group, are used and each mouse was inoculated with 200 l bacterial suspension subcutaneously on both sides of the vertebrae on the back of mice. After bacterial challenge, the body weight, behaviour, and local soft tissue lesions of the mice were recorded.

(70) Results: With the increase in the concentration of the attacking bacteria, the systemic atrophy and local lesions of animals became more serious. The body weight loss caused by the invasion of high concentration bacteria was the most obvious, the mice were morbid, and the area of local pathological changes was the largest. When the four different P. gingivalis subtypes were challenged by the same dose of bacteria, the local damage is also inconsistent (FIG. 9A and FIG. 9B).

(71) Conclusion: FIG. 9A and FIG. 9B show that the virulence of the four tested strains of P. gingivalis are different. In FIG. 9A, PgA, PgB, PgC and PgD represent the W50, Thai, QML and 381 subtypes of P. gingivalis, and in FIG. 9B the three bacterial suspensions 1, 2 and 3 represent 510.sup.9 CFU/ml, 210.sup.10 CFU/ml and 810.sup.10 CFU/ml respectively. However, when 20 different strains of P. gingivalis (belonging to the four main subtypes of P. gingivalis) were tested in the same way in the challenge experiments, it was found that the virulence among strains was different even within the same subtype (data not shown). Therefore, the difference in virulence among strains in this embodiment did not have the representative characteristics of this subtype. That is, the results of this embodiment do not indicate what P. gingivalis subtype has the strongest or weakest virulence. However, the correlation between virulence and a dose was repeated for all four subtypes, and the greater the attack dose, the greater the harm. According to the clinical symptoms, bacteria will erupt rapidly when they gather to a certain concentration.

Example 6

(72) Correlation between P. gingivalis Infection and the Age of Experimental Mice

(73) In practice, it has been noticed that mice over 25 weeks old with no pre-infection of P. gingivalis have only slight local lesions when attacked by different subtypes of P. gingivalis. The purpose of this embodiment is to investigate the correlation between age and P. gingivalis infection.

(74) Specifically, according to the method described in Example 4, a bacterial suspension of P. gingivalis W50 subtype 2*10.sup.10 CFU/ml was made, and 0.2 ml was injected into the subcutaneous tissues on both sides of the dorsal vertebrae of the experimental mice of each age group. There were 8-10 animals in each age group. After the bacterial attack, the development of the lesion area was observed until the end of the experiment on the 35th day.

(75) Results: The same dose and volume of bacterial suspension were used to attack the mice of different age groups, and the results showed that the attack by the W50 subtype of P. gingivalis challenge causes various damage degrees, for the age range groups. In this experiment, animals of all age groups did not die after being attacked by bacteria. The animals in G1 group (weight 15-18 g) and G2 group (weight 22-26 g) were in their infancy at 4 and 8 weeks, respectively, showing rapid onset and serious pathological changes. However, the recovery of self-healing was fast, and the healing period was short. The pathological process of adult mice from 12 weeks (weight 28-32 g) of G3 group to 16 weeks (weight 32-36 g) of G4 group and to 20 weeks (weight 33-38 g) of G5 group was similar. The area of pathological damage was significantly lower than that of young group, but the prognosis of adult group was delayed (Table 1, FIG. 10).

(76) Conclusion: The animals primarily infected with P. gingivalis have the phenomenon of self-healing. The young animals can heal quickly after infection, but the adult animals have the tendency of forming chronic infection focus. This experiment has a reference value to the actual clinical situation, that is, generally, maybe teenagers are more likely to suffer from periodontal disease caused by the infection of P. gingivalis, but because it can be quickly repaired after infection, it does not cause serious local damage and get less attention in adolescence. High incidence rate of periodontal disease in adults may be explained by the delay of the course of infection and poor prognosis. So, a local damage is gradually getting worse, and later, it even causes local alveolar bone destruction and absorption, resulting in loosening of teeth. This example suggests that the prevention of P. gingivalis infection starts from childhood to adolescence.

(77) TABLE-US-00005 TABLE 1 Investigation of local lesions caused by P. gingivalis infection in mice of different age groups Average local lesion area in different age groups (unit: mm.sup.2) Time post-challenge G1 (4 G2 (8 G3 (12 G4 (16 G5 (20 (days) weeks) weeks) weeks) weeks) weeks) 0 0.00 0.00 0 0 0 1 2.60 0.00 6.86 0.00 4.17 2 169.60 81.40 51.14 31.00 49.67 3 189.90 185.50 101.14 62.50 91.83 4 196.90 195.80 117.29 96.67 91.83 5 215.30 202.10 126.57 105.83 119.00 6 230.80 216.00 129.00 114.33 124.50 7 242.60 228.30 116.29 122.50 131.00 8 239.60 229.00 98.00 118.33 127.83 9 235.50 200.70 90.14 105.67 93.00 11 181.50 143.90 68.29 88.00 76.83 13 140.60 98.50 46.57 67.33 60.83 15 26.45 56.00 4.71 38.33 10.00 17 3.60 18.25 9.43 21.67 8.00 20 0.00 0.30 7.14 14.50 4.17 23 0.00 0.00 5.29 11.83 0.00 30 0.00 0.00 0.14 6.00 0.00 35 0.00 0.00 0.00 0.67 0.00

Example 7

(78) Repeat Infection of P. gingivalis Causes Local Aggravation and General Weakness

(79) The experimental results of Example 6 showed that the animals primarily infected with P. gingivalis had self-healing phenomenon, and the younger the animals were, the faster the recovery was. In clinical practice, periodontal disease often presents a state of intermittent progressive development. The purpose of this embodiment is to investigate the local and systemic harm caused by repeat chronic infections to the experimental animals by comparing the experimental animal models of single and repeat infections.

(80) Specifically, mice of the same age, 8-10 weeks old and weighing 26-30 g, were divided into two groups. Group 148 (G148) was challenged by P. gingivalis QML subtype of 510.sup.10 CFU/ml bacteria suspension, and group 148.1 (g148.1) was not attacked. After 40 days, the mice in group 148 (G148) who were attacked by bacteria were self-cured. At this time, the mice in group in group 148 (G148) and the mice in group 148.1 (g148.1) were both infected with QML subtype of P. gingivalis in bacterial suspension at 510.sup.10 CFU/ml, the method was the same as that of Example 4.

(81) Results: When the animals were attacked by the second time challenge, the areas of local lesions were larger than those of the first-time infection group (Table 2). In addition, the overall condition of the animals with the second infection showed a trend of weakness, which was manifested in dark hair, shrug, withered tail, slow recovery, and poor prognosis. Repeat infection experiments have been done in four major subtypes of P. gingivalis, and similar results have been obtained. The local lesions are shown in FIG. 11A, and the general condition of mice is shown in the video screenshot. FIG. 11B shows the video screenshot of the general condition of the mice in G148 group on the 24th day after being infected by the P. gingivalis QML subtype. FIG. 11C shows the video screenshot of the recovered mice in G148.1 group on the 24th day after being infected by the P. gingivalis QML subtype of for the first time.

(82) TABLE-US-00006 TABLE 2 Comparison of the areas of soft tissue damage caused by P. gingivalis repeat infection and primary infection (unit: mm.sup.2) time post-challenge (days) Group 2 4 6 8 10 12 14 18 24 31 148 repeat 19.85 176.52 258.84 234.19 177.54 196.02 134.32 113.04 70.34 35.53 infection 148.1 primary 20.66 136.01 172.69 238.30 196.87 208.50 95.06 54.00 0.00 1.38 infection

(83) Conclusion: The results of animal experiments show that the persistent infection of P. gingivalis not only makes the local pathological changes worse, but also affects the general health. Clinically, periodontal disease not only causes tooth loosening and falling off, but also there are a large number of published clinical and statistical data on the correlation between periodontal disease and systemic diseases. Periodontal disease is an independent risk factor for coronary heart disease and its acute attack, and an independent risk factor for stroke. It has been found that the pathogenic bacteria of periodontal disease, P. gingivalis has a direct link to Alzheimer's disease. Whether chronic recurrent P. gingivalis infection can directly cause cardiovascular disease or Alzheimer's disease needs further data proof and research. The invention aims to solve the problem resulting from chronic infection by pathogenic bacteria using immunological method and prevent the long-term extension of pathogenic bacteria from endangering the general health.

Example 8

(84) Discovery of Combination Vaccine

(85) This embodiment was an initial attempt in the discovering of combined vaccine for its immune protection function. At first, the purpose of the experiment was to investigate whether there was immune cross protection between different subtypes of P. gingivalis outer membrane protein RagB. Therefore, RagB bivalent vaccine, including W50ragB protein, (more details about protein sequence, protein purification and other production methods similar to those presented in Example 3, can be found in PCT/GB2005/001976, the content of which is incorporated here by reference) and QMLragB protein (more details about protein sequence, protein purification and other production methods similar to those presented in Example 3, can be found in PCT/GB2005/001976, the content of which is incorporated here by reference) was prepared at the mass ratio of 1:1. After second immunization, Cra4S1 protein (Cra4S1 protein prepared in Example 3) was added, and each protein was given three times of immunization opportunities. Adding Cra4S1, a common antigen of all subtypes, is to investigate whether the new combined vaccine can affect the immune protection effect of RagB vaccine.

(86) Immune scheme, the purified Cra4S1 protein described in Example 3 and different subtype RagB protein were used to immunize animals (Table 3-1, Table 3-2). Mice aged 6-7 weeks and weighing 18-22 g were divided into three groups. The first group (divided into three sub-groups: G11, G14 and G17) animals were immunized with QMLragB protein and W50ragB protein; the second group (divided into three sub-groups: G12, G15 and G18) animals were immunized with combination vaccine containing QMLragB protein, W50ragB protein and Cra4S1 protein; the third group (divided into three sub-groups: G13, G16 and G19) animals were not immunized as control. The final formula of the combination vaccine of the embodiment is Cra4S1 protein: W50ragB protein: QMLragB protein, with a mass ratio of 1:1:1.

(87) Specifically, each mouse was intraperitoneally injected with 100 l recombinant protein solution. The first group (G11, G14 and G17) used 100 l solution containing 5-50 g W50ragB protein, 5-50 g QMLragB protein and 250 g aluminum adjuvant, which was implemented according to the immunization plan in Table 3-1; the second group (G12, G15 and G18) used 100 l solution containing 5 g Cra4S1 protein, 5-50 g W50ragB protein, 5-50 g QMLragB protein, and 250 g aluminum adjuvant according to Table 3-2; the third group (G13, G16 and G19) was control without vaccination. The interval between immunizations was 3-4 weeks. Serum antibody titers were detected before immunization and during antibody production. After the three times of immunization, the titer of the specific antibody was detected by ELISA, and when the titer of the antibody was higher than 1:100000, bacterial challenge experiment can be carried out, by the method as described in Example 4.

(88) TABLE-US-00007 TABLE 3-1 G11/G14/G17 immunization plan First Second Third immunization immunization immunization G11 W50ragB: 50 g W50ragB: 50 g W50ragB: 5 g G14 QMLragB: 50 g QMLragB: 50 g QMLragB: 5 g G17

(89) TABLE-US-00008 TABLE 3-2 G12/G15/G18 immunization plan First Second Third Fourth Fifth immunization immunization immunization immunization immunization G12 W50ragB: 50 g W50ragB: 50 g W50ragB: 5 g Cra4S1: 5 g Cra4S1: 5 g G15 QMLragB: 50 g QMLragB: 50 g QMLragB: 5 g G18 Cra4S1: 5 g

(90) TABLE-US-00009 TABLE 3-3 Comparison of immune protection function between combined vaccine and RagB vaccine 7 Days post-challenge 9 Days post-challenge 11 Days post-challenge Average Average Average Subtype lesion Standard lesion Standard lesion Standard P. gingivalis Group Vaccine area mm.sup.2 deviation area mm.sup.2 deviation area mm.sup.2 deviation P. gingivalis G11 W50ragB 82.04 9.11 65.79 29.69 69.17 28.67 W50 QMLragB G12 W50ragB 82.72 14.35 58.76 12.81 55.47 12.34 QMLragB Cra4S1 G13 N/A 119.35 65.36 73.02 22.16 73.43 26.89 P. gingivalis G14 W50ragB 109.66 31.77 108.66 35.47 102.30 30.09 Thai QMLragB G15 W50ragB 107.26 32.37 173.09 13.92 136.37 26.00 QMLragB Cra4S1 G16 N/A 97.48 37.11 133.26 57.18 116.35 43.97 P. gingivalis G17 W50ragB 78.21 10.68 101.99 8.49 99.39 15.02 QML QMLragB G18 W50ragB 81.52 11.96 86.42 14.61 86.83 10.95 QMLragB Cra4S1 G19 N/A 112.74 63.33 123.86 60.46 134.16 84.84

(91) Results: The animals were immunized with W50ragB and QMLragB proteins, and then Cra4S1 protein was added to vaccine formula to form new combination. The immune protection function of combined vaccine was significantly enhanced in response to the challenge of P. gingivalis subtypes (W50 subtype and QML subtype), which showed that the soft tissue lesion areas were smaller than those of the control group (Table 3-3). In FIG. 12, the abscissa is G17 (W50ragB and QMLragB mixed vaccine), G18 (combination vaccine contains Cra4S1 protein, W50ragB protein and QMLragB protein), G19 (control group of mice not immunized), and the challenge bacteria is P. gingivalis QML subtype.

(92) In Table 3-3, the animals immunized with bivalent vaccines containing W50ragB and QMLragB bivalent vaccines or W50ragB, QMLragB and Cra4S1 trivalent combination vaccines did not show the immune protection effect on the P. gingivalis Thai subtype, and the local damage of the trivalent combination vaccine was even more serious than the other two groups.

(93) Conclusion and analysis: This example is the initial attempt of combined vaccine. The reason for the decrease of vaccine dosage is that the vaccine dose-dependent experiment was conducted at the same time. In fact, the follow-up study found that high titer antibody can also be produced when the vaccination dosage of four RagB proteins in the range of 0.5-5 g. The preliminary experiment is further improved, the results lay the foundation for the follow-up study.

(94) The results of this embodiment show that the combined vaccine not only enhances the immune protection effect, but also improves the stability of the product. This phenomenon suggests that the combination of two proteins with different targets can improve the efficacy of the product. The principle that the combined vaccine enhances the immune effect and stability may be related to the fact that the two subunits of RagA and RagB are controlled by the same transcription factor. When the targets of the two interrelated subunits on the bacterial surface are occupied by antibodies, a more stable sub structure could be formed, and the binding of antigen and antibody limits the function of bacterial outer membrane protein. Another hypothesis is that the firm binding of two antigens and antibodies is more likely to trigger the body to play a better immune synergy/coordination to eliminate and inhibit pathogens.

(95) Initially, when the recombinant Cra4S1 protein was successfully expressed, it was noted that Cra4S1 protein alone could be used to immunize animals to obtain high titer specific antibodies. In several separate experiments, it was also observed that the local soft tissue damage in the immunized animal group was more serious than that in the control group, indicating that Cra4S1 may be involved in hypersensitivity reaction, and cra4s1 protein is not considered to be a good candidate vaccine. In more than two years of practice, in vitro antibody experiments showed that if animals were immunized with RagB vaccine and then attacked with P. gingivalis, the collected serum antibody had a certain degree of immune cross reaction with recombinant Cra4S1 protein. This phenomenon shows that when RagB antibody reacts with P. gingivalis outer membrane protein RagB, the original spatial structure of cra4s1 protein changes and its antigenicity is exposed, which creates an opportunity for the reaction of two target antigens and antibodies.

(96) This embodiment also proves that RagB vaccine only protects the corresponding P. gingivalis subtype, the combination vaccine of Cra4S1 and RagB only plays an immune protection role for the corresponding P. gingivalis subtype. For example, the combination vaccine of Cra4S1 and QMLragB protects the body against the challenge of QML subtype of P. gingivalis but has no protective effect on Thai subtype of P. gingivalis.

(97) Therefore, the combination vaccine described in this embodiment needs to contain the RagB protein (different subtypes) and Cra4S1 of P. gingivalis, and the combination of the two molecules can enhance the immune protection function and stability. The combination vaccine is a new concept. The following embodiment further verifies and applies the combination vaccine.

Example 9

(98) Investigation on the Immunoprotective Effect of Combined Vaccine on Infected Animals

(99) Clinically, in most cases, patients with discomfort decide to go to the dentist, and periodontal disease/peri-implant inflammation is already in a serious state. In this embodiment, the immune protective effect of combined vaccine on P. gingivalis infected animals was discussed.

(100) Specifically, mice 3-4 weeks old and weighing 12-16 g were divided into 5 groups (Table 4), with 5-6 mice in each group. Four groups of mice were subcutaneously injected with 200 l low-dose P. gingivalis W50 subtype bacterial suspension (5*10.sup.8 CFU/ml) on the back, resulting in mild infection. The diet and activities of infected mice were normal. After bacterial attack, some animals had slight weight loss, and then their weight continued to grow. One week later, infected mice could have small local lesions. Group 5 uninfected mice were used as control. The mice were fed for 4 weeks and then vaccinated.

(101) The infected animals were divided into four groups according to the plan including vaccine dose and immunization time listed in Table 4. G154 group was immunized with W50ragB protein, G155 group was immunized with Cra4S1 Protein, and G156 group was immunized with Cra4S1 and W50ragB mixed vaccine. G157 group was a control group with mild infection but not vaccinated, and G158 group was a same batch non-infected control.

(102) After three times of immunization, one mouse in each group was selected for blood collection to detect the antibody titre, and then the animals were challenged with P. gingivalis W50 subtype according to the method described in Example 4. The concentration of bacterial suspension was 510.sup.10 CFU/ml, and 200 l was injected subcutaneously into the back. After bacterial challenge, the weight, behaviour and local soft tissue injury of mice were recorded, and regular general condition videos were recorded.

(103) Results: both monovalent and combination vaccine immunized animals in the pre-infected animal group showed that the damage degree of local soft tissue was lower than that in the control group and uninfected control group (Table 5 and FIG. 13). The records of the animal group receiving the vaccine on the 24th day after infection showed that it had been cured. The indexes of the combined vaccine group were better than the monovalent vaccine, and the prognosis of the control group was poor.

(104) In this embodiment, the phenomenon described in Example 7 also occurs, that is, the local damage of animals repeatedly infected with P. gingivalis is more serious (Table 5, FIG. 13 and FIGS. 14A & 14B). Especially in the process of animal recovery, the video screenshot in FIGS. 14A & 14B shows the state of the animal. The mice receiving the vaccine were in good physical condition, with smooth hair, balanced body and free movement, while the mice in the control group were difficult to recover from body surface ulcer, dull hair and slow movement. There was no significant change in body weight between the experimental group and the control group.

(105) TABLE-US-00010 TABLE 4 Post infection immunization test plan for G154-G158 in 2019 Group Group Pre- Subtype name size infection Vaccine Dose Interval P. gingivalis G154 7 Yes W50ragB protein 1 g 4 w/3 w/4 w W50 G155 6 Yes Cra4S1 protein 0.5 g 4 w/3 w/4 w W50 G156 7 Yes W50ragB protein 1 g + 4 w/3 w/4 w W50 Cra4S1 protein 0.5 g G157 7 Yes N/A / / W50 G158 7 N/A N/A / / W50

(106) TABLE-US-00011 TABLE 5 Immune the mean values in protection experiments (unit: mm.sup.2) and standard deviation of lesion area post-infection Time (Days) 4 10 14 24 31 Group AVG STDEV AVG STDEV AVG STDEV AVG STDEV AVG STDEV G154 58.28 21.48 74.67 17.68 68.58 19.47 0.00 0.00 0.00 0.00 G155 65.57 24.13 68.37 28.91 53.03 25.61 0.00 0.00 0.00 0.00 G156 44.31 16.20 64.67 26.99 49.64 16.95 0.00 0.00 0.00 0.00 G157 102.15 62.30 104.51 65.55 82.08 51.03 71.22 155.69 22.15 54.25 G158 65.69 8.16 82.51 36.35 68.51 28.25 36.34 77.31 5.56 11.37

(107) Conclusion: in the Example 7, it shows that repeated infection with P. gingivalis will not only lead to progressive local injury, but also affect the overall health. Table 5 shows that when the combined vaccine is used for pre-infected animals, the immune protection show that the degree of local lesions decreases, the mean value of lesion area (AVG) decreases, and the standard deviation (STDEV) of data is at a low level, and the immunized animals are in good condition. These results show that the combined vaccine can play an effective immune protective role in healthy people or infected people. Similar experiments were carried out on four major P. gingivalis subtypes. These data indicate that the use of the patented technology combination vaccine of the invention is beneficial to general health and has a wide market demand.

Example 10

(108) Investigation of the Passive Immune Protection Function of Specific Double Target Antibody

(109) The purpose of this study was to explore whether passive immunization (i.e. injection of specific antibodies) can play a safe and effective role in immune protection. In fact, as a therapeutic drug, antibodies are usually targeted at infected patients, therefore, this embodiment analyzes both uninfected and infected animals.

(110) Specifically, the scheme for preparing mouse specific antiserum is shown in Table 6-1 (more details about protein sequence, protein purification and other production methods similar to those presented in Example 3, can be found in PCT/GB2005/001976, the content of which is incorporated here by reference). After three times of immunization, the titer of specific antibodies in serum was determined by indirect ELISA. Finally, blood was collected, and the polyclonal antibodies were stored in the refrigerator at 20 C.

(111) TABLE-US-00012 TABLE 6-1 Polyclonal antibody immunization plan Polyclonal First Second Third antibody Animals immunization immunization immunization Anti-ThairagB Balb/C mice, Male ThairagB: 0.5 g ThairagB: 0.5 g ThairagB: 0.5 g serum 5-6 weeks old, Anti-Cra4S1 weight 16-20 g, Cra4S1: 1 g Cra4S1: 1 g Cra4S1: 1 g serum 5-8 mice/group Anti-ThairagB + ThairagB: 0.5 g ThairagB: 0.5 g ThairagB: 0.5 g Cra4S1 serum Cra4S1: 1 g Cra4S1: 1 g Cra4S1: 1 g

(112) The grouping of animal experiments is shown in Table 6-2. Mice in G361, G362, G363, G364 and G369 groups received pre-infection, and 200 l bacterial suspension (510.sup.8 CFU/ml) was injected subcutaneously into the back of mice. Mice in G370, G371, G372, G373, and G374 groups were not infected.

(113) Specifically, these mice were 9-10 weeks old and weighed 28-32 g. Four days before and one day before the bacterial challenge, 100 l antibody solution containing 200 g mouse serum was injected into the abdominal cavity of experimental mice according to the experimental plan in Table 6, and then the bacterial challenge experiment was carried out, following the method described in Example 4. The weight and behaviour of mice before and after the challenge were observed and recorded, the development of subcutaneous soft tissue injury was recorded, and the area of skin injury was measured (Table 7).

(114) TABLE-US-00013 TABLE 6-2 Animal grouping information for antibody passive immune protection Pre- Group name size infection Polyclonal antibody Dose Volume G361 8 yes Anti-ThairagB serum 200 g/mouse 100 l G362 8 yes Anti-ThairagB + 200 g/mouse 100 l Cra4S1 serum G363 8 yes Anti-Cra4S1 serum 200 g/mouse 100 l G364 8 yes Normal serum 200 g/mouse 100 l G369 8 yes PBS N/A 100 l G370 4 no Anti-ThairagB serum 200 g/mouse 100 l G371 4 no Anti-ThairagB + 200 g/mouse 100 l Cra4S1 serum G372 5 no Anti-Cra4S1 serum 200 g/mouse 100 l G373 6 no Normal serum 200 g/mouse 100 l G374 6 no PBS N/A 100 l

(115) TABLE-US-00014 TABLE 7 Record of average lesion area in antibody passive immunoprotection experiment (unit: mm.sup.2) post-challenge time Group 0 2 4 6 8 10 12 14 17 21 28 32 G361 0 184.27 124.91 166.74 236.72 197.79 156.33 106.04 61.23 31.05 13.88 0.00 G362 0 195.08 95.38 180.54 186.96 152.41 97.08 44.43 12.53 4.37 2.02 0.00 G363 0 239.75 194.29 249.85 265.03 221.80 141.58 90.64 28.71 3.51 0.00 0.00 G364 0 251.98 183.93 230.06 212.13 164.39 99.88 59.84 13.06 10.28 4.05 0.00 G369 0 206.68 139.09 219.30 210.55 202.80 140.63 86.03 21.47 2.77 0.00 0.00 G370 0 116.42 109.95 118.07 136.79 113.62 82.43 70.07 71.08 0.00 448.97 110.89 G371 0 155.34 131.54 172.22 195.88 217.62 157.67 101.65 43.61 8.39 0.00 0.00 G372 0 291.57 246.22 252.10 285.31 282.30 207.49 140.88 81.25 8.66 0.84 5.07 G373 0 457.47 294.04 324.44 433.62 419.36 341.65 171.24 55.08 7.16 0.00 0.00 G374 0 243.82 262.59 270.86 297.03 307.68 151.93 90.18 19.20 0.00 0.00 0.00

(116) Results: The mortality of the experimental animals was higher than expected in this embodiment when the animals were challenge with conventional doses of bacteria, and it should be noted that all animals in this embodiment have an intraperitoneally injection. The challenge dose of P. gingivalis designed in this project has been tested repeatedly, and the death of infected animals rarely occurs. In this example, in FIG. 15A, all animals did not have pre-infection. Some animals died in group G370 injected with anti-ThaiRagB antibody, G372 injected with anti-Cra4S1 antibody, G373 control group injected with normal serum and G374 control group injected with PBS, the mortality rates were 75% (), 40% (), 33.3% ( 2/6) and 50% ( 3/6), respectively, while no animal death occurred in the G371 which injected with serum of the combined antibody group (anti-ThairagB and anti Cra4S1). In this example, FIG. 15B shows that G364 normal serum control and G369 PBS control have higher mortality rates, which are 37.5% () and 62.5% (), respectively, the mortality rates of G361 injected with anti-ThaiRagB, G362 the combined antibodies of ThairagB and Cra4S1 were 25% ( 2/8) and 12.5% (), respectively. All the animals in G363 group with anti-Cra4S1 antibody survived.

(117) In FIGS. 16A and 16B, animals in the specific combined antibody group sustained the local lesions in a lower range of than the surviving animals in other groups in both pre-infected and uninfected animals did, in these two sets of experiments, only one death occurred in the pre-infected group. The severity of local lesions in the anti-ThairagB serum group was lower than that in the control group, however, only one animal survived in the uninfected group, which was difficult to evaluate the real situation of the whole group.

(118) The anti-Cra4S1 antibody group showed an elusive phenomenon. Particularly, when animals received the antibody, their survival rate was the highest, and there was no death. However, the local lesions were more serious than those in the anti-ThairagB and the combined antibody (anti-ThairagB and anti-Cra4S1) groups (FIGS. 16A and 16B).

(119) Conclusion: the experimental results of Example 10 show that the combined antibody (anti-ThaiRagB and anti-Cra4S1) provides a stable, safe and efficient protection from the infection of P. gingivalis, demonstrating an immunoprotective effect on both uninfected and pre-infected experimental animals (FIGS. 16A and 16B). The use of anti-ThairagB antibody and anti-Cra4S1 antibody alone had uncertainty in therapeutic. The experimental results of this example suggest that when a single target antibody reacts with the antigen molecules on the surface of the bacteria, there may be a structural instability, so the antibody efficacy is defective. When double target specific antibodies are used, the combined antibodies occupy the antigen targets of the main outer membrane proteins specifically, and block the function of outer membrane proteins, so as to achieve the effect of inhibiting and eliminating bacteria and reducing bacterial virulence.

(120) In summary, Cra4S1 an important outer membrane protein component of P. gingivalis, is discovered and confirmed by the present disclosure; the expression of Cra4S1 protein is achieved; the theory of combined vaccine and double target specific antibody is proposed by combining Cra4S1 with specific/characteristic outer membrane protein RagB of bacteria; and the experimental data disclosed herein prove that the innovative product demonstrate effective and stable inhibition against bacteria. The new technology has prospects of a wide industrial application.

(121) The above is only the preferred embodiment of the invention. It should be noted that for those skilled in the art, without departing from the principles of the invention, several improvements and refinements can be made. These improvements and refinements should also be considered as the protection scope of the invention.