Targeted chimeric antigen receptor modified T cells for treatment of IL13RALPHA2 positive malignancies

12551557 ยท 2026-02-17

Assignee

Inventors

Cpc classification

International classification

Abstract

Chimeric antigen receptors targeted to IL-13Ra2 are described. The targeting domain is a IL13 variant having increased specificity for IL-13Ra2 relative to IL-13Ra1.

Claims

1. A nucleic acid molecule comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), wherein the chimeric antigen receptor comprises: targeting domain comprising an amino acid sequence selected from: SEQ ID NO: 30-37; a spacer domain; a transmembrane domain; a costimulatory domain and a CD3zeta domain.

2. The nucleic acid molecule of claim 1, wherein the spacer domain is selected from the group consisting of: and IgG4(EQ) spacer domain, a IgG4(HL-CH3) spacer domain and an IgG4(CH3) spacer domain.

3. The nucleic acid molecule of claim 1, wherein the spacer domain comprises any one of SEQ ID NO: 10, 9, and 12.

4. The nucleic acid molecule of claim 1, wherein the transmembrane domain is selected from the group consisting of: a CD4 transmembrane domain, a CD8 transmembrane domain, and a CD28 transmembrane domain, and wherein the co-stimulatory domain is selected from a CD28 costimulatory domain, and CD28gg costimulatory domain, and a 41-BB co-stimulatory domain.

5. The nucleic acid molecule of claim 1, wherein the CAR comprises or consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 39-68.

6. The nucleic acid molecule of claim 1, wherein the CAR comprises or consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 39-68 wherein the spacer having the amino acid sequence of SEQ ID NO: 10 is replaced by the amino acid sequence of any of SEQ ID NOs: 2-9 and 11.

7. A nucleic acid molecule comprising a nucleotide sequence encoding a chimeric antigen receptor (CAR), wherein the chimeric antigen receptor comprises: a targeting domain comprising an amino acid sequence comprising a variant IL13 domain comprising 109, 110, 111, contiguous amino acids of SEQ ID NO: 1 or the entirety of SEQ ID NO: 1 with 1, 2, 3, 4 or 5 single amino acid changes, provided that there is an amino acid other than E at position 90 of SEQ ID NO:1; a spacer domain; a transmembrane domain; a costimulatory domain; and a CD3zeta domain.

8. The nucleic acid molecule of claim 7, wherein there is an L at position 90 of SEQ ID NO: 1.

9. The nucleic acid molecule of claim 1, wherein the spacer domain comprises the amino acid sequence of any of SEQ ID NOs: 2-12, and wherein the costimulatory domain comprises the amino acid sequence of any of SEQ ID NOs: 22-25.

10. The nucleic molecule of claim 1, wherein the CAR comprises the amino acid sequence of any of SEQ ID NOs: 39-68 with up to 5 single amino acid substitutions.

11. A vector or an expression vector comprising the nucleic acid molecule of claim 1.

12. A population of human T cells or NK cells harboring the nucleic acid molecule of claim 1.

13. The population of human T cells of claim 12, wherein the population of human T cells comprise central memory T cells, naive memory T cells, pan T cells, or PBMC substantially depleted for CD25+ cells and CD14+ cells.

14. A method of treating a patient suffering from glioblastoma, pancreatic ductal adenocarcinoma, melanoma, ovarian carcinoma, renal cell carcinoma, breast cancer or lung cancer, comprising administering to the patient a population of autologous or allogeneic human T cells or NK cells harboring the nucleic acid molecule of claim 1.

15. The method of claim 14, wherein the cells are administered locally or systemically.

16. The method of claim 14, wherein the cells are administered intraventricularly.

17. The method of claim 14, wherein the human T cells or NK cells administered by single or repeat dosing.

18. A method of preparing CAR T cells or CAR NK cells comprising: providing a population of autologous or allogeneic human T cells or NK cells and transducing the cells with a vector comprising the nucleic acid molecule of claim 1.

19. A polypeptide encoded by the nucleic acid molecule of claim 1.

20. The nucleic acid molecule of claim 1, wherein the nucleic acid molecule is RNA or DNA.

21. The nucleic acid molecule of claim 1, wherein the targeting domain comprises or consists of the amino acid of SEQ ID NO: 30.

22. The nucleic acid molecule of claim 1, wherein the targeting domain comprises or consists of the amino acid of SEQ ID NO: 31.

23. The nucleic acid molecule of claim 1, wherein the targeting domain comprises or consists of the amino acid of SEQ ID NO: 32.

24. The nucleic acid molecule of claim 1, wherein the targeting domain comprises or consists of the amino acid of SEQ ID NO: 33.

25. The nucleic acid molecule of claim 1, wherein the targeting domain comprises or consists of the amino acid of SEQ ID NO: 34.

26. The nucleic acid molecule of claim 1, wherein the targeting domain comprises or consists of the amino acid of SEQ ID NO: 35.

27. The nucleic acid molecule of claim 1, wherein the targeting domain comprises or consists of the amino acid of SEQ ID NO: 36.

28. The nucleic acid molecule of claim 1, wherein the targeting domain comprises or consists of the amino acid of SEQ ID NO: 37.

29. The method of claim 14, wherein the CAR comprises or consists of an amino acid sequence selected from the group consisting of: SEQ ID NO: 39-68.

Description

DESCRIPTION OF DRAWINGS

(1) FIG. 1: Schematic diagram of WT IL13 CAR certain variant IL13 CAR. IL-13 variant sequences are indicated. Variations in the hinge/linker (spacer) domains, transmembrane domains, and costimulatory domains are indicated. A linker (e.g., GGG) is generally present between the costimulatory domain and CD3zeta. The inclusion of a T2A ribosomal skip sequence and a truncated CD19 (CD19t) marker is optional.

(2) FIG. 2: IL13 variant CAR T cells exhibit differential targeting of tumors expressing IL13Ra2, IL13Ra1, or IL13Ra1/IL4R. Parental HT1080 tumor cells, HT1080 tumor cells genetically modified to overexpress IL13Ra1, IL13Ra1 and IL4, or IL13Ra2, were incubated alone (white bars) or co-incubated 1:1 with either mock-transduced T cells (Mock), or T cells transduced to express the indicated IL-13 variant-containing CAR. After 3 days in culture, numbers of viable tumor cells were evaluated. While all CART cells targeted the IL13Ra2-expressing tumor cells, only the previously described E11Y variant also directed killing of the IL13Ra1- and IL13Ra1/IL4R-expressing tumors, while the LK and L variant directed killing of IL13Ra1/IL4R-expressing tumors.

(3) FIG. 3: Depicts the amino acid sequence of CAR having: a variant IL13 targeting domain, an IgG4 (EQ) spacer, CD28 TM domain, 41-BB co-stimulatory domain and a CD3zeta domain (SEQ ID NOs: 39-40).

(4) FIG. 4: Depicts the amino acid sequence of CAR having: a variant IL13 targeting domain, an IgG4 (EQ) spacer, CD28 TM domain, 41-BB co-stimulatory domain and a CD3zeta domain (SEQ ID NOs: 41-42).

(5) FIG. 5: Depicts the amino acid sequence of CAR having: a variant IL13 targeting domain, an IgG4 (EQ) spacer, CD28 TM domain, 41-BB co-stimulatory domain and a CD3zeta domain (SEQ ID NOs: 43-44).

(6) FIG. 6: Depicts the amino acid sequence of CAR having: a variant IL13 targeting domain, an IgG4 (EQ) spacer, CD28 TM domain, 41-BB co-stimulatory domain and a CD3zeta domain (SEQ ID NOs: 45-46).

(7) FIG. 7: Depicts the amino acid sequence of CAR having: a variant IL13 targeting domain, an IgG4 (EQ) spacer, CD4 TM domain, CD28 co-stimulatory domain and a CD3zeta domain (SEQ ID NOs: 47-48).

(8) FIG. 8: Depicts the amino acid sequence of CAR having: a variant IL13 targeting domain, an IgG4 (EQ) spacer, CD4 TM domain, CD28 co-stimulatory domain and a CD3zeta domain (SEQ ID NOs: 49-50).

(9) FIG. 9: Depicts the amino acid sequence of CAR having: a variant IL13 targeting domain, an IgG4 (EQ) spacer, CD4 TM domain, CD28 co-stimulatory domain and a CD3zeta domain (SEQ ID NOs: 51-52).

(10) FIG. 10: Depicts the amino acid sequence of CAR having: a variant IL13 targeting domain, an IgG4 (EQ) spacer, CD4 TM domain, CD28 co-stimulatory domain and a CD3zeta domain (SEQ ID NOs: 53-54).

(11) FIG. 11: Depicts the amino acid sequence of CAR having: a variant IL13 targeting domain, an IgG4 (EQ) spacer, CD4 TM domain, 4-1BB co-stimulatory domain and a CD3zeta domain (SEQ ID NOs: 55-58).

(12) FIG. 12: Depicts the amino acid sequence of CAR having: a variant IL13 targeting domain, an IgG4 (EQ) spacer, CD8 TM domain, 41-BB co-stimulatory domain and a CD3zeta domain (SEQ ID NOs: 59-62).

(13) FIG. 13: Binding of yeast displayed IL13 variants to recombinant human IL13Ra2 protein. Human IL13 cDNA containing identified mutations was cloned into a yeast display vector and transformed into Saccharomyces cerevisiae strain EBY100. Single clones were induced at 20 C. in media containing galactose, followed by incubation with recombinant human biotinylated IL13Ra2-Fc and streptavidin coupled to Alexa-647 with binding was assessed by flow cytometry. The calculated KD based on the titration curve is reported.

(14) FIG. 14: Binding of yeast displayed IL13 variants to recombinant IL13Ra1 protein. Human IL13 cDNA containing identified mutations was cloned into a yeast display vector and transformed into Saccharomyces cerevisiae strain EBY100. Single clones were induced at 20 in media containing galactose, followed by incubation with recombinant human biotinylated IL13Ra1-Fc and streptavidin coupled to Alexa-647 with binding was assessed by flow cytometry. The calculated KD based on the titration curve is reported. All mutations containing L variant showed diminished binding to IL13Ra1.

(15) FIG. 15: IL13 variant CART cells exhibit differential targeting of tumors expressing IL13Ra2, IL13Ra1, or IL13Ra1/IL4R. Parental HT1080 tumor cells, HT1080 tumor cells genetically modified to overexpress IL13Ra1, IL13Ra1 and IL4, or IL13Ra2, were incubated alone (white bars) or co-incubated with either mock-transduced T cells (Mock), or T cells transduced to express the indicated IL-13 variant-containing CAR. After 2-3 days in culture, numbers of viable tumor cells were evaluated.

(16) FIG. 16: YLK and RLK IL13-CD28 variant CAR T cells exhibit comparable efficacy against IL13Ra2 expression tumor lines and enhanced specificity relative to IL13Ra1 or IL13Ra1/IL4R expressing lines.

(17) FIG. 17: YLK and YL IL13-28tm-41BB variant CART cells exhibit superior efficacy against IL13Ra2 expressing patient derived brain tumor (PBT) in a 6 day re-challenge assay where 1000 seeded T cells were challenged with tumors repeatedly (total 20000).

(18) FIG. 18: In vivo efficacy of IL13-28t-41BB variant CART cells against PBT103 engineered to over express IL13Ra2. Seven days after engraftment, 0.310.sup.6 CART cells per mouse were intracranially delivered, followed by monitoring of tumor bioluminescence and survival. RLK and YL variants showed superior efficacy.

(19) FIG. 19: In vivo efficacy of IL13-28t-41BB variant CART cells including YLK variant against PBT103 engineered with over expression of IL13Ra2. Eleven days after engraftment, 0.110.sup.6 CAR per mouse were intracranially delivered, followed by monitoring of tumor bioluminescence and survival. YLK, RLK and YL showed superior efficacy.

(20) FIG. 20: Depicts the amino acid sequence of CAR having: a variant IL13 targeting domain, an IgG4(HL-CH3)(S228P) spacer, CD28 TM domain, 41-BB co-stimulatory domain and a CD3zeta domain (SEQ ID NOs: 63-68).

DETAILED DESCRIPTION

(21) In this disclosure the generation and anti-tumor efficacy of CAR with a variant IL13 domain targeting IL13R2 are described. The CART cells exhibited potent antigen-dependent cytotoxicity against L13R2-expressing human cancer lines.

(22) IL13R2 Targeted CAR

(23) The CAR described herein include a variant IL-13 comprising or consisting of the amino acid sequence of SEQ ID NO: SEQ ID NOs: 30-37 (e.g., SEQ ID NOs: 30-34 and 36). In preferred embodiments, the sequence comprises no more than 126 amino acids.

(24) A useful IL13 variant CAR can consist of or comprises the amino acid sequence of SEQ ID NO: SEQ ID NO: 40-68. The CAR can be expressed in a form that includes a signal sequence, e.g., a human GM-CSF receptor alpha signal sequence (MLLLVTSLLLCELPHPAFLLIP; SEQ ID NO: 29). The CAR can be expressed with additional sequences that are useful for monitoring expression, for example, a T2A skip sequence and a truncated EGFRt. The CAR can be expressed with additional sequences that are useful for monitoring expression, for example, a T2A skip sequence and a truncated CD19t. The variant IL13 CAR can comprise or consist of the amino acid sequence of any SEQ ID NO: SEQ ID NO: 40-68 with up to 1, 2, 3, 4 or 5 amino acid changes (preferably conservative amino acid changes) or with up to 1, 2, 3, 4 or 5 amino acid changes in the IL13 domain.

(25) In some embodiments, the nucleic acid encoding amino acid sequences SEQ ID NOs: 30-37 (e.g., SEQ ID NOs: 30-34 and 36) are codon optimized for expression in human cells.

(26) In some cases, the CAR can be produced using a vector in which the CAR open reading frame is followed by a T2A ribosome skip sequence and a truncated EGFR (EGFRt) or truncated CD19. (CD19t) In this arrangement, co-expression of EGFRt or CD19t provides an inert, non-immunogenic surface marker that allows for accurate measurement of gene modified cells, and enables positive selection of gene-modified cells, as well as efficient cell tracking of the therapeutic T cells in vivo following adoptive transfer. Efficiently controlling proliferation to avoid cytokine storm and off-target toxicity is an important hurdle for the success of T cell immunotherapy. The EGFRt or CD19t incorporated in the lentiviral vector can act as suicide gene to ablate the CAR+ T cells in cases of treatment-related toxicity.

(27) The CAR described herein can be produced by any means known in the art, though preferably it is produced using recombinant DNA techniques. Nucleic acids encoding the several regions of the chimeric receptor can be prepared and assembled into a complete coding sequence by standard techniques of molecular cloning known in the art (genomic library screening, overlapping PCR, primer-assisted ligation, site-directed mutagenesis, etc.) as is convenient. The resulting coding region is preferably inserted into an expression vector and used to transform a suitable expression host cell line, preferably a T lymphocyte, and most preferably an autologous T lymphocyte.

(28) Various T cell subsets isolated from the patient can be transduced with a vector for CAR expression. Central memory T cells are one useful T cell subset. Central memory T cell can be isolated from peripheral blood mononuclear cells (PBMC) by selecting for CD45RO+/CD62L+ cells, using, for example, the CliniMACS device to immunomagnetically select cells expressing the desired receptors. The cells enriched for central memory T cells can be activated with anti-CD3/CD28, transduced with, for example, a lentiviral vector that directs the expression of the CAR as well as a non-immunogenic surface marker for in vivo detection, ablation, and potential ex vivo selection. The activated/genetically modified CAR T cells can be expanded in vitro with IL-2/IL-15 and then cryopreserved. Additional methods of preparing CART cells can be found in PCT/US2016/043392.

EXAMPLES

(29) The invention is further described in the following examples, which do not limit the scope of the invention described in the claims.

Example 1: IL13 Variants Exhibit Selective Binding to IL13R2

(30) In an effort to identify IL13 variants with increased selectivity for binding IL13R2 relative to IL13R1. To assess receptor binding various mutants were compared to wild-type IL13 (GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFC PHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN; SEQ ID NO: 1) and the previously known IL3 E11Y mutant (GPVPPSTALRYLIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFC PHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN; SEQ ID NO: 69). Wild-type IL13 (WT) and the various variants were each displayed on the surface of yeast. Surface plasmon resonance with immobilized recombinant IL13R1 and immobilized IL13R2 was used to assess binding affinity. The results of this analysis are presented in Table 4. As expected, WT bound strongly to both IL13R1 and IL13R2. E11Y and E11R were somewhat more selective. E90L and R107K were more selective. YLK and RLK were the most selective, with no measurable binding to IL13R1 under the conditions used.

(31) TABLE-US-00016 TABLE 4 Binding Affinity of WT IL13 and Variants (nM) WT E11Y E11R E90L R107K YLK RLK SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID NO: 1 NO: 69 NO: 35 NO: 36 NO: 37 NO: 30 NO: 31 IL13R1 69 20 96 50 98 50 1300 2000 240 300 IL13R2 18 5 19 5 15 5 27 9 27 7 26 5 28 20

Example 2: Certain IL13 Variant CAR have Increased Selectivity for Killing IL13R2 Cells

(32) IL13 variants (E11Y (SEQ ID NO: 69), RLK (SEQ ID NO: 31), RL (SEQ ID NO: 32), YL (SEQ ID NO: 33), LK (SEQ ID NO: 34) and L (SEQ ID NO: 35) were used to create CAR constructs. In each case the construct included an IgG4(EQ) spacer, a CD28 transmembrane domain, a 4-1BB co-stimulatory domain, a GGG linker and CD3zeta.

(33) Briefly, parental HT1080 tumor cells, HT1080 tumor cells genetically modified to overexpress IL13Ra1, IL13Ra1 and IL4R, and HT1080 tumor cells genetically modified to overexpress IL13Ra2, were incubated alone or co-incubated 1:1 with either mock-transduced T cells or T cells transduced to express an IL13 variant CAR. After 3 days in culture, numbers of viable tumor cells were evaluated. As can be seen in FIG. 2, while all CAR T cells targeted the IL13Ra2-expressing tumor cells, only the previously described E11Y variant also directed significant killing of both the IL13Ra1 and IL13Ra1/IL4R-expressing tumors, while the LK and L variants directed killing of IL13Ra1/IL4R-expressing tumors.

Example 3: Binding of IL13 Variants to Recombinant IL13Ra2

(34) Human IL13 cDNA IL13 variants were cloned into a yeast display vector and transformed into Saccharomyces cerevisiae strain EBY100. Single clones were induced at 20 C. in media containing galactose, followed by incubation with recombinant human biotinylated IL13Ra2-Fc and streptavidin coupled to Alexa-647 with binding was assessed by flow cytometry. The calculated KD based on the titration curve is reported (FIG. 13).

Example 4: Binding of IL13 Variants to Recombinant IL13Ra2

(35) Human IL13 cDNA containing identified mutations was cloned into a yeast display vector and transformed into Saccharomyces cerevisiae strain EBY100. Single clones were induced at 20 C. in media containing galactose, followed by incubation with recombinant human biotinylated IL13Ra1-Fc and streptavidin coupled to Alexa-647 with binding was assessed by flow cytometry. Relative binding is shown is shown in FIG. 14, upper panel, with a different scale shown in the lower panel.

Example 5: Differential Targeting by IL13 Variant CAR

(36) As shown in FIG. 15, IL13 variant CAR T cells exhibit differential targeting of tumors expressing IL13Ra2, IL13Ra1, or IL13Ra1/IL4R. Parental HT1080 tumor cells, HT1080 tumor cells genetically modified to overexpress IL13Ra1, IL13Ra1 and IL4, or IL13Ra2, were incubated alone (white bars) or co-incubated with either mock-transduced T cells (Mock), or T cells transduced to express the indicated IL-13 variant-containing CAR. The CAR included an IgG4 (EQ) Spacer, a CD4 TM domain and a CD28 co-stimulatory domain in addition to CD3zeta or an IgG4 (EQ) Spacer, a CD28 TM domain and a 4-1BB co-stimulatory domain in addition to CD3zeta. After 2-3 days in culture, numbers of viable tumor cells were evaluated. RLK-CD28 is SEQ ID NO: 48; R-CD28 is SEQ ID NO:52; L-CD28 is SEQ ID NO: 53; K-CD28 is SEQ ID NO: 54. RLK-41BB is SEQ ID NO: 40; RL-41BB is SEQ ID NO:41; YL-41BB is SEQ ID NO: 42; L-41BB is SEQ ID NO: 54; and LK-41BB is SEQ ID NO: 43.

Example 6: YLK and RLK IL13 Variant CAR T Cells have Increased Specificity

(37) As shown in FIG. 16, YLK and RLK IL13 Variant CAR T cells exhibit comparable efficacy against IL13Ra2 expression tumor lines and enhanced specificity relative to IL13Ra1 or IL13Ra1/IL4R expressing lines. The CAR included an IgG4 (EQ) Spacer, a CD4 TM domain and a CD28 co-stimulatory domain in addition to CD3zeta, RLK-CD28 is SEQ ID NO: 48; YLK-CD28 is SEQ ID NO:52; L-CD28 is SEQ ID NO: 53; K-CD28 is SEQ ID NO: 54. RLK-41BB is SEQ ID NO: 40; RL-41BB is SEQ ID NO:47.

Example 7: YLK and YL IL13 Variant CAR T Cells Exhibit Superior Efficacy Against IL13Ra2 Expressing Patient Derived Brain Tumor

(38) As shown in FIG. 17, YLK and YL IL13-28tm-41BB variant CAR T cells exhibit superior efficacy against IL13Ra2 expressing patient derived brain tumor (PBT) in a 6 day re-challenge assay where 1000 seeded T cells were challenged with tumors repeatedly (total 20000). The CAR included an IgG4 (EQ) Spacer, a CD28 TM domain and a 4-1BB co-stimulatory domain in addition to CD3zeta. RLK-41BB is SEQ ID NO: 40; RL-41BB is SEQ ID NO:41; YL-41BB is SEQ ID NO: 42; and RL-41BB is SEQ ID NO: 41.

Example 8: In Vivo Efficacy of IL13Variant CAR T Cells

(39) FIG. 18, depicts an assessment of the in vivo efficacy of IL13-28t-41BB variant CAR T cells against PBT103 engineered to over express IL13Ra2. Seven days after engraftment, 0.310.sup.6 CAR T cells per mouse were intracranially delivered, followed by monitoring of tumor bioluminescence and survival. The CAR included an IgG4 (EQ) Spacer, a CD28 TM domain and a 4-1BB co-stimulatory domain in addition to CD3zeta. RLK-41BB is SEQ ID NO: 40; RL-41BB is SEQ ID NO:41; YL-41BB is SEQ ID NO: 42; and RL-41BB is SEQ ID NO: 41. RLK and YL variants showed superior efficacy.

(40) FIG. 19, depicts an assessment of the in vivo efficacy of IL13-28t-41BB variant CAR T cells including YLK variant against PBT103 engineered with over expression of IL13Ra2. Eleven days after engraftment, 0.110.sup.6 CAR per mouse were intracranially delivered, followed by monitoring of tumor bioluminescence and survival. The CAR included an IgG4 (EQ) Spacer, a CD28 TM domain and a 4-1BB co-stimulatory domain in addition to CD3zeta. YLK-41BB is SEQ ID NO: 39; RLK-41BB is SEQ ID NO: 40; RL-41BB is SEQ ID NO:41; YL-41BB is SEQ ID NO: 42; and RL-41BB is SEQ ID NO: 41. YLK, RLK and YL showed superior efficacy.

OTHER EMBODIMENTS

(41) It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims. All references are herein incorporated in their entirety for any and all purposes.