ENZYMES
20260045319 ยท 2026-02-12
Assignee
Inventors
Cpc classification
C12N9/0071
CHEMISTRY; METALLURGY
C12Y114/19
CHEMISTRY; METALLURGY
C12N15/1089
CHEMISTRY; METALLURGY
C12P1/00
CHEMISTRY; METALLURGY
International classification
C12P1/00
CHEMISTRY; METALLURGY
Abstract
The present disclosure is based on the identification of a novel sequence motif present in halogenase type enzymes. From this, the disclosure provides methods for identifying and or detecting halogenases (halogenating enzymes) and novel halogenases identifiable using such methods. The disclosure also provides a novel cohort of enzymes and novel methods for achieving substrate halogenation.
Claims
1. A method of identifying or detecting amino acid sequences which potentially encode or provide halogenases, said method comprising probing or screening an amino acid sequence for the presence of a motif or consensus sequence/motif having the sequence: TABLE-US-00015 (SEQIDNO:1) FxPxSxG or (SEQIDNO:2) FxxPxxSxG; wherein an amino acid sequence comprising said motif or consensus sequence, is an amino acid sequence which potentially encodes or provides a halogenase.
2. A method of identifying or detecting nucleic acid sequences which potentially encode halogenases, said method comprising probing or screening an nucleic acid sequence for the presence of a nucleic acid sequence which encodes the motif or consensus sequence/motif having the sequence: TABLE-US-00016 (SEQIDNO:1) FxPxSxG or (SEQIDNO:2) FxxPxxSxG; wherein a nucleic acid sequence comprising a sequence which encodes said motif or consensus sequence, is a nucleic acid sequence which potentially encodes a halogenase.
3. The method of claim 1 or 2, wherein the halogenase exhibits a broad substrate specificity.
4. The method of any preceding claim, wherein the sequence amino acid or nucleic acid sequence screened or probed for the presence of the motif provided by SEQ ID NO: 1/2 or a sequence encoding the same, is a sequence selected from the group consisting of: (i) a deposited sequence; (ii) an uncurated deposited sequence; (iii) a hypothetical protein sequence; (iv) an unannotated sequence; (v) a prokaryotic sequence; (vi) a eukaryotic sequence; (vii) a sequence from a microorganism; (viii) a bacterial sequence; (ix) a viral sequence; (x) a fungal sequence; (xi) a plant sequence; (xii) a mammalian sequence.
5. The method of any preceding claim, wherein the method is an in silico method.
6. The method of any preceding claim, wherein the method further comprises screening or probing the amino acid sequence or nucleic acid sequence for a motif having the sequence TABLE-US-00017 (SEQIDNO:3) GxGxxG; and/or (SEQIDNO:4) WxWxIP; or for a nucleic acid sequence encoding the same.
7. The method of any preceding claim, wherein the method comprises a further step in which an amino acid sequence or a nucleic acid sequence identified as potentially encoding or providing a halogenase, is subjected to an assay to determine a level or presence of halogenase activity.
8. The method of any one of claims 2-7, wherein a nucleic acid sequence identified as potentially encoding or providing a halogenase, is subject to a codon optimisation procedure to ensure that it is optimised for expressing in or within the chosen expression system.
9. A halogenase obtainable by any one of the methods of claims 1-8.
10. A halogenase encoded or provided by any one of the sequences of SEQ ID NOS: 5-149 or a functional fragment, variant or derivative thereof.
11. A halogenase comprising a sequence of any one of SEQ ID NOS: 5-149 or a functional fragment, variant or derivative thereof.
12. A halogenase comprising the sequence of SEQ ID NO: 7 or a functional fragment, variant or derivative thereof.
13. A nucleic acid sequence encoding SEQ ID NO: 7.
14. A method of halogenating a substrate, said method comprising contacting a substrate to be halogenated with one or more halogenases comprising any of the sequences provided by SEQ ID NOS: 5-149 or a functional fragment, variant or derivative thereof.
Description
DETAILED DESCRIPTION
[0064] The present invention will now be described in detail with reference to the following Figures which show:
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
GLOBAL APPROACH TO DETERMINING DISTINCTLY DIFFERENT FLAVIN DEPENDENT HALOGENASES (FDHs)
[0086] The methodology consists of three bioinformatic components. Firstly compilation, alignment and analysis of the complete set of biochemically and structurally characterised FDH sequence data. By carrying out careful analysis on amino acid sequences and structural information of experimentally verified FDHs, series of conserved signature motifs can be revealed.
[0087] Second, utilisation of these series of sequence motifs to mine un-curated genomic data. The presence of these motifs, in the expected order provides confidence that the identified hypothetical protein is a FDH. This approach can be utilised to pool series of likely FDHs.
[0088] Third by looking at the phylogeny, and focusing on less explored species, distinctly different substrate specificity may be accessed.
[0089] Once a candidate is identified utilising this simple approach, it can be synthesised (optionally in gene optimised form), expressed, and its activity assayed. For example, Escherichia coli BL21 can be used as an expression platform. A medium throughput LC-MS assay of a 600 member library of small molecules was also developed.
[0090] The aim is to develop a method of bioinformatic analysis that is simple and easy and that can be readily adopted by others. Accordingly, the methods described herein have been developed utilising bioinformatics software available online. In this way, users can navigate genomes and pool potentially novel FDHs. A particular advantage of the methods described herein is that non-specialised laboratories can retrieve interesting candidates, within minutes.
Assembling a Definitive Series of Sequence Motifs Found in FDHs that can be Used to Mine, in Silico, for Previously Undiscovered Halogenases.
Structure and Mechanism
[0091] FDHs are an intriguing family of enzymes; they are composed of two main domains, the monooxygenase domain and the halogenase domain, connected by a 8-10 tunnel. Each of these domains, has its own role for FDH chemistry. FDHs are highly analogous with the two-component flavoprotein monooxygenases with which they share an evolutionary origin. Both families are dependent on a partner flavin reductase enzyme, which reduces FAD to FADH.sub.2. Whilst flavin reductases can utilise both FAD and FMN, all FDHs investigated so far require FADH.sub.2 and not FMNH.sub.2 as their cofactor. PrnA, a tryptophan-7-halogenase, mediating the first step in pyrrolnitrin biosynthesis, was the first FDH to be investigated and structurally characterised; as such is considered the prototypical FDH. Following the first crystal structure of PrnA, 9 more structures of FDHs have been solved so far, all containing the Rossman fold, a motif known to be important for the binding of FAD. Once the cofactor has been reduced by the partner flavin reductase, FADH.sub.2 binds to the flavin-binding site of the halogenase, where it reacts with molecular oxygen to form a flavin C4a-hydroperoxide. This subsequently oxidises the halide, bound nearby, (through interactions with the amide NH groups of Gly349, Thr348 and the hydrophobic ring of Pro344 in PrnA), to generate hypoalous acid. This reactive halogen intermediate is not released, instead it is guided through a channel (10 in PrnA), leading to the active site, where a conserved lysine residue reacts with the hypoalous acid to form a chloramine (
Data Assembly, Alignment and Motif Identification
[0092] As a starting point, the amino acid sequences of the FDHs with strong experimental data supporting their substrate preference were collected within a local database. This included a comprehensive collection of sequences, as the experimental confidence of the annotation and characterisation of the original data can significantly influence downstream analysis; in other words, the more information we have of the original data being analysed, the more informative the output of the downstream analysis will be. The combination of comprehensive data and appropriate algorithms, can reveal important evolutionary changes such as substitutions, insertions and deletions that have occurred between variants, but can also reveal areas that have been protected by mutations and are conserved even between distant variants.
[0093] Due to the difficulties of the in vitro study of FDHs, there are several halogenases where gene knock-outs have confirmed their involvement in the biosynthesis of their associated halometabolites, but their exact substrate preference has not been established in vitro. One of the issues leading to lack of in vitro investigation, could be that many FDHs have been identified in actinomycetes, which are known GC rich organisms. The high GC content renders their genetic information difficult to be overexpressed in different organisms; something necessary for the overproduction of the enzymes from secondary metabolism. Additionally, there are examples of FDHs with solved crystal structures, but unfortunately no in vitro activity has been demonstrated; although there are hints about their associated halometabolites. FDHs have very high substrate specificity and, thus, either their natural substrate or a highly structurally related compound is required for activity. Furthermore, the exact stage of a biosynthetic halogenation step is not always clear and thus it is very often difficult to identify the biosynthetic precursor which is the natural substrate of the FDH. Sometimes a halogenase might act in early stages and the biosynthesis will not continue if the precursor is not halogenated. Other times, it might not affect the biosynthesis if first stage halogenation is omitted. Therefore, FDH gene deletions in the producing strain does not always provide evidence for the natural substrate.
[0094] Multiple sequence alignment 1 (MSA.sub.1), was performed in order to identify conserved residues across variants of FDHs which revealed three main sequence motifs. Of these motifs, two of them had been previously been identified; these are the GxGxxG and WxWxIP motifs. More excitingly, MSA.sub.1 also revealed a third motif which has not been previously identified. This is the FxxPxxSxG motif. This could be either because the alignments so far have all included a disproportionate number of the well-studied tryptophan halogenases; the areas near the C-terminus (where the motif is located) were similar enough to miss the motif. It is also possible that although its presence was clear, it may have just been ignored, as the previously described GxGxxG and WxWxIP were initially considered as the signature motifs of FDHs. Unlike the other motifs, the inventors have found this new motif present in all characterised FDHs. Notably this motif is absent from flavin-dependent enzymes that mediate other reactions such as oxygenations; this is very exciting as the FxxPxxSxG motif can be definitively used for FDH assignment.
[0095] The GxGxxG motif is located within the first 20-30 amino acids of the N-terminus. This is part of the Rossmann fold and is present in all validated FDHs. This consensus is also known as the dinucleotide-binding motif (DBM) and is common within FAD and NAD (P) H-dependent enzymes. The importance of the glycine residues is well understood with the first glycine allowing for a tight turn of the main chain, thereby positioning the second glycine such that close contact may be made between the main chain to the pyrophosphate of FAD. The third glycine, allows close packing of the helix with the -sheet (
[0096] The conserved tryptophans in the WxWx(IP) motif have been previously described as the signature motif of FDHs (Dong C et al., Acta cryst, 2004) (Dong C et al., Science, 2005). The two tryptophans, although not directly interacting with flavin, are located at the flavin binding module, and have been proposed by Dong et al to have evolved as a steric block, keeping the substrate distant from the flavin and thereby preventing the enzyme from catalysing a monooxygenase reaction (Dong C et al., Science, 2005). However, when W272/Phe and W274/Phe exchanges in PrnA were made individually or together no change in halogenating activity was observed, and even the more extreme W272/Ala mutation made little impact on the enzyme's activity; W274/Ala exchange resulted in enzyme redundancy (Flecks S et al., Angew Chem Int Ed Engl, 2008) . . . . Tryptophan is instrumental in protein folding and structure, and this result therefore made the inventors to challenge whether the loss of halogenase activity occurred due to potential conformational change, aggregation, misfolding or collapse, and therefore whether the WxWx(IP) motif can really be relied upon to predict halogenase activity.
[0097] The simplest way of examining the original hypothesis of Dong et al., (that the two tryptophans of the WxWxIP motif were evolved in FDHs to block monooxygenase activity) was to include in the alignments the ancestors of FDHs; this outgroup needed to be large enough to compete with the FDH numbers of sequences. The inventors gathered experimentally verified sequences of FAD monooxygenases together with all the sequences used in MSA.sub.1 and performed MSA.sub.2. Not surprisingly, the sequences could align overall. This means that areas that are a result of a deletion or an insertion in addition to various substitutions could be identified. It was shown that many members of the outgroup, including the mammalian monooxygenases have variations of this motif (
[0098] A third motif, FxxPxxSxG, which to our knowledge, has been overlooked in previous multiple alignments of halogenases caught our attention. We sought to investigate how this third and previously ignored sequence motif maps onto the available structures of FDHs. Intriguingly we saw that these residues are present in a loop that separates the active site from the isoalloxazine ring of the flavin cofactor binding pocket, in all solved crystal structures of FDHs (
[0099] In a given fold, structural variability is a result of substitutions, insertions, and deletions of residues between members of the family. Such changes frequently correspond to loop regions that connect elements of secondary structure in the protein fold, and therefore, loops often determine the functional specificity of a given protein framework. It may be that this loop plays an important role in substrate specificity and active site configuration, which is the reason why nature has kept it protected from spontaneous mutations, as conservation correlates with functionality.
[0100] Unlike the other motifs, the newly disclosed motif has been found to be present in all characterised FDHs (
[0101] Notably the new motif is absent from flavin-dependent enzymes that mediate other reactions such as oxygenations.
[0102] The identification of this motif enabled for the first time the definitive identification of FDHs in silico. Together with mechanistic and structural knowledge, the newly identified FxxPxxSxG motif permits the prediction of FDH function, even at low sequence similarity.
Mining, in Silico, for Previously Undiscovered Halogenases, Using a Phylogenetically Guided Approach.
[0103] We further used MSA2 for the construction of a phylogenetic tree (
[0104] Tryptophan FDHs appear to cluster together, separate to the pyrrole FDHs.
[0105] Free pyrrole FDHs form a distinct cluster in comparison to the ACP bound pyrrole FDHs. (The addition of the outgroup was very important for the construction of a meaningful network, that could be used to extract information about the substrate preference.) This phylogenetic tree provides an excellent starting point for the discovery of halogenases with very different substrate preference to those which have previously been investigated. Using this tree we chose to investigate a series of phylogenetically distinctive halogenases. The encoding genes were codon optimised, synthesised and their gene products analysed. All of the genes resulted in soluble protein and halogenase activity could be determined.
[0106] We outline below our approach to halogenase discovery and biocatalytic investigation, and describe two examples.
Example 1: Identification of Dsg205 from Trichoderma virens, a Plant Beneficial Fungus
[0107] Trichoderma virens is a haploid filamentous fungus, known for its beneficial role in plant growth. Its 30 Mb genome is predicted to contain about 50 secondary metabolite gene clusters, half of which can also be found in other Ascomycota species such as Trichoderma atroviride and Trichoderma reesei.
[0108] Previous genomic analysis has revealed non syntenic genomic islands containing several monooxygenases and oxidoreductases and many other potential gene products, the annotation of which has so far been unsuccessful due to the low sequence similarity to known proteins.
[0109] Although it has become apparent that this organism might contain an as yet undiscovered reservoir of secondary metabolites, its ability to produce halogenated metabolites is known, making its genome an excellent model for FDH hunting, balancing both challenge and potential for our novel genomics led approach to successfully identify halogenases.
[0110] The halogenase amino acid sequences (fasta format) which were used to construct Multiple Sequence Alignment 1 (MSA1), was added as a query sequence in blastp suit. The database used as a search set was the non-redundant protein sequences (nr). The search parameters were changed to only search against Trichoderma virens Gv29-8 (taxid: 413071). PHI-blast was selected as the algorithm and the FxxPxxSxG motif was included as the selected pattern. This yielded three hits all of which had been annotated as hypothetical proteins. These were hypothetical protein TRIVIDRAFT_60172 (this is Dsg205), hypothetical protein
TABLE-US-00012 TRIVIDRAFT_192594aminoacidsequence: (SEQIDNO:150) MANIPEQCTVLVIGGGPAGSYAASALAREGIEVVLLEAEKFPRYHIGES MLPSMRHFLKFIDAYEKWDAHGFNIKKGGAFRLNWSRPETYTDFIAAGG PGGYAWNVVRSEADELLFKHAAECGVQTFDETKVASIEFAPATSDVQSL GRPVSATWTRKDGSSGTVSFDYVVDASGRAGLISTKYLKNRSYNQGLKN VASWGYWKNGGVHGVGTHKEGAPYFEALKDGSGWVWFIPLHNGHHSVGV VQNQEMAAKKKREMTEPSSKGFYIESLDLVPGIKELLANAELVSEIKSA SDWSYSASKYAFPGVRIAGDAGSFIDPFFSSGVHLALSGGLSAATTIAA AIRGDCGEKAASSWHDKKTAESYTRFLLVVSSALKQIRSQDEPVINDFD EATFERAFDLFRPIIQGQADADAKGKLTQAEISKTVEFCFKAFAHVSFE EKEALVKKLKELGLDGDAYDESNRKALDELEKKLTPEEQSILKTLKGRR MVRPEDSLNIDNFTLDSIDGLAPRLERGKLGLATAKKAEVKFTRHDPLS FLNGESKAVKKALQNGHAELNERSEVHSTNVTNGDKPLNGHTKVEDQSV ASLVAELVASERSLPQASLDESSRHRLISSLQESAEELETPYDSMLRFL NASRQIALIKIGGDLGIFKCLAESKTPLSSKELAKPNMADPTLVGRIMR YLVANRLAAETAPDQYVARKMTYALADPQIEGPMRFFHAVSSPSFQALP DFLKETGYQNQPQTSALQKGLNTDLGLFAWLKQHPDLLKDFQNLMGIPK EGNCLDVISFESAVIGGHEGPVFVDIGGNTGHQAKQLLAKYPELANRVV VQDREETIKSASDVKGFQLMAHDFFSPQPVQGAKYYYLRAILHNWDDDK ASQILSNIVPSMSTDSLMLIDELVIADQGSHVWPAGLDLQMYTLFGSSE RTASQWDSILDRAGLRPVAVKKYAPVMGSSVIFAAPKFRCYTTL. and hypotheticalproteinTRIVIDRAFT_53554amino acidsequence: (SEQIDNO:151) MAATAPVPKHTFAERAAANNLSDSQILNSNNVAGSSLPKESDVVIAGGG IHGLIYAIHSAKHKPGNLKILLVEKNRKPGYKIGESTLPVFSMWCKMYG LTAEYLLRIFGLKDGLCFYFLDRENQGKFKDFVINGTAGTLLSGFQIER PTSELLFTLLAQRSGVNVYHGTEVNFDGTTVDGGLNKCNIGIAKGKSND TPETSIQSSILVDATGRFRRVASKNAPIHRFEGWNYDAFWGYFTNPKDT SKMPFPHYESCNTNHICFPEGWIWVIRLLSWEGSPTANLMDMMTYLLDC AESGVPADQIPSTDELAKMFGLNYRWITSLGFAVRNDVEYPEDMSAYGT REAERRFNYFVEKYPLIKEFMSNFELIEDHYGPGTTWYIRKSLTYQSPV VSGPGWISIGDACGFTNPLWSPGINVGLSTSTYAAELTHKAFDAAKNAN PEAAELSIRETMAPYDAYAKRLIPALNQMNCFNYVCFRDPRLGAQISAA WQNIASALQGWGRIQGNYTLTPETFVDYATNWCYGAINPAYDIVARKAI ELLAPIPLKDAVPDHIVQEVIEFADSIKKSTLESGCINLRWGGLFRRFD NRLNYLEEKETKDTFARPCSNCSSWFVLRPDWKKCYSCGTERTDEESTI LWNPVLV.
[0111] As a comparison, the searches were repeated with the GxGxxG motif, which yielded 20-30 hits, as well as with the WxWxIP motif which yielded only 2 hits. Using the WxWxIP motif failed to reveal the hypothetical protein TRIVIDRAFT_53554 as the proline residue of WxWxIP had been substituted with arginine in this variant. However, using the GxGxxG motif retrieved twenty hits comprising all flavin-dependent enzymes present in the genome, including the three halogenases that we identified with the FxxPxxSxG motif. These results together demonstrate that FxxPxxSxG is the motif to be used for fast and definitive FDH identification. The three FDH candidates identified using this method showed no significant similarity to tryptophan halogenases. More specifically when the tryptophan 7 halogenase (PrnA) was aligned against TRIVIDRAFT_60172 the two sequences could only align 50% of their sequences, with a sequence identity of 21% (sequence similarity 35%) with the major differences located near the C-terminus of the sequences. When this terminal sequence was aligned against the UniProtKB/Swiss-Prot database, it only showed moderate similarity in the C-terminus area with the Rdc2 fungal halogenase (47% sequence identity, 55% sequence similarity) and even lower similarity to pyrrole halogenase PrnC (22% sequence identity) which aligned against 66% of the sequence. All three identified FDH sequences of Trichoderma virens showed a comparable low similarity to known FDHs.
[0112] Out of these 3 halogenases identified in the Trichoderma genome, we chose TRIVIDRAFT_60172 (later renamed as Dsg205) to test in vitro.
[0113] The possibility of Dsg205 acting on carrier bound substrates was next assessed. We have been able to predict such specificity by employing a phylogenetic-like branching analysis. As the question asked was how similar Dsg205 was to known FDHs and in parallel how different it was from variant B halogenases which require the substrate to be carrier bound, we employed split decomposition to generate a splitting network, a variation of branching analysis (
[0114] Structural models of Dsg205 were next generated using the Phyre2 protein fold recognition server (
[0115] A previous proposal has correlated variant A (acting on free substrates) and B (requiring carrier bound substrates) halogenases with the degree of structural order on the C-terminus (ordered in variant A, disordered in variant B). However, this correlation is not definitive as a recently a biochemically characterised variant B member, PltA, was structurally elucidated showed a mostly ordered C-terminal region (
Example 2: Dsg701 from Pleurotus ostreatus, a Common Edible Mushroom
[0116] The same methodology for identification of novel FDHs was used against the genome of Pleurotus Ostreatus PC15 (taxid: 1137138), otherwise known as the oyster mushroom. Pleurotus ostreatus is an active lignin degrader in forests and is also the third in the worldwide market of industrially produced mushrooms. Until now, there has been only one halogenase characterised from an edible mushroom and that is ArmH1 (and its homologues from the same producing organism). The FxxPxxSxG motif retrieved 4 potential FDHs in the P. ostreatus genome. These were hypothetical protein PLEOSDRAFT_1093300 (later renamed Dsg701),
TABLE-US-00013 hypotheticalproteinPLEOSDRAFT_1079235(amino acidsequence(SEQIDNO:152): MASIAVPSASTILVIGGGPGGSYSAAVLAREGLDVVLLEADKFPRYHVG ESQLASLRHFLRFIDLEKEFEEFGFQRKDGAGFKLNRHKREGYTDFVSQ DPNNFSWNTVRSQADELMLRHASKCGAKVFEETKVTELEFEGSEQSGRP VAALWKQKSGATGRITFSYLVDASGRNGIMSTRYLKNRQFNSLLKNVAC WGYWEGTGKYLPGTSRENSPLFEALADESGWAWFIPLHDGTTSVGIVMN QDISNEKKAKAKESGEDTSLVAHYLSELKRAPNVLALIGDGVHIKKSDA PLISAASDYSYSATSYAGPHYRIVGDAGAFIDPYFSSGVHLAISGGLSA AATICAEMKGGCTSTEAIAWHSAKVDTSYTRFMLVVLSAYHQIKSQEAP VLSNKDEDNFDRAFDFFRPSKYRTDWTFIQGNTDVGRKLQGDDLRRTVE FCAKHAYEPSLPEERKELVEKFGDPLRVLSAESAEDSEQVATEKRILKG VAIRKLMRTEDIVHIDNFVADNLLGYKLRLIRGSLGLEKVL, hypotheticalproteinPLEOSDRAFT_1108187(amino acidsequence(SEQIDNO:153): MSLPRIPQRTTVLVIGGGPAGSYASTLLAREGLDVVLLEALKHPREHVG ESMLPSMRQYLRFIDLENEYDIRGFLHKPGAFFKFIHGAPACYADFDIL GRDKNTWHVFRAEADELMLRHAAQQGVKVFEEVRVDSTEFAGSDPTTSR PIAANWKSKLGETGALSFDWLIDASGRQGLMATKYLKNRIYREGLRNVA AYGYWEHAAAPVEEGNPRQNATWIECLTDKRGWAWHIPLHNGKTSIGVV MHQETSNQKKAVGPKGLEAHYLDQVKLAPGVLERLGHGASYITGSVRST ADFSYHAKSYSGDHYRIIGDAAAFVDPLFSSGVHIGMTGALSAACTILG SMKEQITEVGACAWHDAKIGISQIRFLLVVLSAYRQMQHQGNYTVLGDF NPQDFGRAFELFRPVYQGQHDVENKLTNEELERMIDFTRNFFLPISQDQ HAAVSERLGHFMPINGPVMGPDDLAKVLDDDDSDAKAVLQKINARKVLS TEMGSSGLNSESVNGYTLILEKGRLGMKKEIGVA and hypotheticalproteinPLEOSDRAFT_1103280(amino acidsequence(SEQIDNO:154): MSLPRIPQRTTVLVIGGGPAGSYASTLLAREGLDVVLLEALKHPREHVG ESMLPSMRQYLRFIDLENEYDIRGFIHKPGAFFKFIHGAPECYSDFDLL GQDKRTWHVFRAEADELMLRHAAQQGVRVFEEVRVDSIEFAGSDSMSSR PITANWKSKLGETGAISFDWLIDASGRQGLMATKYLKNRIYREGLRNVA AYGYWENAPVEEDGSHQNATWIECLTDKRGWAWFIPLHNGKTSVGIVMH QETSNQKKADGPKGLEAHYLDQVKLAPGVLKRLGNDATYITGSVRSTAD FSYHAKSYSGDHYRIIGDAAAFVDPLFSSGVHIGMTGALSAACTILGSM KEQVTEVEACAWHDAKIGVSQTRFLLVVLSAYRQMQHQGNYTALGDFNP QDFGRAFELFRPVYQGQHDVENQLTNEELERMIDFTRNFFLPVSQDQYA DVGERFGQFTEINGPVMGPDDLAKVLDDDDSDAKAVLQRINALKVLSNE MGSSGLNSEAVNGYTLVVEKGRLGMKKVINA
[0117] The closest orthologue to PLEOSDRAFT_1093300 is a hypothetical protein from Agaricus mushroom, which are both edible and poisonous species. When compared its sequence against Dsg205 from Trichoderma virens it was shown that the two sequences have 45% sequence identity and 60% sequence similarity.
[0118] When I analysed the gene clusters of Pleurotus ostreatus PC15 I identified 22 clusters which did not share sequence similarity to any known BGCs. The only FDH which was in a BGC was hypothetical protein PLEOSDRAFT_1079235. The other three are probably scattered around the genome of P. ostreatus.
[0119] The first FDH example identified from uncharacterised genomic deposits was dsg205 and we were able to carefully annotate the candidate and the neighbouring genes, to obtain as much information possible for the activity of Dsg205. However, one of our aims is to be able to show activity in sequences that there is no information about their function, other than our annotation. We therefore selected the hypothetical protein PLEOSDRAFT_1093300 as our next candidate for production and assessment of halogenase activity, as the only information available about PLEOSDRAFT_1093300 is that it contains an open reading frame and might be a protein and therefore the level of challenge is what we need to show activity. We named this candidate Dsg701.
[0120] Branching analysis (see
Protein Production and Purification
[0121] We designed a codon optimised gene for the heterologous expression of Dsg205 and Dsg701 in Escherischia coli BL21. We cloned these genes individually into the pUC19 vector enabling the introduction of a TEV cleavable N terminal octahistidine tag to ease purification of each protein. The resulting constructs were named pDSG205 and pDSG701. Conditions that would enable good levels of protein production were screened More specifically small scale cultures were used to determine conditions for each construct that resulted in the production of good levels of soluble protein. A single colony, from a fresh transformation in BL21 (DE3) chemically competent cells was used to inoculate 10 ml LB medium containing appropriate antibiotics. In most cases the expression vector used was pSG181, which carries a kanamycin antibiotic cassette. The culture was incubated over night with shaking at 37 C. The starter culture was diluted 100-fold into fresh LB medium containing kanamycin and incubated as before until the cell density reached an OD.sub.600 of 0.4-0.6. The culture was separated into 10 ml cultures, into sterile plastic 50 ml falcon tubes. These tubes were induced at varied concentrations of IPTG, 0 mM, 1 mM, 0.5 mM and 0.1 mM and incubated at either 28 C. for 18 h, 16 C. for 16 hours or 37 C. for 4 hours (
[0122] Once the conditions that enabled good protein production for each member were identified, we scaled up accordingly, lysed the cells and performed NiNTA purification with increasing amounts of imidazole, to finally obtain relatively pure protein. The NiNTA purification was optimised accordingly for each individual construct, and details are in further chapters. The eluted fractions were subjected to SDS-gel electrophoresis to assess efficiency of IMAC purification and binding to NiNTA.
[0123] The best conditions for production were selected (in both cases optimal conditions were found to be 16 C. for 18 h, with 0.5 mM IPTG), resulted in good amounts of soluble protein (10 mg/L and 5.8 mg/L as a 120 KDa dimer of Dsg205 and Dsg701 60 kDa as a monomer respectively) (
Assaying Halogenase Activity
[0124] A small selection of electron rich substrates were used as an initial assay of halogenase activity by Dsg205 and Dsg701, supplemented with the flavin reductase PrnF.
[0125] We tested both proteins in purified form (using no enzyme, boiled enzyme and acidified reactions as negative controls). PrnF was provided enabling the reduction of FAD to FADH.sub.2. Both proteins showed halogenase activity.
[0126] Having confirmed activity we explored the activity of the new halogenases against substrates within a 600 member compound library. Activity was determined using an LC-MSMS assay.
[0127] We observed a previously unprecedented level of enzyme promiscuity with a diverse series of compounds being accepted as substrates at good levels of conversion. Our study revealed that Dsg205 and Dsg701 could halogenate 33 (
CONCLUSION
[0128] Two novel halogenases of eukaryotic origins have been identified from uncharacterised genomic deposits. These are Dsg205 from the small filamentous fungus Trichoderma virens and Dsg701 from the edible mushroom Pleurotus ostreatus. Both sequences had been deposited in public databases as hypothetical proteins. Both novel FDHs were predicted (using the in silico methodology developed during this project) to act on free substrates and that they could show a broad substrate tolerance based on the flexibility of the C-terminus in the structural models that we generated.
[0129] Both FDH genes were successful cloned and expressed in E. coli which resulted in good yields of soluble protein. We tested the purified proteins against 600 small molecules and we showed for the first time a remarkable substrate tolerance of these wild type enzymes. Dsg205 accepted 33 structurally different substrates, while Dsg701 has accepted 27. 15 of these substrates were both accepted by Dsg205 and Dsg701. We saw conversion with a wide range of substrates, with some of the conversions estimated as high as 75%, as in the case of 8-quinolamine. We have also demonstrated that these phylogenetically distant FDH variants, although they exhibit a natural flexibility, they seem to retain the regioselective halogenation character that makes these enzymes attractive for biocatalysis. Although our yields for the majority of the substrates are modest this represents an exceptionally good starting point for a halogenase enzyme.
[0130] To our knowledge this is the first demonstration of phylogenetically different FDHs with such a broad substrate range from the wild type enzymes. Previous studies have tried to engineer tryptophan halogenases PyrH and PrnA to accept non-indolic substrates such as kynurenine, anthranilamide and anthranilic acid with yields ranging from 19% to 76% conversion. We have shown moderate to high yields with the wild type enzymes against a broad range of structurally different substrates, with retention of regioselectivity and moderate yields. This represent a great starting point for protein engineering or directed evolution, to increase the conversions and enzyme stability. Furthermore, this directly shows that being the identification of the definitive loop FxxPxxSxG can help identify FDH variants that do not show significant similarity to know FDHs, even if the only information of those variants is that it might exist as an open reading frame.
Example 3: Dsg407 from the Cyanophage Syn10
[0131] At the beginning of this project, the only characterised (by others) flavin-dependent halogenases (FDHs) from eukaryotic organisms were Rdc2 from the fungus Pochonia chlamydosporia and ChIA from the slime mold Dictyostelium discoideum. All other studied FDHs have been identified from bacterial species and more specifically, from the phylum of actinobacteria. The discovery of Rdc2 was especially exciting as it revealed that eukaryotic genomes could potentially harbour variants of FDHs with enhanced substrate flexibility compared to bacterial FDHs, while retaining the regioselective manner of halogenation which makes them especially attractive.
[0132] We searched for FDH variants from uncharacterised deposits of organisms in other kingdoms of life, away from fungi and bacteria. During those searches, we came across variants from archaebacteria including halophiles, thermophiles and psychrophiles as well as from plants and even arthropods. The most surprising of all findings however, was of a group of hypothetical proteins of viral origins.
[0133] Viruses are notorious for their small genomes, selecting only for genes that are important for their persistence. Although small, viral genomes are capable of acquiring new genes through horizontal gene transfer and through transposable elements. Horizontal transfer very frequently occurs from the host to the virus but the opposite occurs very rarely. Although the viral genomes are flexible, they exhibit unique selection pressures against deleterious and unnecessary additions to their genomes, enabling their genomes to be as efficient and minimalistic as possible for survival. The possibility that viruses have evolved or obtained and retained modifying biosynthetic genes like halogenases, is extremely surprising and remarkable. Here, we discuss our findings with a halogenase from the cyanophage Syn10.
Sequence Analysis of Dsg407 from Syn10
[0134] The identified FDH variant from the cyanophage Syn10 was hypothetical protein CPUG_00131. We renamed this variant Dsg407. This phage was isolated in 1986 from the Gulf Stream (not by the authors of this invention), as a double stranded viral DNA. Interestingly enough, Dsg407 only shows low >48% sequence similarity to hypothetical proteins from various cyanophages like cyanophage P-TIM40, P-RIM44 and phages from metagenomic samples. Additionally, when aligned against known halogenases it shows a very low 30% similarity to PrnA which brings it to the twilight zone of sequence similarity (25%-35%). The monodechloroaminopyrrolnitrin halogenase PrnC aligned only locally around the FxxPxxSxG motif (19% query coverage) with 31% sequence identity for the aligned area. This clear variation from the known halogenases could be also seen when be performed a simple blastp alignment. This low similarity to other FDHs other than cyanophages putative sequences reflects a clear sequence variation in viral FDHs which perhaps could also signify structural and mechanistic variation of viral halogenases compared to fungal and bacterial halogenases.
[0135] We next sought to find if Dsg407 could have been hijacked from cyanobacteria or other marine microorganisms. We analysed all the available genomes of the synechococcales in order to extract potential halogenases. This search yielded 4 potential FDH sequences from cyanobacteria including Phormidesmis priestleyi, Acaryochloris marina, Aphanocapsa montana and Prochloron didemni, but none in Synechococcus, which is the host of Syn10. When we aligned the top hit of this search against Dsg407, we did not observe any significant similarity, with the local alignment covering only 41% between the two sequences and with a sequence identity of 29% for the aligned area. Same level of similarity was demonstrated for all other hits, showing that Dsg407 is very unlikely to have been hijacked by Syn10 from these organisms, unless extreme recombination, insertions and deletions were induced by viral purifying selection.
[0136] We next submitted both the cyanophage Syn10 genome as well as the genomes of the cyanobacteria Acaryochloris marina MBIC110117 and Prochloron didemni on antiSMASH, to identify potential gene clusters that these halogenases could fall in. As expected, cyanophage syn 10 genome does not seem to organise its genes in gene clusters and therefore not a single gene cluster was identified in its 177103 bp genome. The cyanobacterial species were found to contain several gene clusters encoding for bacteriocin, ladderanes, lassopeptides and terpenes, but none of these gene clusters was found to harbour any of the identified halogenase genes.
[0137] When we performed split decomposition/branching analysis of Dsg407 with Multiple Sequence Alignment (MSA.sub.2) we could see that Dsg407 had common ancestry with tryptophan halogenases as they are located in the same extended spitted cluster (
[0138] We also generated a homology structural model of Dsg407 using Phyre2 (
Cloning and Purification of Dsg407
[0139] As with the other halogenases tested in this project, the ideal protein production conditions were determined to be when inducing at OD.sub.600 of 0.4-0.6 with 0.5 mM IPTG and incubation for 16 hours at 16 C. These conditions seem to be common with all FDHs that we have identified, unrelated from which organism they originate. We used these conditions to scale up to 8 L of culture, which was lysed by sonication and subjected to immobilised metal affinity chromatography (IMAC) manually using biorad columns prepared with equilibrated Nickel resin (Thermos). After elution of our protein, and buffer exchange using PD10 desalting columns to remove the imidazole, we obtained a highly pure Dsg407 N-terminus 8His tagged with excellent yields of 13 mg ml.sup.1 (
[0140] We also sought to determine the oligomeric state of Dsg407. In order to be certain about the results, we decided to cleave the affinity tag from the N-terminus of the protein. After IMAC purification and buffer exchange to remove imidazole, we incubated the enzyme with a 1:10 ratio of Dsg407: Tobacco Etch nuclear-inclusion- endopeptidase (TEV protease) in dialysis bag and incubated overnight at 4 C. It is important to highlight that buffer exchange to remove the imidazole from the sample is quite important for the TEV cleavage step, as we have noticed presence of imidazole in the sample leads to Dsg407 precipitation when the sample is left dialysing overnight. Once cleavage of the His-Tag was confirmed by SDS Gel against an undigested sample of Dsg407-His.sup.8, we subjected the sample to a second IMAC purification step but this time, we collected the flowthrough which contained our cleaved Dsg407. The sample was then subjected to size exclusion chromatography with a column which had been previously calibrated with protein standards, using the same equilibration, and running method for Dsg407 and standard. The results clearly demonstrated that Dsg407 exists as a trimer, something that was also confirmed by crystallographic data obtained from the solved structure of the apoenzyme. Furthermore, size exclusion chromatography revealed a monodispersed homogeneous sample, demonstrating an excellent purification and protein sample quality (
Dsg407 Against Library of 300 Compounds
[0141] Having demonstrated that it was possible to express dsg407 and obtain good quantities of pure and soluble protein, we wished to determine whether that enzyme had any activity as a halogenase. We used a master library as a test bed for probing halogenase activity. An LCMS-based approach was used for analysis of the assay; the assay conditions were modified for those used for Dsg205 and Dsg701. NaBr was used as the halogen source and Dsg407 was tested against a small subset of the master library. We observed bromination of some of those compounds.
[0142] An FDH iodinase has yet to be identified. The only known FDHs that has been discussed to be able to utilise iodine in vivo was the variant B brominase Bmp2 and the decarboxylating phenol brominase Bmp5. However, this activity has not been demonstrated in vitro. Specifically, in a publication that followed their initial discovery where the mechanism of these enzymes was tested in vitro, there has been no mention of iodinase activity for either enzymes.sup.43. Another discussed enzyme which could perhaps act as an iodinase is CalO3 from calicheamicin biosynthesis. However, there are no in vitro or in vivo experiments to our knowledge demonstrating such activity of CalO3.
[0143] Encouraged by our results with Dsg407 and NaBr, we also tested for NaI, as the incorporation of CI bond would be a modification highly desirable and unprecedented from the toolkit of selective halogenating biocatalysts. Surprisingly, Dsg407 enzyme not only incorporated iodine to produce the corresponding iodinated products, but it showed a preference for iodine.
[0144] We immediately sought to test the full master library against Dsg407 with NaBr and NaI. For the assays we used 10 UM Dsg407, 1 M PrnF, 1 l of substrate (10 mg/ml), 10 M FAD, 5 mM NADH and 10 mM NaBr or NaI in Hepes Buffer at pH=7.2. With Dsg205 and Dsg701, only 3 out of 300 compounds of the initial 300 compound library were halogenated. With Dsg407 10% of the library (30 compounds) were accepted as substrates of Dsg407. As with the other two halogenases, we repeated the assays with the positive hits at least in triplicate, including controls with boiled and acidified enzyme as well as absence of enzyme, as we wanted to be sure that halogenation is mediated by Dsg407, which was the case. We did not observe any halogenated products in the controls. Furthermore, we observed halogenation of the same products with both NaBr and NaI, however we got higher conversions with NaI, hinting that the enzyme prefers iodine.
[0145] Approximate conversions were calculated based on PDA peak areas of both substrate and halogenated product and do not take into account any change in extinction coefficient that may occur in halogenation. For the substrates accepted by Dsg407, we only observed a single new peak appearing after the starting material, indicating regioselective halogenation, although it is possible that minor regioisomers were not observable due to low conversions of several of the substrates. We only observed the presence of two new peaks in the case of 5-azaindole but after analysis of the starting material we determined that the starting material was contaminated with small traces of 6-azaindole, which is also a substrate of Dsg407 Furthermore, Dsg407 accepts D-tryptophan but not L-tryptophan, showing a degree of enantioselectivity which has not been seen previously with tryptophan halogenases. Most tryptophan halogenases act on L-tryptophan but can also accept D-tryptophan. Dsg407 also accepted complicated and exotic moieties like spiroindoles which were passed to us by our collaborator Professor Richard Taylor. These results together indicate a very strong substrate flexibility in combination with the unprecedented ability to incorporate CI bonds in vitro. Additionally, we have shown that Dsg407 can accept a variety of heterocycles including N-, S-, and O-heterocycles. Finally, although our initial results show moderate conversion for most of the accepted substrates, it should be highlighted that Dsg407 is a wild type enzyme and the substrates that have been accepted are most possibly not the natural substrates. Therefore, these initial results are rather remarkable, considering that PrnA and other halogenases were engineered by directed evolution and rational design to expand their substrate scope and demonstrate yields from 15-65%.
Substrates Accepted by Dsg407
[0146] Having demonstrated Dsg407 halogenase activity in such a broad range of substrates, we sought to test if we could also show this activity with the crude lysate. Unsurprisingly, halogenation of these compounds can also proceed with the crude lysate, this result has been demonstrated with all FDHs investigated so far. Furthermore, by addition of 10-fold excess of the halogen salt of choice 100 mM NaI or 100 mM NaBr, the substrates can be selectively brominated or iodinated respectively. As a control we also prepared an empty vector lysate (pSG181 without dsg407 insert) from 100 ml of culture; this was used to determine whether the reaction could be promoted from any other components in the lysate. We saw that this was not the case.
Optimisation and pH Studies with Dsg407 Pure Enzyme
[0147] We sought to investigate if we could modify assay parameters for better conversions. As such, we tested various buffers including Hepes, Phosphate buffers, Tris-HCl at pH 7.2, however we did not observe any significant difference between these buffers. We next performed a pH screen, using some of the initial purified enzyme Dsg407 preps.
[0148] For the pH studies, the assay conditions were 10 M Dsg407, 10 M of FAD, 1 l of substrate (10 mg/ml in DMSO), 10 mM of either NaBr, NaCl or NaI, 5 mM NADH, 1 M of PrnF and 50 mM of the buffers mentioned above at the appropriate pH, in 96 well plates, at 100 l assays. We used 6-azaindole as it gives good conversions with Dsg407. The reactions were all run in triplicate for all three halogen salts for 90 mins at 30 C. The workup was performed carefully using a precalibrated multichannel pipette, for comparable sample preparations. Both starting material and halogenated product were monitored at 335 nm using the PDA detector of the Waters UPLC system.
[0149] The results from the pH studies confirm that iodine is the preferred halide of Dsg407 as we can see that the conversions are significantly higher with this halogen. The highest conversions are achieved at pH=8 or in lower pH bellow 5.5 (
Steady State Kinetics of Dsg407 and 6-Azaindole
[0150] We next sought to determine the kinetic constants of Dsg407 with the substrate 6-azaindole, at the optimal pH for chlorine, bromine and iodine. For iodine, we determined the kinetic parameters for both pH=3 and pH=8, as both of them showed high conversions. Initial rates were calculated based on substrate consumption, at 0, 2, 4 and 6 minutes and the substrate concentration was varied for the best fit for the Michaelis-Menten curve. All assays were run in 150 l, in 96 well plates and the PrnF concentration was always in excess to ensure that production of the cofactor FADH.sub.2 was not a limiting step. Assays were always performed at 30 C. and all assay components except the substrate and NADH were preincubated at 30 C.
[0151] NADH was added the reaction started by addition of substrate and terminated with addition of formic acid. All assays were run in triplicate and the assay conditions were the same used for the pH studies, but instead we were using 15 M PrnF.
TABLE-US-00014 Enzyme K.sub.cat (min.sup.1) K.sub.M (M) K.sub.cat/K.sub.M Dsg407 (NaI, pH = 3) 4.8 0.6 35.3 2.1 0.14 0.07 Dsg407 (NaI, pH = 8) .sup.5 0.5 27.8 1.6 0.17 0.04 Dsg407 (NaBr, pH = 7) 2.4 0.6 53.6 3.2 0.04 0.08 Dsg407 (NaCl, pH = 3) 4.4 0.5 35.8 4.3 0.12 0.07 PyrH 2.5 0.4 15.2 4.2 0.16 0.05 PrnA 1.1 0.1 20.7 0.1 0.05 0.005 RebH 0.6 0.1 18.7 1.3 0.02 0.004 SttH 1.7 0.1 25.3 3.2 0.07 0.01 Th-Hal (30 C.) 4.3 0.5 12.2 1.8 0.35 0.07
[0152] The results were compared with related FDHs including the tryptophan 5-halogenase PyrH, tryptophan 6-halogenase SttH and tryptophan 7-halogenases PrnA and RebH. By selecting halogenases with different regioselectivities, a better comparison of kinetic parameters for FDHs in this class can be obtained and shown.
[0153] The K.sub.cat values of Dsg407 with iodine and chlorine were found surprisingly found to be higher than any of the other tryptophan halogenases, which is rather surprising as we have not yet managed to obtain full conversion with 6-azaindole, whereas the tryptophan halogenases all reach full conversion. Dsg407 is found to be as fast if not more as the thermophilic halogenase Th-Hal when it acts as an iodinase and two times faster than PyrH. However, it is obvious that Dsg407 has almost two times higher K.sub.m compared to all the other FDHs compared showing that it has less high affinity for 6-azaindole compared to all other FDHs against their natural substrate tryptophan. Finally the ratio of K.sub.cat over K.sub.M showed that our enzyme acts better as an iodinase and especially at higher pH and significantly less good as a brominase, however the catalytic efficiency of Dsg407 compared to the Th-Hal is 2 times less, although it is significantly higher than most of the other FDHs compared in this study.
[0154] These results suggest that our assay needs further optimisation, as there could be several factor inhibiting our reaction and preventing our enzyme reaching optimal conversion. Furthermore, although we can confidently compare the kinetic parameters of Dsg407 against varied pH and halogen, our kinetic studies calculated initial rates based on substrate consumption whereas all other FDH parameters were determined based on product production.
[0155] This enzyme seems to have an ability to utilise all three halogens, with iodine functioning in both high and low pH but with a preference for higher pH and chlorine at lower pH, whereas bromine can be utilised stably at all pH, with lower kinetic parameters reflecting the significantly lower yields compared to iodine and chlorine, making it a remarkable halogenase with great potential for biotechnological applications.
[0156]
[0157] Both the solved structure and the homology model of Dsg407 (that we had previously generated), show that there is a higher loop participation in the overall structure. Interestingly, the overall structure seems to be more disordered than other FDHs. There are significant differences observed between the monomer of Dsg407 and other FDHs (apo structures) in the flavin binding pocket and the C-terminus, which are found to be significantly more mobile in Dsg407. The mobility of those areas is shown in the B-factor or Debye-Waller factor model, used to describe the attenuation of xray scattering caused by thermal motion in those areas (
[0158] All structurally characterised tryptophan halogenases tend to envelop the substrate by a tightly ordered C-terminus. In the case of Dsg407, the C-terminus has an increased loop content. Strangely, the characteristic helix which usually holds the C-terminus in tryptophan FDHs, is interrupted by several unusual loops showing a helical propensity. This structural behaviour could enable these loops to act as both loop but also as a helix. Furthermore, these areas are highly mobile in the B-factor map. This could reflect how Dsg407 can accommodate such diverse substrates, from small aromatics to complex spiroindoles.
[0159] Using the FxxPxxSxG motif (highlighted in green cylinders,
[0160] From the apo Dsg407 we cannot deduce much about the halogen binding site as the same residues that have been found to coordinate Cl.sup. in tryptophan FDHs are also present in the apo structure. Although Dsg407 is 8 amino acids shorter than PrnA, it contains almost twice the amount of histidines and lysines. In combination with the higher proportion of loop content, pH might be a trigger for conformational changes which could enable chlorine to bind to the halogen binding site and enable it to participate in chlorination in lower pH. In pH above 5, a different conformation might not facilitate binding of chlorine. We ought however to consider that there could be a second halogen binding site, which has evolved to coordinate larger halogens such as bromine and iodine. However, this is a working hypothesis based on structural data and it needs further investigation in order to show exactly what is happening from a mechanistic point of view.
[0161] Finally, when facing the trimer from the frontal plane (
Conclusions with Viral FDH Dsg407
[0162] The viral halogenases is of particular interest as it showed a remarkable substrate tolerance against the initial 300 compound library. The two fungal halogenases halogenated 1% of the initial 300 compound library initially and we later developed a second hit-based which brought the number of hits up to 28-33. The viral halogenase Dsg407 however halogenated 10% of the initial 300 compound library (30 compounds), regioselectively, accepting even 3D substrates such as spiroindoles and thus going beyond the flat indolic structures that PrnA and other characterised halogenases show preference. More importantly, this enzyme is the first viral iodinase capable of also brominating and chlorinating in a pH dependent manner. A super-halogenase capable of incorporating all halogens (except fluorine) could provide the reason for a virus to keep it within its otherwise very minimal genome.
[0163] We also determined kinetic parameters for this viral iodinase, at various pH against one of the non-native substrates that gave good yields, 6-azaindole. Steady state kinetics showed that iodination is the preferred activity of this enzyme and that it is a very competent biocatalyst when compared to other FDHs, the kinetic parameters of which have been shown against their natural substrate. There are several components of the assay that require further optimisation in order to explore the full biocatalytic capacity of this enzyme as we can see that there might be some limiting factors developing in our assay not enabling full conversion for the moment. A cofactor regeneration system and optimisation of enzyme stability for longer incubation times could greatly benefit the biotransformation. As with the other two halogenases, it is our most urgent goal to fully characterise most products possible to understand more about the regioselectivity of these halogenases. Furthermore, it would be very exciting to explore whether this halogenase could incorporate other pseudohalogens, including azides. Tentative experimental data (not included in this thesis) suggests that it may.
[0164] Dsg407 represents a game-changing enzyme in this area. From a fundamental viewpoint it is fascinating that a virus with a genome 170 kb with strong purifying selection against genes that are of no use to the virus, encodes a biosynthetic modifying enzyme like a halogenase. Dsg407 represents almost 1% of its genome. This virus infects Synechococcus, one of the most abundant photosynthesiser in the planet. Although there have been a few publications in recent years where various researchers have tried to understand the functions of these metabolic genes through comparative genomics and transcriptomics, to our knowledge no one has established activity in vitro. This work represents the first biochemical and structural characterisation of such a metabolic gene from a bacterial phage, found to be a halogenase and more excitingly an iodinase capable of incorporating also bromine and chlorine, in a variety of structures.
General Experimental
[0165] All chemicals and solvents were purchased from Sigma Aldrich UK, Alpha Aesar UK, Fisher UK, Fluorochem UK or Apollo Scientific Japan. All chemicals were used when specified under nitrogen either wise all reactions were performed in clean, air-dried glassware.
[0166] .sup.1H NMR 500 MHZ, .sup.13C NMR 126 MHz and .sup.19F NMR 470 MHz were recorded on Bruker 500 or 400 instrument at the University of St Andrews. Deuterated NMR solvents were purchased from Sigma Aldrich or Cambridge Isotope Laboratories Inc. and contained 99.8% atom % deuterium. Chemical shifts () are listed in ppm relative to tetramethylsilane (TMS, =0.00) unless stated otherwise with all coupling constants J listed in Hz. High-resolution mass spectral (HRMS) analyses were acquired by electrospray ionisation (ESI), electron impact (EI) or chemical ionisation (CI) at the EPSRC National Mass Spectrometry Facility in Swansea University. Peaks are reported as m/z. TLC analysis was performed using Machery Nagel polyester backed sheets which were coated with silica 0.20 mm of thickness. Plates were using a model UVGL-58 MINERLIGHT LAMP multiband UV-254/365 nm and/or by ninhydrin stain (50 mg of ninhydrin dissolved in 40 ml of acetone).
[0167] Evaporation of solvents was carried out on a Bchi Rotavapor R-114 under reduced pressure. The pH of solutions was adjusted using a Fisherbrand Hydrus 300 PH meter with a two-point calibration (pH 4 and 7). Purified compounds were freeze-dried using an SCAVAC cool safe freeze-drier equipped with a Vacuubrand chemistry 158 hybrid pump RC6.
[0168] For the biological work, all chemical and biological reagents for buffers, media and stock solutions were purchased from commercial suppliers. No further purification took place and storage was according to the supplier's instructions. All microorganisms used in this work were stored at 80 C. for longer term storage. Biological work was carried under sterile conditions using either a Faster BH-EN class II vertical laminar airflow cabinet or a Bunsen flame. All surfaces, equipment and gloves were always disinfected with Distel (2% v/v). All microorganisms used in this work were stored at 80 C., in 700 l of 50% glycerol in water combined with 300 l of culture in sterilised 1.5 ml Eppendorf tubes. All media, buffers and glassware used for cultures were sterilised at 121 C. for 20 minutes in a Boxer Benchtop Denley autoclave prior to use. Pipetting of solutions and samples was done using LABNET Biopette autovclavable pipettes. pH measurements were taken using a Fisherbrand Hydrus 300 pH meter.
Standard UPLC Conditions
[0169] Samples were analysed by UHPLC using a Waters Acquity UHPLC system equipped with a Waters Acquity BEH C.sub.18 1.7 m 2.150 mm column at 40 C. An injection volume of 5 l was always used for all samples. The analytes were eluted using an initial solvent composition of 90% solvent A (0.1% TFA in water) and 10% solvent B (Acetonitrile) at a flow rate of 600 L/min that was held for 0.5 mins. This was followed by a linear gradient to 95% solvent B over 1.5 minutes. This solvent composition was held for 0.9 mins before returning to initial conditions over 0.1 mins. The initial conditions were held for 1 minute before the next sample was injected. The elution was monitored by UV absorption or fluorescence response tuned to appropriate wavelengths.
Standard LCMS Conditions
[0170] Samples were analysed by a LC-HRMS2 using a Thermo Orbitrap Velop Pro system, equipped with a Waters Xbridge C.sub.18 m 2.1100 mm column at 40 C. An injection volume of 5 l was used for all samples. Analytes were eluted using an initial solvent composition of 90% water & 0.1% formic acid (solvent A) and 10% acetonitrile (solvent B) at a flow rate of 0.35 ml/min. This initial solvent composition was held for 1.5 mins followed by a linear gradient to 95% solvent B over 8 mins. This composition was held for another 2 minutes before returning to initial conditions over 0.5 mins. The eluted analyte was passed through a PDA detector monitoring absorbance at 220-800 nm (2 nm resolution, 10 Hz) and a valve which diverted eluted analyte to the waste. After the first minute, the valve was switched to pass the eluted analyte through to the inlet valve of the H-ESI source. The H-ESI source was set to positive ionisation mode using a 300 C. heater temperature, 350 C. capillary temperature, 50 U sheath gas flow, 20 U aux gas flow, 2 U sweep gas flow, 3.5 kV ionization voltage and 50% RF lens power. The scan cycle included one high-resolution survey scan and three data-dependent fragmentation scans. The survey scan was analysed in the orbitrap FTMS analyser at a resolution of 30,000 (at 400 m/z) over a range of 100-2000 m/z, based on a background ion corresponding to the [M+H].sup.+ charge state of n-butyl-benzenesulfonamide (exact mass 214.08963) as a lock-mass for internal scan-by-scan calibration. The top three peaks from that scan, were then identified, isolated and subsequently fragmented under the CID (collision-induced dissociation) or HCD (higher energy collisional dissociation) modes at 35% normalized energy before fragments were analysed in the standard resolution ITMS analyser (CID) or high-resolution FTMS analyser (HCD).
General Experimental Procedures & Equipment for Molecular Biology
[0171] Reagents, enzymes, media components, buffers, and solvents were obtained from Sigma Aldrich, Alfa Aesar, Fisher, Formedium, Promega or Thermos Scientific. Microbial culturing was performed under sterile conditions maintained using a Faster BH-EN class II vertical laminar airflow cabinet or under a Bunsen flame. E. coli strains were stored at 80 C. in 20% glycerol. Sterilisation was performed by autoclaving at 121 C. for 20 minutes unless otherwise stated, or by passage through a 0.2 m syringe filter. Primers were synthesised by Sigma Aldrich at 0.1 mmol scale and purified by desalting by the manufacturer. Synthetic genes were purchased from Invitrogen. DNA sequencing was performed by GATC Biotech. Melting temperatures (Tm) of primers was calculated using Thermo Fisher Multiple Primer Analyzer under default settings, considering only the annealing region of the primer. Restriction enzymes, DNA modifying enzymes, DNA polymerases, and DNA purification kits were used according to the manufacturer's instructions unless otherwise described.
[0172] Microbial cultures were incubated in New Brunswick Scientific 126 or 126R, Innova 4300, 44 or 42, or Stuart SI500 orbital incubator shakers or a Genlab static incubator. pH measurements were taken using a Fisherbrand Hydrus 300 pH meter. 18 M water was generated using an ELGA Purelab Flex system fitted with 0.2 m point-of-use filter. Autoclaving was performed using a Boxer Benchtop Denley autoclave. Pipetting was performed using LABNET Biopette or Eppendorf Xplorer pipettes, externally calabrated biennially by Starlab. Centrifugation was carried out using a Fisher Scientific accuSpin microcentrifuge, Thermo Scientific IEX CL30R centrifuge with T41 swinging bucket rotor, or Beckman JXN-26 centriguge with JS 5.3, JA 25.50, or JLA 8.100 rotors. PCR was performed using a Biorad T100 thermocycler. UV spectra were obtained using a BMG LABTECH FLUOstar OMEGA microplate reader using clear flat-bottomed 96-well plates or a quartz L-Vis plate. Electroporation was performed using a Bio-Rad Micropulser. Sonication was performed using a Bandelin Sonoplus instrument with KE76 and MS73 flat titanium tips. Automated protein purification was performed using an GE Healthcare AKTA Pure FPLC (fast protein liquid chromatography) system equipped with GE Healthcare HiLoad 16/600 Superdex 75 g or 200 pg columns; HPLC, UPLC, and LCMS were performed using equipment described in the chemical experimental procedures.
General in Silico Procedures
[0173] DNA sequences were obtained from either the EMBL-EBI (European bioinformatics institute) or the NCBI GenBank nucleotide database (National Center for Biotechnology Information). For halogenase sifting PHI-Blast was used against non-redundant protein sequences (nr). The BLAST software used to search for protein sequence homologues of known halogenases was either the NCBI blastp software using the non-redundant protein sequences database (nr) or the SIB BLAST Network Service (Swiss Institute of Bioinformatics). Multiple sequence alignments were performed either using ClustalW2 software (EMBL-EBI), MUSCLE (EMBL-EBI) or CLQ workbench. DNA sequences were translated into protein sequences using the ExPASy translate tool (Swiss institute bioinformatics). Branching analysis and phylogenetic trees were generated with CLQ workbench (Qiagen). Split decomposition was generated with SplitsTree software (Mathematisch-Naturwissnschaftiliche fakultat). Protein secondary structure was predicted using the online PSIPRED predictor from the Bloomsbury Centre for Bioinformatics from University College London. Homology models were generated using PHYRE2 Protein Fold server. Restriction endonuclease sites within nucleotide sequences were identified with NEBcutter software V2.0 (New England Biolabs). The theoretical melting temperatures (Tm) of PCR primer oligos were calculated using the Biomath Tm calculator (Promega); base-stacking melting temperatures were calculated under PCR master mix conditions adjusting for Mg2+ concentration (1.5 mM). Protein pl and extinction coefficient were calculated by ProtParam (expasy).
General Gene Synthesis
[0174] Genes were synthesised as linear DNA fragments, designed by reverse translation from a protein sequence. The sequence was codon optimised for expression in E. coli using the online Invitrogen GeneArt tools. Restriction sides aside from those that were used from cloning were removed during design. A glycine residue was introduced after starter methionine, respective to the N-end rule, to increase protein half-life. Genes were cloned into appropriate vectors and the full-length sequence was confirmed by DNA sequencing before doing any further work. For easy cloning into pUC19, 25-30 bp of pUC19 MCS regions were added at the 5 and 3-prime end of each synthetic gene.
Easy Cloning of Synthetic Genes (Strings) into pUC19
[0175] The cost of string synthesis is significantly lower than insertion into a vector by a supplier. In addition, the quantities of the synthetic gene can be a limiting factor for traditional restriction digest and ligation cloning into a vector. A template of 25-30 bp, identical to pUC 19 MCS were added as flanking regions to the synthetic gene, allowing it to act as a primer in a PCR-amplification of the target plasmid, including restriction sites for EcoRI, NdeI.
[0176] For the vector preparation, all components were mixed on ice, in 50 l reactions containing 37 l sterile water, 5 l 10 buffer E (Promega), 5 l pUC19 (100 ng/l), 1.5 l of EcoRI, 1.5 l of HindIII. The mixture was incubated at 37 cover night or until complete digestion monitored by gel electrophoresis. In the reaction mixture, 1 L of FastAP alkaline phosphatase (Thermo) was added and was further incubated for 60 mins. The mixture was purified with PCR clean up kit (Promega) and the product was analysed by agarose gel electrophoresis.
[0177] Once the vectors had been prepared, PCR amplification was performed. The following were mixed on ice in 100 UL reactions that were later divided into 425 l aliquots. The components included 67 l of sterile water, 20 l of 5 Phusion HF buffer, 2 l of pUC19 (digested by EcoRI/HindIII, FastAP treated) as 5-20 ng/L, 2 l of synthetic gene as 50 ng/l in sterile water, 8 l of dNTPs (2.5 mM stock) and 1 l of Phusion DNA polymerase. In parallel a negative control was prepared and analysed which did not include synthetic gene. The PCR conditions included 30 sec of 98 C. as an initial denaturation step, followed by 30 cycles of denaturation for 15 sec at 98 C., gradient annealing temperature from 60-72 C. for 30 sec and an extension for 3 min at 72 C. After completion of the 30 cycles, PCR was extended for 10 mins at 72 C. and the samples were held at 12 C.
[0178] After completion of PCR, 0.5 L of DpnI were added into each PCR reaction and the mixtures were again incubated at 37 C. overnight. 5 l of each reaction and control were mixed together (control separately) and 5 l of this mixture was used to transform 100 l of chemically competent DH10B-T1 cells.
Optimisation of Production Under T7/Ac Promoter
[0179] A 10 ml LB culture of E. coli BL21 cells (shortly before transformed with plasmid of choice under the control of T7 promoter) was used to inoculate fresh 10 ml LB cultures (X16) with appropriate antibiotic in sterile 50 ml falcon tubes and incubated with shaking (37 C., 180 rpm) until an of OD.sub.600 of 0.4-0.6 (around 2 hours). Once this point was met, the tubes were divided and incubated for 10 mins in various temperatures (16 C., 28 C. and 37 C.). For each temperature, three out of four cultures were induced with either 1 mM, 0.5 or 0.1 mM IPTG (isopropyl--D-1-thiogalactopyranoside) final concentration, as well as no IPTG control for comparison when the T7 promoter was not induced. The cultures were left for 16 h at 16 C., 16 h at 28 C. and 4 more hours at 37 C. Following this, cells were harvested by centrifugation (using JLA 8.1000 rotor, 2000 g, 20 min, 4 C.) and frozen at 80 C. for at least 12 hours.
[0180] The pellets were lysed using chemical cell lysis and the lysates were then subjected to batch nickel purification (in 1.5 ml eppendorf tubes) by centrifugation. The lysates were equilibrated with nickel resin (Promega) using NINTA buffer 1 (Sodium Phosphate 20 mM, Sodium Chloride 300 mM, 10 mM imidazole pH=7.4), followed by washing twice with NINTA buffer 2 (Sodium Phosphate 20 mM, Sodium Chloride 300 mM, 25 mM imidazole pH=7.4) and finally eluting twice with NINTA buffer 3 (Sodium Phosphate 20 mM, Sodium Chloride 300 mM, 250 mM imidazole pH=7.4). Pellet, lysate and samples from batch nickel purification were kept and analysed by SDS electrophoresis.
Culturing for Protein Production with Shaking Flasks for Dsg205, Dsg701 and Dsg407.
[0181] The plasmid harbouring the gene of interest was always pre-transformed fresh into BL21 (DE3) competent cells. A single colony was picked from the transformation plate and was used to inoculate a 10-mL culture in LB containing kanamycin, which was incubated overnight (37 C., 200 rpm). If more than 10 mL starter culture was needed for following steps, then multiple cultures were prepared and combined after overnight incubation. The starter culture was diluted 100-fold with fresh LB containing kanamycin and was then incubated (37 C., 200 rpm) until it reached an OD.sub.600 of 0.4-0.6. The culture was then incubated at the temperature of protein production (typically 16 C.) with shaking at 200 rpm for 10 minutes. Once the incubator had reached the desired temperature, the appropriate amount of IPTG (0.5 mM) was added to the culture and was further incubated for another 16 h. Following this, cells were harvested by centrifugation (using JLA 8.1000 rotor, 2000 g, 20 min, 4 C.) and frozen at 80 C. for at least 12 hours.
Chemical Cell Lysis
[0182] For small scale cultures (<200 ml), sonication was not necessary, instead chemical cell lysis is more appropriate for such volumes. A pellet of cells was re-suspended in 0.1 vol of chemical lysis buffer (including 2 mg of lysozyme/ml of buffer used). If NINTA purification was not to follow downstream, additional EDTA could also be added. The suspension was incubated on ice in the cold room (4 C.) for 1 h. Once a viscous solution could be observed, the sample was passed several times through a G23 gauge needle to loosen the mixture and the suspension was centrifuged to separate lysate from cell debris (16000 g, 20 mins, 4 C.). The supernatant was analysed straight away or stored at 80 C.
Cell Lysis by Sonication
[0183] Frozen pellets were thawed in a room temperature water bath until pellet had liquified and were transferred on ice and gently resuspended in lysis buffer (40 ml/L of culture). The portions of cell suspension were subjected to sonication on ice using the KE 76 titanium tapered tip was used for volumes of 100 ml of suspension per time, sonicating each sample for 2 cycles of 6 min at 40% power and 20% duty cycle. Samples were cooled on ice for at least 10 min between cycles. Cell lysate containing the protein of interest was harvested by centrifugation twice (using JA 25.50 rotor, 35,000 g, 45 min, 4 C.) and the supernatant was either subjected to further purification steps or aliquoted and frozen in liquid nitrogen for storage at 80 C.
Removal of Imidazole During Binding Step
[0184] It is important to highlight that the column should only be loaded with 2.5 ml (MAX) of sample. Therefore, if the previous step has yielded more than 2.5 ml, the elution fractions should either be concentrated (if the protein is not too sensitive in higher concentrations) or multiple PD10 columns should be used. If the sample is less than 2.5 ml, add some storage buffer to the sample to a final volume of 2.5 ml.
[0185] Before sample application the column was equilibrated (with gravity protocol) using step additions of storage buffer (5 ml)4 times. The flow though was discarded.
[0186] Once this step was completed and the column was equilibrated, 2.5 ml of the sample were loaded to the column and was left to bind the column until no more flow though was coming off the column. The flow though was discarded.
[0187] For elution of our protein, a 15 ml sterile falcon tube was placed carefully under the column. 3.5 ml of storage buffer were added and eluate was collected the protein concentration was calculated.
TEV Cleavage of Histidine Terminal Tag
[0188] After IMAC purification and buffer exchange (very important to include buffer exchange step to remove imidazole, as most of the FDHs used in this study precipitate overnight with increased concentration of imidazole) the protein and TEV were mixed in a 10:1 ratio (protein: TEV) and added in dialysis tubing. For a 10 ml of protein sample, 3 L of NiNTA lysis buffer were prepared. The dialysis bag containing the protein and TEV were added to the buffer and left dialysing in the cold room overnight with gentle stirring. For assessment of the efficiency of the his-tag cleavage, a small aliquot of the TEV/Protein sample was analysed with SDS against an aliquot of the uncleaved protein. Once the protein was completely digested by TEV protease, the protein sample was subjected to a second IMAC purification. The flowthrough was collected and analysed further, as it contained the his-tag cleaved protein.
Size Exclusion Chromatography
[0189] After NiNTA IMAC purification, the protein sample was concentrated to 5 mL using Merck Milipore Amicon Ultra-15 10 kDa MWCO centrifugal filters and subjected to gel filtration using the GE AKTA pure FPLC system, typically equipped with the GE HiLoad 16/600 Superdex 200 pg column equilibrated and eluted with GF buffer, monitoring elution by UV absorbance at 280 nm. In a typical purification, the injection loop was washed with 5 volumes of GF buffer and the first 40 mL of eluate following injection were discarded. After this, the eluate was collected in fractions of 3 mL over an appropriate fractionation range for the protein of interest. Fractions containing the protein of interest were pooled, concentrated by ultracentrifugation or subjected to buffer exchange into Storage Buffer (as above) if necessary, aliquoted and frozen in liquid nitrogen for storage at 80 C.
Flavin-Reductase Assays
[0190] Flavin reductase enzyme PrnF was IMAC purified from cultures of E. coli BL21 RG-5066. Flavin reductase enzyme solution (1 M) was added to an assay containing NADH (200 M), FAD (30 M), NaCl (50 mM), Tris-HCl (20 mM, pH 7.5) in a total volume of 1 ml. The PrnF enzyme was added half way through the time course and the decreasing absorbance of the assay was followed at 340 nm over either 20 or 30 minutes, corresponding to the oxidation of NADH. An assay containing no FAD was used as a blank.
Halogenation Assays Using Pure Dsg205
[0191] His.sup.8-Dsg205 enzyme was purified from cultures of E. coli BL21 DSG205. 100 l reactions were carried out using Ni-NTA purified Dsg205 and PrnF enzymes using a range of substrates from the initial 300 compound library or the hit guided library (10 mg/ml stock solutions in DMSO) with appropriate controls. 10 M Dsg205, 1 l of substrate (10 mg/ml), 10 mM NaCl, 1 M PrnF, 5 mM NADH and HEPES buffer pH=7.2. For a full 96 well plate a 10 ml mastermix was prepared, which contained everything but NADH and the substrate. Each substrate was added to a specific position in the well using a multichannel pipette. The mastermix was added in a sterile plastic container and was added in each well of the plate. NADH was added last in each well. The plate was sealed with gas permeable tubing and the reactions were incubated at 30 C. for 90 minutes. Equal volumes methanol and were added to quench the reactions and plates were centrifuged for 1 h. The samples were analysed either by UPLC or LCMS method.
Halogenation Assays Using Crude Lysate Containing Dsg205
[0192] The same procedure was followed for assays with crude lysate of Dsg205, as with pure protein, but this time the enzyme was not purified, it was used directly after lysis or after the lysate had been flash frozen in droplets and stored at 80 C. The conditions included 100 l of crude lysate containing also 1 M PrnF, 5 mM NADH, 10 mM NaCl and 1 l of the substrates (initial 300 compound library or hit guided library). The reactions were left incubating for 12 hours. Equal volumes methanol and were added to quench the reactions and plates were centrifuged for 1 h. The samples were analysed either by UPLC or LCMS method.
Halogenation Assays Using Pure Dsg701
[0193] His.sup.8-Dsg701 enzyme was purified from cultures of E. coli BL21 DSG701. 100 l reactions were carried out using Ni-NTA purified Dsg701 and PrnF enzymes using a range of substrates from the initial 300 compound library or the hit guided library (10 mg/ml stock solutions in DMSO) with appropriate controls. 10 M Dsg701, 1 l of substrate (10 mg/ml), 10 mM NaBr, 1 M PrnF, 5 mM NADH and HEPES buffer pH=7.2. For a full 96 well plate a 10 ml mastermix was prepared, which contained everything but NADH and the substrate. Each substrate was added to a specific position in the well using a multichannel pipette. The mastermix was added in a sterile plastic container and was added in each well of the plate. NADH was added last in each well. The plate was sealed with gas permeable tubing and the reactions were incubated at 30 C. for 90 minutes. Equal volumes methanol and were added to quench the reactions and plates were centrifuged for 1 h. The samples were analysed either by UPLC or LCMS method.
Halogenation Assays Using Crude Lysate Containing Dsg701
[0194] The same procedure was followed for assays with crude lysate of Dsg701, as with pure protein, but this time the enzyme was not purified, it was used directly after lysis or after the lysate had been flash frozen in droplets and stored at 80 C. The conditions included 100 l of crude lysate containing also 1 M PrnF, 5 mM NADH, 10 mM NaBr and 1 l of the substrates (initial 300 compound library or hit guided library). The reactions were left incubating for 12 hours. Equal volumes methanol and were added to quench the reactions and plates were centrifuged for 1 h. The samples were analysed either by UPLC or LCMS method.
Halogenation Assays Using Pure Dsg407
[0195] His.sup.8-Dsg407 enzyme was purified from cultures of E. coli BL21 DSG407. 100 l reactions were carried out using Ni-NTA purified Dsg407 and PrnF enzymes using a range of substrates from the initial 300 compound library (10 mg/ml stock solutions in DMSO) with appropriate controls. 10 M Dsg407, 1 l of substrate (10 mg/ml), 10 mM NaX (X=CI, Br, I), 10 M PrnF, 5 mM NADH and either a) 50 mM citric acid buffer at pH 3 for NaCl, b) 50 mM bicene at pH 8 for NaI or c) 50 mM HEPES at pH 7.4 for NaBr. For a full 96 well plate a 10 ml mastermix was prepared, which contained everything but NADH and the substrate. Each substrate was added to a specific position in the well using a multichannel pipette. The mastermix was added in a sterile plastic container and was added in each well of the plate. NADH was added last in each well. The plate was sealed with gas permeable tubing and the reactions were incubated at 30 C. for 90 minutes. Equal volumes methanol and were added to quench the reactions and plates were centrifuged for 1 h. The samples were analysed either by UPLC or LCMS method.
Halogenation Assays Using Crude Lysate Containing Dsg407
[0196] The same procedure was followed for assays with crude lysate of Dsg407, as with pure protein, but this time the enzyme was not purified, it was used directly after lysis or after the lysate had been flash frozen in droplets and stored at 80 C. It is important to note that the lysis buffer should contain the appropriate halogen salt at the appropriate pH. The conditions included 100 l of crude lysate containing also 1 M PrnF, 5 mM NADH, 10 mM halogen salt and 1 l of the substrates (initial 300 compound library or hit guided library). The reactions were left incubating for 12 hours. Equal volumes methanol and were added to quench the reactions and plates were centrifuged for 1 h. The samples were analysed either by UPLC or LCMS method.
pH Screening for Dsg407
[0197] For the pH studies, the assay conditions were 10 M Dsg407, 10 M of FAD, 1 l of substrate (10 mg/ml in DMSO), 10 mM of either NaBr, NaCl or NaI, 5 mM NADH, 10 M of PrnF and 50 mM of the following buffers: a) for pH ranging between 7.5 to 9 we used 50 mM Bicene buffer b) for pH ranging between 5.8 to 7.5 we used sodium phosphate (NaH.sub.2PO4) buffer and c) for lower pH ranging from 3 to 5.8 we used citric acid-sodium citrate buffer. The assays were run in 96 well plates, at 100 l assays. 1 l of 6-azaindole was used (1 mg/ml stock in DMSO). The reactions were all run in triplicate for all three halogen salts for 90 mins at 30 C. The workup was performed carefully using a precalibrated multichannel pipette, for comparable sample preparations. Equal volumes methanol and were added to quench the reactions and plates were centrifuged for 1 h. The samples were analysed either by UPLC or LCMS method. Both starting material and halogenated product were monitored at 335 nm using the PDA detector of the Waters UPLC system.