SHC ENZYMES AND ENZYME VARIANTS

20260043058 ยท 2026-02-12

    Inventors

    Cpc classification

    International classification

    Abstract

    Squalene Hopene Cyclase (SHC) enzymes and variants thereof and their uses for making ()-Ambrox from homofarnesol and Ambra oxide from bishomofarnesol and the like.

    Claims

    1. A process for preparing ()-Ambrox or a mixture comprising ()-Ambrox, the process comprising enzymatically converting (3E,7E)-homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to ()-Ambrox or a mixture comprising ()-Ambrox using a SHC/HAC enzyme variant, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 and wherein the SHC/HAC enzyme variant amino acid sequence has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, or 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme corresponding to W169, A306 and/or G600 of SEQ ID NO: 1, 2, or 3.

    2. A process for preparing ()-Ambrox or a mixture comprising ()-Ambrox, the process comprising enzymatically converting (3E,7E)-homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to ()-Ambrox or a mixture comprising ()-Ambrox using a SHC/HAC enzyme variant, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 13, 15, 23, 32, and wherein the SHC/HAC enzyme variant amino acid sequence has amino acid alterations relative to SEQ ID NO: 1 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme corresponding to W169, A306 and/or G600 of SEQ ID NO: 1.

    3. A process for preparing Ambra oxide or a mixture comprising Ambra oxide, the process comprising enzymatically converting (2,E)-Bishomofarnesol (BisEEH) or a mixture of isomers of bishomofarnesol comprising BisEEH to Ambra oxide or a mixture comprising Ambra oxide using a SHC/HAC enzyme variant, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 and wherein the SHC/HAC enzyme variant amino acid sequence has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, or 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme corresponding to W169, A306 and/or G600 of SEQ ID NO:1, 2, or 3.

    4. A process for preparing Ambra oxide or a mixture comprising Ambra oxide, the process comprising enzymatically converting (2,E)-Bishomofarnesol (BisEEH) or a mixture of isomers of bishomofarnesol comprising BisEEH to Ambra oxide or a mixture comprising Ambra oxide using a SHC/HAC enzyme variant, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 13, 15, 23, 32, and wherein the SHC/HAC enzyme variant amino acid sequence has amino acid alterations relative to SEQ ID NO: 1 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme corresponding to W169, A306 and/or G600 of SEQ ID NO: 1.

    5. A process according to any one of the preceding claims, wherein: the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, A or V or a functional equivalent thereof, preferably wherein the W at position 169 is replaced by G, the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V or a functional equivalent thereof and/or the G at position 600 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by A, V, L, I or M or a functional equivalent thereof.

    6. A process according to any one of the preceding claims, wherein: the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G.

    7. A process according to any one of the preceding claims, wherein: the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, and the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V.

    8. A process according to any one of the preceding claims, wherein: the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, and the G at position 600 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by M.

    9. A process according to any one of the preceding claims, wherein: the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V, and the G at position 600 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by M.

    10. A process according to any one of the preceding claims, wherein the amino acid at position 168 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 is S or the amino acid at a position in an amino acid sequence of a wild type SHC corresponding to 168 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 is S.

    11. A process according to any one of the preceding claims, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 1, 4, 5, 6 or 350 and has at least one of the following mutations: W169G, A306V and G600M or the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 7, 8, 9 or 386 and has the following mutations: M132R, A224V, 1432T, A557T, R613S, and has at least one of the following mutations: W169G, A306V and G600M or the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 10, 11, 12 or 387 and has the following mutations: M132R, A224V, 1432T and has at least one of the following mutations: W169G, A306V and G600M.

    12. A process according to any one of claims 1 to 11, wherein the W at position 169 is replaced by G.

    13. A process according to any one of claims 1 to 11, wherein the W at position 169 is replaced by G, and the A at position is replaced by V.

    14. A process according to any one of claims 1 to 11, wherein the W at position 169 is replaced by G, and the G at position 600 is replaced by M.

    15. A process according to any one of claims 1 to 11, wherein the W at position 169 is replaced by G, the A at position 306 is replaced by V, and the G at position 600 is replaced by M.

    16. A process according to any one of the preceding claims, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 23, 304, 359 or 360 and has at least one of the following mutations: W172G, A311V and G609M (Tel SHC/HAC variant) or the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 32, 311, 357, or 358 and has the following mutations: W196G, A335V and G629M (Sco SHC/HAC variant) or the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO:13, 312, 353 or 354 and has at least one of the following mutations: W222G, A368V and G667M (Zmo SHC1 variant) or the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 15, 313, 355 or 356 and has at least one of the following mutations: W177G, A321V and G619M (Zmo SHC2 variant).

    17. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 23, 304, 359 or 360 and has W172G mutation.

    18. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 23, 304, 359 or 360 and has W172G and A311V mutations.

    19. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 23, 304, 359 or 360 and has W172G and G609M mutations.

    20. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 23, 304, 359 or 360 and has W172G, A311V and G609M mutations.

    21. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 32, 311, 357, or 358 and has W196G mutation.

    22. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 32, 311, 357, or 358 and has W196G and A335V mutations.

    23. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 32, 311, 357, or 358 and has W196G and G629M mutations.

    24. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 32, 311, 357, or 358 and has W196G, A335V and G629M mutations.

    25. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO:13, 312, 353 or 354 and has W222G mutation.

    26. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO:13, 312, 353 or 354 and has W222G and A368V mutations.

    27. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO:13, 312, 353 or 354 and has W222G and G667M mutations.

    28. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO:13, 312, 353 or 354 and has W222G, A321V and G667M mutations.

    29. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 15, 313, 355 or 356 and has W177G mutation.

    30. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 15, 313, 355 or 356 and has W177G and A321V mutation.

    31. A process according to any one of claims 1 to 16, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 15, 313, 355 or 356 and has W177G and G619M mutation.

    32. A process according to any one of claims 1 to 16. wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 15, 313, 355 or 356 and has W177G, A321V and G619M mutations.

    33. A process according to any one of the preceding claims, wherein the SHC/AHC enzyme variant has an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10, 11, 12, 305, 306, 304, 302, 311, 312, 313, 353, 354, 355, 356, 357, 358, 359, 360, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 350, 351,352, 385 or 386.

    34. A process according to any one of the preceding claims, wherein, the SHC/HAC enzyme variant disclosed herein exhibits: an increased substrate specificity for EEH (or for BisEEH) when homofarnesol or bis-homofarnesol substrates are used, an increased product selectivity for ()-Ambrox (or Ambra oxide) when homofarnesol or bis-homofarnesol substrates are used, an increased specificity for a particular isomer of substrates when substrates other than homofarnesol or bis-homofarnesol are used (eg ethyl-homofarnesol, hydroxyfarnesylacetone and the likesee, for example WO2021/110858 and WO2021/209482 respectively) an increased productivity and/or an increased degree of conversion of EEH (or BisEEH) as well as an increased conversion rate of EEH (or BisEEH) over the first 3 to 6 hours (or over the first 4, 5, or 6 hours) of the reaction, compared to the reference SHC enzyme (e.g. wild-type SHC such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310 or 215G2 AacSHC or SHC #65 or a parent SHC enzyme the variant derives from such as those represented by SEQ ID NO:2, 3, 47-48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383.

    35. A SHC/HAC enzyme variant as defined in any one of the preceding claims.

    36. A process according to any one of the preceding claims except claim 35, wherein the enzymatic conversion takes place at a temperature in the range of about 30 C. to about 50 C., for example from about 40 to about 50 C., and/or at a pH in the range of about 5 to about 6.

    37. A process according to any one of the preceding claims except claim 35, wherein the process comprises culturing a recombinant host cell that produces the SHC/HAC enzyme variant.

    38. A process according to claim 35, wherein the recombinant host cells comprise a nucleic acid sequence selected from SEQ ID NO: 38, 39, 40, 41, 42, 43, 44, 45 or 46.

    39. A process according to any one of the preceding claims except claim 35, wherein the mixture of isomers of homofarnesol comprising EEH is an EE:EZ isomer mixture, preferably wherein the EE:EZ isomer mixture is in a weight ratio of 80:20.

    40. A process according to any one of the preceding claims except claim 35, wherein the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture in a weight ratio of 80:20 is about 2:1, 1:1 or about 0.5:1 or about 0.1:1.

    41. A process according to any one of the preceding claims except claim 35, wherein the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture is in the range of 0.1-0.5, preferably 0.4 and the concentration of EEH is in the range of 250 g/l to 650 g/l, preferably 450 g/l.

    42. A process according to any one of the preceding claims except claim 35, wherein the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture is 1 and the concentration of EEH is 250 g/l.

    43. ()-Ambrox obtained by or obtainable by the process of any preceding claim except claim 35, in a solid form in an amorphous or crystalline form.

    44. Use of ()-Ambrox of claim 43 as part of a fragrance or a cosmetic or a consumer product such as fabric care, toiletry, beauty care, a cleaning product, a detergent product, and/or a soap product.

    45. A fragrance or a cosmetic or a consumer product comprising ()-Ambrox of claim 43.

    46. A nucleic acid sequence encoding the SHC/HAC enzyme variant of claim 35.

    47. A construct comprising the nucleic acid sequence of claim 46.

    48. A recombinant host cell comprising the nucleic acid sequence of claim 46 or the construct of claim 47.

    Description

    BRIEF DESCRIPTION OF THE FIGURES

    [0100] FIG. 1: EEH conversion with AacSHC and 215G2SHC P1, P2, and P3 variants. Reactions were run with 8 g/l EEH (AacSHC wt 4 g/l EEH only), cells to an OD.sub.650 nm of 10 applying individually optimized reaction conditions (T, pH, SDS).

    [0101] FIG. 2 shows the reaction products of Homofarnesol SHC-catalyzed cyclization using a mixture of E,E- and E,Z-Homofarnesol isomers.

    [0102] FIG. 3: Substrate specificity and product selectivity with P1, P2, and P3 SHC variants. Reactions were run with 8 g/l EEH, cells to an OD650 nm of 10 applying individually optimized reaction conditions (T, pH, SDS).

    [0103] FIG. 4: Homofarnesol cyclization with SHC variants. Reactions were run with 125 g/l EEH and 250 g/l cells, at T, pH and SDS (SDS:cells ratio) conditions defined as optimal for each of the variants.

    [0104] FIG. 5: Homofarnesol bioconversions with SHC variants. Reactions were run with 125 g/l EEH and 250 g/l cells, at T, pH and SDS (SDS:cells ratio) conditions defined as optimal for each of the variants.

    [0105] FIG. 6: Substrate specificity and product selectivity in Homofarnesol bioconversions with SHC enzyme variants. Reactions were run with 125 g/l E,E-Homofarnesol and 250 g/l cells, at T, pH and SDS (SDS:cells ratio) conditions defined as optimal for each of the SHC enzymes.

    [0106] FIG. 7: Homofarnesol bioconversions with SHC variants. Reactions were run with 250 g/l EEH and 250 g/l cells, at T, pH and SDS (SDS:cells ratio) conditions defined as optimal for each of the variants.

    [0107] FIG. 8: Homofarnesol bioconversions with SHC variants. Reactions were run with A: 250 g/l EEH and SHC #65 P2, and with B: 300 g/l EEH and SHC #65, at varying [EEH]:[cells] ratios, and at T, pH and SDS (SDS:cells ratio) conditions defined as optimal for each of the variants.

    [0108] FIG. 9: Squalene Hopene cyclase amino acid sequence alignment. The figure shows an amino acid sequence alignment of the squalene hopene cyclase enzymes listed in Table 3 and/or Table 16 prepared with CLUSTAL O (1.2.4). The amino acids at positions 169, 306, and 600 of the Alicyclobacillus acidocaldarius (AacSHC) sequence are highlighted in white on a black background. W at position 169 is almost strictly conserved as is G at position 600 throughout the amino acid sequences aligned: 15 out of 16 sequences, one single conservative substitution. A at position 306 is less conserved (9 out of 16 sequences).

    [0109] FIG. 10: Bis-homofarnesol cyclization with SHC variants. Reactions were run with 4 g/l E,E-Bis-homofarnesol and cells to an OD.sub.650 nm of 10, applying conditions individually defined as optimal for SHC #65 and SHC #65 P2 regarding T, pH and SDS concentration.

    [0110] FIG. 11: Homofarnesol cyclization with wild-type and variantSHC enzymes. Reactions were run in deionized water at 30 C. with 2.36 g/l Homofarnesol and cells to an OD.sub.650 nm of 6.

    [0111] FIG. 12: Homofarnesol bioconversion with SHC #65 P2. Reactions were run with 400 g/l EEH and cells that had produced SHC #65 P2 at [cells]:[EEH] ratios of 0.6, 0.5, 0.4, and 0.3. Reactions were run at 35 C., pH 5.8, and at a constant [SDS]:[cells] ratio of 0.025.

    [0112] FIG. 13: Homofarnesol bioconversion with SHC #65 P2. Reactions were run with 450 g/l EEH and 180 g/l cells ([cells]:[EEH] ratio of 0.4), or 250 g/l EEH and 250 g/l cells ([cells]:[EEH] ratio of 1.0) at 35 C., pH 5.8, and a constant [SDS]:[cells] ratio of 0.030.

    SUMMARY OF THE SEQUENCES

    [0113] SEQ ID NO: 1 is the wild-type Alicyclobacillus acidocaldarius (Aac) SHC amino acid sequence.

    [0114] SEQ ID NO: 2 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, 1432T, A557T and R613S and may be referred to as SHC/HAC enzyme variant #65 or SHC #65 variant herein.

    [0115] SEQ ID NO: 3 may be referred to as 215G2 SHC (or 215G2 SHC variant) and corresponds to the wild-type AacSHC amino acid sequence with the mutations M132R, A224V and 1432T.

    [0116] SEQ ID NO: 4 corresponds to SEQ ID NO: 1 with the substitution W169G (also called the Aac SHC P1).

    [0117] SEQ ID NO:5 corresponds to SEQ ID NO: 1 with the substitutions W169G and G600M (also called the Aac SHC P2).

    [0118] SEQ ID NO:6 corresponds to SEQ ID NO: 1 with the substitutions W169G, A306V and G600M (also called the Aac SHC P3).

    [0119] SEQ ID NO: 7 corresponds to SEQ ID NO: 2 with the substitution W169G (also called the SHC #65 P1 variant).

    [0120] SEQ ID NO:8 corresponds to SEQ ID NO: 2 with the substitutions W169G and G600M (also called the SHC #65 P2 variant).

    [0121] SEQ ID NO:9 corresponds to SEQ ID NO: 2 with the substitutions W169G, A306V and G600M (also called the SHC #65 P3 variant).

    [0122] SEQ ID NO: 10 corresponds to SEQ ID NO: 3 with the substitution W169G (also called the 215G2 SHC P1 variant).

    [0123] SEQ ID NO:11 corresponds to SEQ ID NO: 3 with the substitutions W169G and G600M (also called the 215G2 SHC P2 variant).

    [0124] SEQ ID NO:12 corresponds to SEQ ID NO: 3 with the substitutions W169G, A306V and G600M (also called the 215G2 SHC P3 variant).

    [0125] SEQ ID NO: 13 to SEQ ID NO:34, SEQ ID NO:384 Wild type SHCs enzymes that may be used in the invention as SEQ ID NO:1 (see also tables 3 and 16). SEQ ID NO:13 is identical with SEQ ID NO: 384.

    [0126] SEQ ID NO: 35 is the nucleotide sequence encoding the wild-type AacSHC.

    [0127] SEQ ID NO: 36 is the nucleotide sequence encoding the polypeptide of SEQ ID NO: 2 (SHC #65 variant).

    [0128] SEQ ID NO: 37 is the nucleotide sequence encoding the 215G2 variant (SEQ ID NO:3).

    [0129] SEQ ID NO: 38 is the nucleotide sequence encoding the AacSHC P1 represented by SEQ ID NO:4.

    [0130] SEQ ID NO: 39 is the nucleotide sequence encoding the AacSHC P2 represented by SEQ ID NO:5.

    [0131] SEQ ID NO: 40 is the nucleotide sequence encoding the AacSHC P3 represented by SEQ ID NO:6.

    [0132] SEQ ID NO: 41 is the nucleotide sequence encoding the SHC #65 P1 variant represented by SEQ ID NO:7.

    [0133] SEQ ID NO: 42 is the nucleotide sequence encoding the SHC #65 P2 variant represented by SEQ ID NO:8.

    [0134] SEQ ID NO: 43 is the nucleotide sequence encoding the SHC #65 P3 variant represented by SEQ ID NO:9.

    [0135] SEQ ID NO: 44 is the nucleotide sequence encoding the 215G2 P1 variant represented by SEQ ID NO:10 SEQ ID NO: 45 is the nucleotide sequence encoding the 215G2 P2 variant represented by SEQ ID NO:11 SEQ ID NO: 46 is the nucleotide sequence encoding the 215G2 P3 variant represented by SEQ ID NO:12 SEQ ID NO: 47 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, 1432T, Y81H, A557T and R613S and may be referred to as SHC/HAC enzyme variant #66 herein.

    [0136] SEQ ID NO: 48 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, 1432T, Y81H, H431L and A557T and may be referred to as SHC/HAC enzyme variant #110B8 herein.

    [0137] SEQ ID NO: 49 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, 1432T, T90A and R613S and may be referred to as SHC/HAC enzyme variant #90C7 herein.

    [0138] SEQ ID NO: 50 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, 1432T, A172T and M277K and may be referred to as SHC/HAC enzyme variant #115A7 herein.

    [0139] SEQ ID NO: 51 is the amino acid sequence of the SHC/HAC variant 215G2 SHC (represented by SEQ ID NO:3) with the additional mutation L37Q.

    [0140] SEQ ID NO: 52 is the amino acid sequence of the SHC/HAC variant 215G2 SHC (represented by SEQ ID NO:3) with the additional mutation V1741.

    [0141] SEQ ID NO: 53 is the amino acid sequence of the SHC/HAC variant 215G2 SHC (represented by SEQ ID NO:3) with the additional mutations V1741 and F601Y.

    [0142] SEQ ID NO: 54 is the amino acid sequence of the SHC/HAC variant 215G2 SHC (represented by SEQ ID NO:3) with the additional mutations L37Q, V1741 and F601Y.

    [0143] SEQ ID NO: 55-296, 307-310 are wild type amino acid sequence of SHC/HAC as identified in table 2 or 16.

    [0144] SEQ ID NO: 297-300 are nucleotide sequences encoding SEQ ID NO:47-50.

    [0145] SEQ ID NO: 301 is the amino acid sequence of an GmoSHC variant with V45L, Q54E, M1841, T326S, F624Y.

    [0146] SEQ ID NO: 302 is the amino acid sequence of TeISHC with W172G, P311V, F425Y, G609A mutations.

    [0147] SEQ ID NO: 303 is the amino acid sequence of ZmoSHC1 with Q221S, W222G, A368V, F486Y, G667A mutations.

    [0148] SEQ ID NO: 304 is the amino acid sequence of TeISHC with W172G mutation (P1).

    [0149] SEQ ID NO: 305 is the amino acid sequence of AacSHC with W169G, G600M, M132R, A224V and 1432T mutations.

    [0150] SEQ ID NO: 306 is the amino acid sequence of AacSHC with W169G, G600M, M132R and 1432T mutations.

    [0151] SEQ ID NO: 307-310 (together with SEQ ID NO: 55-296) are wild type amino acid sequence of SHC/HAC as identified in table 2 or 16.

    [0152] SEQ ID NO: 311 is the amino acid sequence of ScoSHC1 with W196G mutation (P1)

    [0153] SEQ ID NO: 312 is the amino acid sequence of ZmoSHC1 with W222G mutation (P1)

    [0154] SEQ ID NO: 313 is the amino acid sequence of ZmoSHC2 with W177G mutation (P1)

    [0155] SEQ ID NO:314 is the motif DXDDTA found in SHC/HAC.

    [0156] SEQ ID NO: 315-360 are amino acid sequences of SHC variants, especially SEQ ID NO: 315-347, 348, 350-352 (except 349) are SHC variants derived from the AaC SHC (SEQ ID NO:1).

    [0157] SEQ ID No. 315 corresponds to SEQ ID NO: 1 with the substitution W169G.

    [0158] SEQ ID No. 316 corresponds to SEQ ID NO: 1 with the substitution W169A.

    [0159] SEQ ID No. 317 corresponds to SEQ ID NO: 1 with the substitution W169V.

    [0160] SEQ ID No. 318 corresponds to SEQ ID NO: 1 with the substitutions W169G and G600A.

    [0161] SEQ ID No. 319 corresponds to SEQ ID NO: 1 with the substitutions W169G and G600V.

    [0162] SEQ ID No. 320 corresponds to SEQ ID NO: 1 with the substitutions W169G and G600L.

    [0163] SEQ ID No. 321 corresponds to SEQ ID NO: 1 with the substitutions W169G and G6001.

    [0164] SEQ ID No. 322 corresponds to SEQ ID NO: 1 with the substitutions W169G and G600M.

    [0165] SEQ ID No. 323 corresponds to SEQ ID NO: 1 with the substitutions W169A and G600A.

    [0166] SEQ ID No. 324 corresponds to SEQ ID NO: 1 with the substitutions W169A and G600V.

    [0167] SEQ ID No. 325 corresponds to SEQ ID NO: 1 with the substitutions W169A and G600L.

    [0168] SEQ ID No. 326 corresponds to SEQ ID NO: 1 with the substitutions W169A and G6001.

    [0169] SEQ ID No. 327 corresponds to SEQ ID NO: 1 with the substitutions W169A and G600M.

    [0170] SEQ ID No. 328 corresponds to SEQ ID NO: 1 with the substitutions W169V and G600A.

    [0171] SEQ ID No. 329 corresponds to SEQ ID NO: 1 with the substitutions W169V and G600V.

    [0172] SEQ ID No. 330 corresponds to SEQ ID NO: 1 with the substitutions W169V and G600L.

    [0173] SEQ ID No. 331 corresponds to SEQ ID NO: 1 with the substitutions W169V and G6001.

    [0174] SEQ ID No. 332 corresponds to SEQ ID NO: 1 with the substitutions W169V and G600M.

    [0175] SEQ ID No. 333 corresponds to SEQ ID NO: 1 with the substitutions W169G, G600A and A306V.

    [0176] SEQ ID No. 334 corresponds to SEQ ID NO: 1 with the substitutions W169G, G600V and A306V.

    [0177] SEQ ID No. 335 corresponds to SEQ ID NO: 1 with the substitutions W169G, G600L and A306V.

    [0178] SEQ ID No. 336 corresponds to SEQ ID NO: 1 with the substitutions W169G, G6001 and A306V.

    [0179] SEQ ID No. 337 corresponds to SEQ ID NO: 1 with the substitutions W169G, G600M and A306V.

    [0180] SEQ ID No. 338 corresponds to SEQ ID NO: 1 with the substitutions W169A, G600A and A306V.

    [0181] SEQ ID No. 339 corresponds to SEQ ID NO: 1 with the substitutions W169A, G600V and A306V.

    [0182] SEQ ID No. 340 corresponds to SEQ ID NO: 1 with the substitutions W169A, G600L and A306V.

    [0183] SEQ ID No. 341 corresponds to SEQ ID NO: 1 with the substitutions W169A, G6001 and A306V.

    [0184] SEQ ID No. 342 corresponds to SEQ ID NO: 1 with the substitutions W169A, G600M and A306V.

    [0185] SEQ ID No. 343 corresponds to SEQ ID NO: 1 with the substitutions W169V, G600A and A306V.

    [0186] SEQ ID No. 344 corresponds to SEQ ID NO: 1 with the substitutions W169V, G600V and A306V.

    [0187] SEQ ID No. 345 corresponds to SEQ ID NO: 1 with the substitutions W169V, G600L and A306V.

    [0188] SEQ ID No. 346 corresponds to SEQ ID NO: 1 with the substitutions W169V, G6001 and A306V.

    [0189] SEQ ID No. 347 corresponds to SEQ ID NO: 1 with the substitutions W169V, G600M and A306V.

    [0190] SEQ ID No. 348 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V and 1432T.

    [0191] SEQ ID NO:349 is a nucleotide sequence coding for a SHC variant derived from AacSHC.

    [0192] SEQ ID No. 350 corresponds to SEQ ID NO: 1 with the substitutions W169G and A306V.

    [0193] SEQ ID No. 351 corresponds to SEQ ID NO: 1 with the substitutions W169A and A306V.

    [0194] SEQ ID No. 352 corresponds to SEQ ID NO: 1 with the substitutions W169V and A306V.

    [0195] SEQ ID NO:353 corresponds to SEQ ID NO: 13 with the substitutions W222G and G667M (also called the ZmoSHC1 P2 variant).

    [0196] SEQ ID NO:354 corresponds to SEQ ID NO: 13 with the substitutions W222G, A368V and G667M (also called the ZmoSHC1 P3 variant).

    [0197] SEQ ID NO:355 corresponds to SEQ ID NO: 15 with the substitutions W177G and G619M (also called the ZmoSHC2 P2 variant).

    [0198] SEQ ID NO:356 corresponds to SEQ ID NO: 15 with the substitutions W177G, A321V and G619M (also called the ZmoSHC2 P3 variant).

    [0199] SEQ ID NO:357 corresponds to SEQ ID NO: 32 with the substitutions W196G and G629M (also called the ScoSHC P2 variant).

    [0200] SEQ ID NO:358 corresponds to SEQ ID NO: 32 with the substitutions W196G, A335V and G629M (also called the ScoSHC P3 variant).

    [0201] SEQ ID NO:359 corresponds to SEQ ID NO: 23 with the substitutions W172G and G609M (also called the TeISHC P2 variant).

    [0202] SEQ ID NO:360 corresponds to SEQ ID NO: 23 with the substitutions W172G, A311V and G609M (also called the TeISHC P3 variant).

    [0203] SEQ ID NO: 361-383 are amino acid sequences of SHC variants derived from Aac SHC (SEQ ID NO:1) as identified in Table 18.

    [0204] SEQ ID No. 361 corresponds to SEQ ID NO: 1 with the substitution T77A.

    [0205] SEQ ID No. 362 corresponds to SEQ ID NO: 1 with the substitution 192V.

    [0206] SEQ ID No. 363 corresponds to SEQ ID NO: 1 with the substitution F129L.

    [0207] SEQ ID No. 364 corresponds to SEQ ID NO: 1 with the substitution M132R.

    [0208] SEQ ID No. 365 corresponds to SEQ ID NO: 1 with the substitution A224V.

    [0209] SEQ ID No. 366 corresponds to SEQ ID NO: 1 with the substitution 1432T.

    [0210] SEQ ID No. 367 corresponds to SEQ ID NO: 1 with the substitution Q579H.

    [0211] SEQ ID No. 368 corresponds to SEQ ID NO: 1 with the substitution F601Y.

    [0212] SEQ ID No. 369 corresponds to SEQ ID NO: 1 with the substitutions M132R and 1432T.

    [0213] SEQ ID No. 370 corresponds to SEQ ID NO: 1 with the substitution F601Y.

    [0214] SEQ ID No. 371 corresponds to SEQ ID NO: 1 with the substitutions T77A, 192V and F129L.

    [0215] SEQ ID No. 372 corresponds to SEQ ID NO: 1 with the substitutions Q579H and F601Y.

    [0216] SEQ ID No. 373 corresponds to SEQ ID NO: 1 with the substitutions F129L.

    [0217] SEQ ID No. 374 corresponds to SEQ ID NO: 1 with the substitutions F129L and F601Y.

    [0218] SEQ ID No. 375 corresponds to SEQ ID NO: 1 with the substitutions F129L, M132R and 1432T.

    [0219] SEQ ID No. 376 corresponds to SEQ ID NO: 1 with the substitutions M132R, 1432T and F601Y.

    [0220] SEQ ID No. 377 corresponds to SEQ ID NO: 1 with the substitutions F129L, M132R, 1432T, and F601Y.

    [0221] SEQ ID No. 378 corresponds to SEQ ID NO: 1 with the substitution F605W.

    [0222] SEQ ID No. 379 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, 1432T, A557T and H431L, and may be referred to as SHC/HAC enzyme variant #49 or SHC #49 variant herein.

    [0223] SEQ ID No. 380 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, 1432T, Y81H, A557T and R613S and may be referred to as SHC/HAC enzyme variant #66 or SHC #66 variant herein.

    [0224] SEQ ID No. 381 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, 1432T, Y81H, H431L and A557T, and may be referred to as SHC/HAC enzyme variant #110B8 or SHC #110B8 variant herein.

    [0225] SEQ ID No. 382 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, 1432T, T90A and R613S, and may be referred to as SHC/HAC enzyme variant #90C7 or SHC #90C7 variant herein.

    [0226] SEQ ID No. 383 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, 1432T, A172T and M277K, and may be referred to as SHC/HAC enzyme variant #115A7 or SHC #115A7 variant herein.

    [0227] SEQ ID No. 385 corresponds to SEQ ID NO: 3 with the substitutions W169G and A306V.

    [0228] SEQ ID No. 386 corresponds to SEQ ID NO: 2 with the substitutions W169G and A306V.

    DETAILED DESCRIPTION

    SHC/HAC Enzymes and Variants Thereof

    [0229] As used herein, the term SHC enzyme means a wild-type (WT) Squalene Hopene Cyclase enzyme that is naturally occurring in, for example, a thermophilic bacterium such as Alicyclobacillus acidocaldarius (Aac). SHCs that act in the cyclisation of homofarnesol to Ambrox may also be referred to as Homofarnesol Ambrox Cyclase (HAC) enzymes. Therefore, the term SHC/HAC enzyme may be used herein.

    [0230] As used herein, the term variant is to be understood as a polypeptide which differs in comparison to the polypeptide from which it is derived by one or more changes or alteration in the amino acid sequence. The polypeptide from which a variant is derived is also known as the parent or reference polypeptide. Typically, a variant is constructed artificially, preferably by gene-technological means. Typically, the polypeptide from which the variant is derived is a wild-type protein or wild-type protein domain. However, the variants usable in the present disclosure may also be derived from homologs, orthologs, or paralogs of the parent polypeptide or from artificially constructed variants, provided that the variant exhibits at least one biological activity of the parent polypeptide. The changes in the amino acid sequence may be amino acid exchanges (substitutions), insertions, deletions, N-terminal truncations, or C-terminal truncations, or any combination of these changes, which may occur at one or several sites.

    [0231] As used herein, the term SHC/HAC enzyme variant means an enzyme that is derived from a wild-type SHC enzyme (such as Aac SHC enzyme, represented by SEQ ID NO:1) but has one or more amino acid alterations compared to the wild-type SHC enzyme and is therefore not naturally occurring in a prokaryote. Table 2 gives a list of wild-type SHC that may be used in the present invention to generate a SHC/HAC enzyme variant. Tables 3 and 16 give a list of preferred wild type SHC to be used in the present invention to generate a SHC/HAC enzyme variant. Table 3 lists the following SHC/AHC enzymes: AaC SHC represented by SEQ ID NO:1, ZmoSHC1 represented by SEQ ID NO:13 or 384, ZmoSCH2 represented by SEQ ID NO:15, BjpSHC represented by SEQ ID NO:16, Burkhoderia ambifaria SHC represented by SEQ ID NO:17 or 18, Bacillus anthracis SHC represented by SEQ ID NO:19, Frankia alni SHC represented by SEQ ID NO:20, Rhodopseudomonas palustris SHC represented by SEQ ID NO:21, GmoSCO SHC represented by SEQ ID NO:22, Tel SHC represented by SEQ ID NO:23, ApaSHC1 represented by SEQ ID NO:24, BmeSHC represented by SEQ ID NO:25, SaISHC represented by SEQ ID NO:26, ApaSHCA represented by SEQ ID NO:27, BamSHC1 represented by SEQ ID NO:28, BamSHC2 represented by SEQ ID NO: 29, PcaSHC2 (or Syntrophotalea carbinolica DSM 2380) represented by SEQ ID NO:30, RpaSHC1 represented by SEQ ID NO:31, ScoSHC represented by SEQ ID NO:32, SfuSHC represented by SEQ ID NO:33, TtuSHC represented by SEQ ID NO:34. More preferred wild type SHC to be used in the present invention to generate a SHC/HAC enzyme variant are: AaC SHC represented by SEQ ID NO:1, ZmoSHC1 represented by SEQ ID NO:13, ZmoSCH2 represented by SEQ ID NO:15, Tel SHC represented by SEQ ID NO:23 and ScoSHC represented by SEQ ID NO:32.

    [0232] The one or more amino acid alterations may, for example, modify (e.g. increase) the enzymatic activity for a substrate (e.g. EEH). In the context of the invention, a SHC/HAC enzyme variant may be derived from a SHC/HAC variant. Examples of SHC/HAC variants include SEQ ID NO:2, 3, 4748, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383.

    [0233] Assays for determining and quantifying SHC/HAC enzyme and/or SHC/HAC enzyme variant activity are described herein and are known in the art. By way of example, SHC/HAC enzyme and/or SHC/HAC enzyme variant activity can be determined by incubating purified SHC/HAC enzyme or enzyme variant or extracts from host cells or a complete recombinant host organism that has produced the SHC/HAC enzyme or enzyme variant with an appropriate substrate under appropriate conditions and carrying out an analysis of the reaction products (e.g. by gas chromatography (GC) or HPLC analysis). Further details on SHC/HAC enzyme and/or SHC/HAC enzyme variant activity assays and analysis of the reaction products are provided in the Examples. These assays include producing the SHC/HAC enzyme variant in recombinant host cells (e.g. E. coli).

    [0234] As used herein, the term activity means the ability of an enzyme to react with a substrate to provide a desired product. The activity can be determined in what is known as an activity test for monitoring the formation of the desired product. The SHC/HAC enzyme derivatives of the present disclosure may be characterized by their ability to cyclize homofamesol (e.g. EEH) into ()-Ambrox and demonstrate a biological activity such as an HAC activity. The SHC/HAC enzyme derivatives of the present disclosure may be characterized by their ability to cyclize bishomofamesol (e.g. E,E-Bishomofarnesol) into Ambra oxide.

    [0235] In the context of the application, an activity or a biological activity of a SHC/HAC variant is compared with the corresponding activity or biological activity of the wild type, parent, reference SHC/HAC it derives from and under the same conditions. Examples of wild type SHC/HAC enzymes have been identified in table 2, 3 or 16. In an embodiment, wild type SHC/HAC enzymes are those represented by SEQ ID NO:1 or by any of SEQ ID NO:13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310.

    [0236] Examples of parent or reference SHC/HAC enzyme used to create the SHC/HAC variant of the invention may be represented by any of SEQ ID NO: 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383.

    [0237] A biological activity as used herein, refers to any activity a polypeptide may exhibit, including without limitation: enzymatic activity; substrate specificity, selectivity (such as substrate selectivity and/or product selectivity), rate of conversion (such as an EEH:EZH conversion ratio), yield, binding activity to another compound (e.g. binding to another polypeptide, in particular binding to a receptor, or binding to a nucleic acid); inhibitory activity (e.g. enzyme inhibitory activity); activating activity (e.g. enzyme-activating activity); or toxic effects. It is not required that the variant exhibits such an activity to the same extent as the parent or wild-type or reference polypeptide. A variant is regarded as a variant within the context of the present application, if it exhibits the relevant activity to a degree of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150% or at least 200% of the activity of the parent polypeptide. Likewise, a variant is regarded as a variant within the context of the present application, if it exhibits the relevant biological activity to a degree of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150% or at least 200% of the activity of the parent polypeptide (as the terms derivative and variant are used interchangeably throughout the present disclosure).

    [0238] In an embodiment, the SHC/HAC enzyme variants described herein show a better yield (i.e. increased yield) compared to the yield obtained using a reference SHC enzyme (e.g. a wild-type SHC/HAC enzyme such as AacSHC/AHC enzyme or a known SHC/HAC enzyme variant or the parent SHC the variant derives from). The term yield refers to the gram of recoverable product (i.e. ()-Ambrox or Ambra oxide) per gram of feedstock (which can be calculated as a percent molar conversion rate). In this context, increase may mean an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, at least 200% or at least 400% of the yield obtained using a reference SHC enzyme.

    [0239] In an embodiment, selectivity refers to product selectivity and describes the ability to produce a particular compound (eg ()-Ambrox or Ambra oxide) in an enzymatically catalyzed method as described in a substantially enriched/predominant form (product selectivity) from a mixture of several substrate isomers. In an embodiment, the mixture of homofarnesol substrate isomers is selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)]. In an embodiment, the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH. In an embodiment, the ratio of EEH:EZH within this mixture may range from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.

    [0240] In a preferred embodiment, selectivity refers to product selectivity and describes the ability to produce a particular compound (eg ()-Ambrox, i.e. compound (I)) in an enzymatically catalyzed method as described in a substantially enriched/predominant form (product selectivity) from a EEH:EZH mixture with a ratio of 80:20 or 90:10.

    [0241] Within this context, substantially enriched/predominant form may mean that the total products formed as a result of the cyclisation reaction of the enzyme variant of WT SHC may, for example, consist essentially of or consist of: [0242] compound of formula (I) (()-Ambrox) described herein when using any of the homofarnesol substrate isomer mixture identified above (preferably EEH:EZH, more preferably with a ratio of 80:20 or 90:10) or [0243] compounds of formula (I) (()-Ambrox) and formula (III) described herein when using any of the homofarnesol substrate isomer mixture identified above (preferably EEH:EZH, more preferably with a ratio of 80:20 or 90:10).

    [0244] It means that compounds of formula (II) and (IV) may not detectable at the end of the process or during the first 3, 4, 5 or 6 or 12 or 18 hours of the process. The detection of compounds of formula (I), (II), (III) and (IV) may be done using techniques known to the skilled person, preferably those used in the experimental part. It also means that in the absence of any downstream processing steps, only the compound of formula (I) or only the compounds of formula (I) and (III) are produced. This means that down stream processing (DSP) may be simplified because both the degree of substrate conversion and the conversion rate of the substrate has been increased. In other words, the DSP is simplified since the amount of unreacted homofarnesol present at the end of the reaction may be reduced. It is known that inreacted homofarnesol dissolves at least part of the solid ()-Ambrox formed and that solid ()-Ambrox formed may also dissolve in the other liquid by-products which, if not present (eg compounds II and/or IV) may simplify the DSP steps.

    [0245] In this context, a downstream processing step means a separation of solid ()-Ambrox from unreacted homofarnesol substrate as well as a separation of ()-Ambrox from other by-products (eg compounds II and/or Ill and/or IV). DSP steps may include but are not limited to one or more of a centrifugation, a filtration, a steam or organic solvent extraction or distillation, or a selective crystallization step. In this context an example of a simplified DSP is where a distillation step may be more efficient at separating ()-Ambrox from unreacted homofarnesol than separating ()-Ambrox from the by-products produced. Each of these downstream processing steps have been later defined herein. Exemplary downstream processing steps are provided in WO2022/023464 the contents of which are incorporated herein by reference.

    [0246] In an embodiment, the SHC/HAC enzyme variants described herein show an increased product selectivity (i.e increased selectivity for ()-Ambrox or Ambra oxide) compared to the product selectivity obtained using a reference SHC enzyme (e.g. a wild-type SHC/HAC enzyme such as AacSHC/AHC enzyme represented by SEQ ID NO:1 or of any other wild type SHC/HAC enzyme represented by SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310 or a known SHC/HAC enzyme variant or the parent SHC the variant derives from, for example any SHC/HAC represented by SEQ ID NO: 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383). The term product selectivity also refers to the gram of recoverable product (i.e. ()-Ambrox or Ambra oxide) per gram of total products formed (which can be calculated as a percent molar conversion rate). In this context, increase may mean an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, at least 200% or at least 400% of the yield obtained using a reference SHC enzyme.

    [0247] In an embodiment, selectivity means an ability to preferentially convert a particular substrate isomer (eg the EEH isomer) into a specific product in an enzymatically catalyzed method as described herein out of a plurality/mixture of several substrate isomers (substrate selectivity).

    [0248] More specifically, this means that a particular product ()-Ambrox is enriched with respect to the enzymatic conversion of a specific substrate (EEH) isomer from a mixture of several substrate isomers.

    [0249] Therefore, substrate selectivity of an enzyme or enzyme variant refers to the ability of the enzyme or enzyme variant to react with a particular substrate isomer compared to another substrate isomer, while the enzyme is in contact with a mixture comprising at least two distinct substrate isomers. For example, a WT SHC enzyme (such as those represented by SEQ ID NO:1 or by any of the SHC/HAC disclosed in tables 2, 3 or 16 or represented by SEQ ID NO:13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55. 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310) or enzyme variant of WT SHC (such as those represented by any of SEQ ID NO: 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383) that is selective for EEH over other isomers of homofarnesol or selective for BisEEH over other isomers of bishomofarnesol means that the WT SHC enzyme or enzyme variant of WT SHC is more likely to convert EEH than other isomers of homofarnesol or to convert BisEEH than other isomers of bishomofarnesol. In an embodiment, the mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers of homofarnesol comprises the EEH isomer and is selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)]. In an embodiment, the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH. In an embodiment, the ratio of EEH:EZH within this mixture may range from about 55:45, 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.

    [0250] For example, the wt % of total products formed as a result of the reaction of the enzyme variant of a WT or of a reference or parent SHC with the mixture comprising at least two distinct substrate isomers of homofarnesol, said mixture comprising EEH may be at least about 1 percentage point greater than the wt % of total products formed as a result of the reaction of the corresponding WT or parent or reference of SHC enzyme with the same mixture comprising EEH. For example, the wt % of total products formed as a result of the reaction of said enzyme variant may be at least about 2 or at least about 3 or at least about 4 percentage points greater than the wt % of total products formed as a result of the reaction of WT or reference or parent SHC with the same mixture comprising EEH. For example, the wt % of total products formed as a result of the reaction of said enzyme variant may be up to about 40 or up to about 30 or up to about 20 or up to about 15 or up to about 10 percentage points greater than the wt % of total products formed as a result of the reaction of WT or reference or parent SHC with the same mixture comprising EEH. For example, the wt % of total products formed as a result of the reaction of said enzyme variant with a mixture comprising EEH may be from about 1 to about 40 or from about 2 to about 30 or from about 3 to about 20 or from about 4 to about 10 percentage points greater than the wt % of total products formed as a result of the reaction of WT or reference or parent SHC with the same mixture comprising EEH. The total products formed as a result of the reaction of the enzyme variant of a WT SHC or of reference or parent SHC may, for example, comprise, consist essentially of or consist of compounds of formula (II) (()-Ambrox) and formula (IV) described herein when a mixture comprising at least two distinct substrate isomers of homofarnesol, said mixture comprising EEH is used as a substrate. In all these embodiments, the mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers of homofarnesol comprises the EEH isomer and is selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)]. In an embodiment, the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH. In an embodiment, the ratio of EEH:EZH within this mixture may range from about 55:45, 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.

    [0251] The total products formed as a result of the reaction of the enzyme variant of WT or of a reference or parent SHC may, for example, comprise, consist essentially of or consist of compounds of formula (X) and/or formula (XII) described herein when bisEEH is used as a substrate.

    [0252] For example, the wt % of ()-Ambrox formed using the enzyme variant of a WT SHC/HAC (such as those WT SHC/HAC represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310) or of a reference/variant SHC/HAC (such as those represented by SEQ ID NO: 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383) may, for example, be at least about 1 percentage point greater than the wt % of ()-Ambrox formed as a result of the reaction of the WT or reference/variant SHC with a mixture comprising at least two distinct substrate isomers of homofarnesol, said mixture comprising EEH. For example, the wt % of ()-Ambrox formed as a result of the reaction of the enzyme variant of said WT or reference or patent SHC with said mixture comprising EEH may be at least about 2 or at least about 3 or at least about 4 percentage points greater than the wt % of ()-Ambrox formed as a result of the reaction of said WT or reference or parent SHC with said mixture comprising EEH. For example, the wt % of ()-Ambrox formed as a result of the reaction of said enzyme variant of WT SHC with said mixture comprising EEH may be up to about 40 or up to about 30 or up to about 20 or up to about 15 or up to about 10 percentage points greater than the wt % of ()-Ambrox formed as a result of the reaction of said WT or said reference or parent SHC with said mixture comprising EEH. For example, the wt % of ()-Ambrox formed as a result of the reaction of said enzyme variant of said WT or said parent or reference SHC with said mixture comprising EEH may be from about 1 to about 40 or from about 2 to about 30 or from about 3 to about 20 or from about 4 to about 10 percentage points greater than the wt % of ()-Ambrox formed as a result of the reaction of said WT of said reference or parent SHC with said mixture comprising EEH. In all these embodiments, the mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers of homofarnesol comprises the EEH isomer and is selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)]. In an embodiment, the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH. In an embodiment, the ratio of EEH:EZH within this mixture may range from about 55:45, 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.

    [0253] Selectivity of an enzyme variant of a WT SHC/HAC (such those represented by SEQ ID NO:1, or 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310) or of those parent or reference SHC/HAC (such as those represented by SEQ ID NO: 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383) may also be compared to the selectivity of the corresponding WT SHC/HAC or corresponding reference/parent SHC/HAC enzyme by comparing the EEH:EZH conversion ratio (i.e. % conversion of EEH:% conversion of EZH) or bisEEH:bisEZH conversion ratio (i.e. % conversion of bisEEH:% conversion of bisEZH) of reactions using each enzyme. This may be determined by measuring the amount of EEH and EZH or bisEEH and bisEZH remaining in the reaction mixture when the reaction has completed. Usually the reaction has completed after 18 hours or after 20 hours. Alternatively, the selectivity of an enzyme variant of a WT SHC/HAC (such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310) or of a reference or variant SHC/HAC (such as those represented by SEQ ID NO: 2, 3 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383) may also be compared to the selectivity of said corresponding WT or reference or parent SHC/HAC by comparing the ratio of the products arising from the conversion of EEH (compounds of formulae I and IV) and EZH (compounds of formulae II and Ill) respectively or the conversion of bisEEH (compounds of formula X and XII) and bisEZH (XI and XIII) respectively.

    [0254] The SHC/HAC enzyme variant of a WT or of a reference or parent SHC/HAC may, for example, provide an EEH:EZH conversion ratio of at least about 2.0 in a process for making ()-Ambrox from a mixture of homofarnesol comprising at least two distinct substrate isomers of homofarnesol, said mixture comprising EEH and EZH. In an embodiment, the mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers of homofarnesol comprises the EEH and the EZH isomers and is selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)]. In an embodiment, the mixture comprises EEH and EZH.

    [0255] In an embodiment, the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH. In an embodiment, the ratio of EEH:EZH within this mixture may range from about 55:45, 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.

    [0256] For example, the enzyme variant of a WT or of a reference or parent SHC/HAC may provide an EEH:EZH conversion ratio of at least about 2.5 or at least about 3.0 or at least about 3.5 in a process for making ()-Ambrox from a mixture as defined above. In an embodiment, the mixture comprises EEH and EZH. For example, the enzyme variant of said WT SHC/HAC or of said reference or parent SHC/HAC may provide an EEH:EZH conversion ratio up to about 5.0 or up to about 4.5 or up to about 4.0 in a process for making ()-Ambrox from the mixture as defined above. In an embodiment, said mixture comprises EEH and EZH. For example, the enzyme variant of said WT or of said reference or parent SHC/HAC may provide an EEH:EZH conversion ratio ranging from about 2.0 to about 5.0 or from about 2.5 to about 4.5 or from about 3.0 to about 4.0 in a process for making ()-Ambrox from the mixture as defined above. In an embodiment, said mixture comprises EEH and EZH. This may, for example, be in contrast to the conversion ratio provided by AacSHC in a process for making ()-Ambrox from a mixture comprising EEH and EZH, which may, for example, be less than about 2.0.

    [0257] In particular, where the WT SHC enzyme or enzyme variant of WT SHC has a higher selectivity for EEH over other isomers of homofarnesol compared to WT AacSHC and/or variants of WT AacSHC, the wild-type SHC/HAC enzyme (e.g. from which the SHC/HAC enzyme variant may be derived) may be selected from TeISHC1, ApaSHC1, ZmoSHC1, ZmoSHC2, BjaSHC (or BjpSHC), GmoSHC BmeSHC, SaISHC, ApaSHCA. For example, where the WT SHC enzyme or enzyme variant of WT SHC has a higher selectivity for EEH over other isomers of homofarnesol compared to WT AacSHC and/or variants of WT AacSHC, the wild-type SHC/HAC enzyme (e.g. from which the SHC/HAC enzyme variant may be derived) may be selected from ZmoSHC1, BjaSHC (BjpSHC), GmoSHC, ApaSHC1 and BmeSHC.

    [0258] In an embodiment, the SHC/HAC enzyme variants described herein show an increased rate of EEH conversion (or increased rate of BisEEH conversion) compared to the rate of conversion of a reference SHC enzyme (e.g. a wild-type SHC/HAC enzyme such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290. 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310) or a known SHC/HAC enzyme variant or the parent SHC the variant derives from (such as those represented by SEQ ID NO:2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383). The term conversion rate refers to the amount of converted substrate (i.e. EEH or BisEEH) per gram of biocatalyst and per unit of time (which can be calculated as a percent molar conversion rate). In this context, increase may mean an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, at least 200% or at least 400% of the conversion rate obtained using a reference SHC enzyme.

    [0259] In an embodiment, the SHC/HAC enzyme variants described herein show an increased specificity for their substrate EEH (or BisEEH) compared to the specificity of a reference SHC enzyme (e.g. a wild-type SHC/HAC enzyme such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310 or a known SHC/HAC enzyme variant or the parent SHC the variant derives from such as those represented by SEQ ID NO:2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383) for the same substrate. The term substrate specificity also refers to the amount of a particular converted substrate isomer (i.e. EEH or BisEEH) per gram of substrate initially present at a certain point of time of an enzymatically catalysed reaction, or during an interval of said reaction. In particular, said selectivity may be observed during an interval corresponding 1 to 99%, 2 to 95%, 3 to 90%, 5 to 85%, 10 to 80%, 15 to 75%, 20 to 70%, 25 to 65%, 30 to 60, or 40 to 50% conversion of the initial amount of the substrate. In an embodiment, the interval may be from 1 to 8 hours or from 2 to 7 or from 3 to 6 hours. In an embodiment, the interval is 6 hours. In this context, increase may mean an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, at least 200% or at least 400% of the substrate specificity obtained using a reference SHC enzyme.

    [0260] In additional embodiments, the SHC/HAC enzyme variants described herein show a modified (e.g. increased) productivity relative to a reference SHC enzyme (e.g. wild-type AacSHC (SEQ ID NO:1) or 215G2 AacSHC (SEQ ID NO:3) or SHC #65 (SEQ ID NO:2) or a parent SHC enzyme the variant derives from such as any of the following wild type SHC/HAC identified in table 2 or 3 or 16 or represented by SEQ ID NO:13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310) or derived from a variant such as any of the following SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383). The term productivity refers to the amount of recoverable product (i.e. ()-Ambrox or Ambra oxide) in grams per liter of reaction capacity per hour of bioconversion time (i.e. time after the substrate was added). The term productivity also refers to the amount of recoverable product in grams per liter of reaction capacity per hour of bioconversion time (ie time after the substrate was added) per gram of biocatalyst used in the reaction. In this context, increase may mean an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, at least 200% or at least 400% of the productivity obtained using a reference SHC enzyme.

    [0261] In an embodiment, the SHC/HAC enzyme variant disclosed herein exhibits: [0262] an increased substrate specificity for EEH (or for BisEEH) when homofarnesol or bis-homofarnesol substrates are used, [0263] an increased product selectivity for ()-Ambrox (or Ambra oxide) when homofarnesol or bis-homofarnesol substrates are used, [0264] an increased specificity for a particular isomer of substrates when substrates other than homofarnesol or bis-homofarnesol are used (eg ethyl-homofarnesol, hydroxyfarnesylacetone and the likesee, for example WO2021/110858 and WO2021/209482 respectively) [0265] an increased productivity and/or [0266] an increased degree of conversion of EEH (or BisEEH) as well as an increased conversion rate of EEH (or BisEEH) over the first 3 to 6 hours (or over the first 4, 5, or 6 hours) of the reaction,
    compared to the reference SHC enzyme (e.g. wild-type SHC such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295 296, 307, 308, 309, 310 or 215G2 AacSHC or SHC #65 or a parent SHC enzyme the variant derives from such as those represented by SEQ ID NO:2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383).

    [0267] In an embodiment, the SHC/HAC enzyme variant disclosed herein exhibits: [0268] an increased substrate specificity for EEH (or for BisEEH) when homofarnesol or bis-homofarnesol substrates are used [0269] an increased product selectivity for ()-Ambrox (or Ambra oxide) when homofarnesol or bis-homofarnesol substrates are used [0270] an increased specificity for a particular isomer of substrates when substrates other than homofarnesol or bis-homofarnesol are used (eg ethyl-homofarnesol, hydroxyfarnesylacetone and the likesee, for example WO2021/110858 and WO2021/209482 respectively)an increased productivity and [0271] an increased degree of conversion of EEH (or BisEEH) as well as an increased conversion over the first 3 to 6 hours (or over the first 4, 5 or 6 hours) of the reaction,
    compared to the reference SHC enzyme (e.g. wild-type AacSHC or 215G2 AacSHC or SHC #65 or a parent SHC enzyme the variant derives from).

    [0272] In further embodiments, the SHC/HAC enzyme variants described herein show a modified (i.e. increased) yield compared with the yield of a reference SHC enzyme (e.g. wild-type AacSHC (SEQ ID NO: 1) or SHC #65 (SEQ ID NO:2), 215G2 AacSHC (SEQ ID NO: 3), ZmoSHC1 represented by SEQ ID NO:13, ZmoSCH2 represented by SEQ ID NO:15, BjpSHC represented by SEQ ID NO:16, Burkhoderia ambifaria SHC represented by SEQ ID NO:17 or 18, Bacillus anthracis SHC represented by SEQ ID NO:19, Frankia alni SHC represented by SEQ ID NO:20, Rhodopseudomonas palustris SHC represented by SEQ ID NO:21, GmoSCO SHC represented by SEQ ID NO:22, Tel SHC represented by SEQ ID NO:23, ApaSHC1 represented by SEQ ID NO:24, BmeSHC represented by SEQ ID NO:25, SaISHC represented by SEQ ID NO:26, ApaSHCA represented by SEQ ID NO:27, BamSHC1 represented by SEQ ID NO:28, BamSHC2 represented by SEQ ID NO: 29, PcaSHC2 (or Syntrophotalea carbinolica DSM 2380) represented by SEQ ID NO:30, RpaSHC1 represented by SEQ ID NO:31, ScoSHC represented by SEQ ID NO:32, SfuSHC represented by SEQ ID NO:33, TtuSHC represented by SEQ ID NO:34.

    [0273] In a preferred embodiment, the SHC/HAC enzyme variants described herein show a modified (i.e. increased) yield compared with the yield of a reference AacSHC (SEQ ID NO: 1) or SHC #65 (SEQ ID NO:2), or 215G2 AacSHC (SEQ ID NO: 3) or ZmoSHC1 represented by SEQ ID NO:13 or ZmoSCH2 represented by SEQ ID NO:15 or Tel SHC represented by SEQ ID NO:23 or ScoSHC represented by SEQ ID NO:32.

    [0274] In particular, the wild-type SHC/HAC enzyme (e.g. from which the SHC/HAC enzyme variant may be derived) may be the Alicyclobacillus acidocaldarius (Aac) SHC/HAC enzyme, the Zymomonas mobilis (Zmo) SHC/HAC enzyme, the Bradyrhizobium japonicum (Bjp/Bja) SHC/HAC enzyme, the Acetobacter pasteurianus (Apa) SHC/HAC enzyme, the Bacillus megaterium (Bme) SHC/HAC enzyme or the Gluconobacter morbifer (Gmo) SHC/HAC enzyme. In particular, the wild-type SHC/HAC enzyme (e.g. from which the SHC/HAC enzyme variant may be derived) may be the Alicyclobacillus acidocaldarius (Aac) SHC/HAC enzyme.

    [0275] The term target yield factor refers to the ratio between the product concentration obtained and the concentration of the SHC/HAC variant enzyme (for example, purified SHC/HAC enzyme variant or an extract from the recombinant host cells producing the SHC/HAC enzyme variant) in the reaction medium. In various embodiments, the SHC/HAC enzyme variants disclosed herein show a modified (e.g. increased) fold increase in enzymatic activity (e.g. a modified/increased homofarnesol Ambrox cyclase (HAC) activity) relative to the activity of a reference SHC protein (e.g. SEQ ID No.1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310 or 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383). This increase in activity may be at least by a factor of: 2, 3, 4, 6, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, and/or 100.

    [0276] As used herein, the term amino acid alteration means an insertion of one or more amino acids between two amino acids, a deletion of one or more amino acids or a substitution (which may be conservative or non-conservative) of one or more amino acids with one or more different amino acids relative to the amino acid sequence of a reference amino acid sequence. Substitutions replace the amino acids of the reference sequence with the same number of amino acids in the variant sequence. Reference amino acid sequences may, for example, be a wild-type (WT) amino acid sequence (for example SEQ ID NO: 1 or any of SEQ ID NO:13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310) or may, for example, itself be a SHC/HAC enzyme variant sequence (for example the Aac variantSEQ ID NO: 2 or 3 or 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383). The word substitution is synonymous with the word replacement.

    [0277] The amino acid alterations can be easily identified by a comparison of the amino acid sequences of the SHC/HAC enzyme variant with the amino acid sequence of the reference amino acid sequence.

    [0278] Conservative amino acid substitutions may be made, for instance, on the basis of similarity in polarity, charge, size, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the amino acid residues involved. The 20 naturally occurring amino acids as outlined above can be grouped into the following six standard amino acid groups: [0279] (1) hydrophobic: Met, Ala, Val, Leu, lie; [0280] (2) neutral hydrophilic: Cys, Ser, Thr; Asn, Gln; [0281] (3) acidic: Asp, Glu; [0282] (4) basic: His, Lys, Arg; [0283] (5) residues that influence chain orientation: Gly, Pro; and [0284] (6) aromatic: Trp, Tyr, Phe.

    [0285] Accordingly, as used herein, the term conservative substitutions means an exchange of an amino acid by another amino acid listed within the same group of the six standard amino acid groups shown above. For example, the exchange of Asp by Glu retains one negative charge in the so modified polypeptide. In addition, glycine and proline may be substituted for one another based on their ability to disrupt alpha-helices. Some preferred conservative substitutions within the above six groups are exchanges within the following sub-groups: (i) Ala, Val, Leu and lie; (ii) Ser and Thr; (ii) Asn and Gln: (iv) Lys and Arg; and (v) Tyr and Phe. Given the known genetic code, and recombinant and synthetic DNA techniques, the skilled scientist readily can construct DNAs encoding the conservative amino acid variants.

    [0286] In a preferred embodiment (as demonstrated in Example 11) a set of conserved amino acids in the amino acid sequence of a wild type SHC, in particular wild type AacSHC of SEQ ID No. 1, comprises L22, Q26, G30, W32, A44, L48, Q72, G76, W78, Y95, L98, G102, A113, 1117, G121, G122, F129, T130, L134, A135, G138, W142, P146, W169, A170, R171, F217, D222, R237, 1261, P263, P281, S309, P310, W312, D313, T314, A320, W339, Q344, G349, D350, W351, G361, G362, A364, F365, N369, Y372, P373, D374, D376, D377, W406, Q411, G415, A419, P433, D436, D442, P443, D447, V448, Q479, G483, W485, G487, R488, W489, G490, N492, Y495, G496, T497, L504, W522, Q527, G531, G532, W533, G534, E535, S539, Y540, G547, T552, T556, W558, A559, A565, L581, Q585, G589, W591, G600, F601, P602, F605, Y609, Y612, F616, P617, A620 and R623 by reference to the wild type AacSHC of SEQ ID No 1.

    [0287] In a preferred embodiment (as demonstrated in Example 14) a set of conserved amino acids in the amino acid sequence for five wild type SHC, in particular wild type AacSHC of SEQ ID No. 1, wild type ZmoSHC1 of SEQ ID No. 13, wild type ZmoSHC2 of SEQ ID No. 15, wild type TeISHC of SEQ ID No. 23 and wild type ScoSHC of SEQ ID No. 32 is presented.

    [0288] As used herein, non-conservative substitutions or non-conservative amino acid exchanges are defined as exchanges of an amino acid by another amino acid listed in a different group of the six standard amino acid groups (1) to (6) as shown above. Typically, the SHC/HAC enzyme variants described herein are prepared using non-conservative substitutions which alter the biological function (e.g. HAC activity) of the disclosed SHC/HAC enzyme variants. For ease of reference, the one-letter amino acid symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission are indicated as follows. The three letter codes are also provided for reference purposes.

    TABLE-US-00001 TABLE 1 Amino acid nomenclature One Letter Code Three Letter Code Amino Acid Name A Ala Alanine C Cys Cysteine D Asp Aspartic Acid E Glu Glutamic Acid F Phe Phenylalanine G Gly Glycine H His Histidine I Ile Isoleucine K Lys Lysine L Leu Leucine M Met Methionine N Asn Asparagine P Pro Proline Q Gln Glutamine R Arg Arginine S Ser Serine T Thr Threonine V Val Valine W Trp Tryptophan Y Tyr Tyrosine

    [0289] Amino acid alterations such as amino acid substitutions may be introduced using known protocols of recombinant gene technology including PCR, gene cloning, site-directed mutagenesis of cDNA, transfection of host cells, and in vitro transcription which may be used to introduce such changes to the reference sequence resulting in an SHC/HAC enzyme variant. The enzyme variants can then be screened for SHC/HAC functional activity.

    [0290] Suitable sources of SHC/HAC enzymes are identified in table 2, 3 or 16. In an embodiment, suitable sources include, for example, Alicyclobacillus acidocaldarius (Aac), Zymomonas mobilis (Zmo), Bradyrhizobium japonicum (Bjp), Gluconobacter morbifer (Gmo), Burkholderia ambifaria, Bacillus anthracis, Methylococcus capsulatus, Frankia alni, Acetobacter pasteurianus (Apa), Thermosynechococcus elongatus (Tel), Streptomyces coelicolor (Sco), Rhodopseudomonas palustris (Rpa), Teredinibacter turnerae (Ttu), Pelobacter carbinolicus (Pca) or Syntrophotalea carbinolica DSM 2380, Bacillus megaterium (Bme), Streptomyces albolongus (Sal) and Tetrahymena pyriformis (see, for example WO 2010/139719, US 2012/01345477, WO 2012/066059, the contents of which are incorporated herein by reference).

    [0291] In particular, the SHC/HAC enzyme (e.g. from which the SHC/HAC enzyme variant may be derived) may be the Alicyclobacillus acidocaldarius (Aac) SHC/HAC enzyme, the Zymomonas mobilis SHC/HAC (ZmoSHC1) enzyme the Bradyrhizobium japonicum (Bjp or Bja) SHC/HAC enzyme or the Gluconobacter morbifer (Gmo) SHC/HAC enzyme or an Acetobacter pasteurianus SHC/HAC (ApaSHC1) enzyme or the Bacillus megaterium (Bme) SHC/HAC enzyme. In particular, the SHC/HAC enzyme (e.g. from which the SHC/HAC enzyme variant may be derived) may be the Alicyclobacillus acidocaldarius (Aac) SHC/HAC enzyme. This enzyme is represented by SEQ ID NO:1.

    [0292] For ease of reference, the designation AacSHC may be used to refer to the Alicyclobacillus acidocaldarius (Aac) SHC/HAC enzyme, ZmoSHC may be used to refer to the Zymomonas mobiis (Zmo) SH19HAC enzymes, BjpSHC or BjaSHC may be used to refer to the Bradyrhizobium japonicum (Bjp) SHC/HAC enzyme, ApaSHC may be used to refer to the Acetobacter pasteurianus (Apa) SHHAC enzymes, BmeSHC may be used to refer to Bacillus megaterium (Bme) SH18HAC enzyme, SaISH may be used to refer to the Streptomyces albolongus (Sal) SH92HAC enzyme and GmoSHC may be used to refer to the Gluconobacter morbifer (Gmo) SHmsHAC enzyme.

    [0293] AacSHC, ZmoSHC and BjpSHC enzyme sequences are disclosed in BASF WO 2010/139719, US 201201345477A1, Seitz et al (as cited above) and Seitz (2012 PhD thesis as cited above). Two different sequences are disclosed for ZmoSHC, referred to as ZmoSHC1 and ZmoSHC2. The Gino SHC/HAC enzyme sequence is disclosed in WO 2018/157021. The SaISHC enzyme is disclosed in Liu et al (2020): A Novel Soluble Squalene-Hopene Cyclase and Its Application in Efficient Synthesis of Hopene, Frontiers in Bioengineering and Biotechnology, vol 8, article 426, https:doi.orgal v.3389ifbioe.2020.00426).

    TABLE-US-00002 TABLE 2 Sources and accession numbers of wild-type (WT) SHC enzymes. SeqID Source organism NCBI Acc. Nr.- 69 Aspergillus fumigatus EDP50814.1 105 Bacillus subtilis AAB84441.1 19 Bacillus anthracis AAP27368.1 186 Geobacter sulfurreducens AAR34018.1 185 Geobacter sulfurreducens AAR36453.1 92 Bacillus cereus ATCC 10987 AAS42477.1 91 Bacillus cereus E33L AAU16998.1 96 Bacillus licheniformis DSM 13 AAU23777.1 13 Zymomonas mobilis subsp. mobilis ZM4 ATCC AAV90172.1 31821 191 Gluconobacter oxydans AAW61994.1 228 Cupriavidus pinatubonensis JMP134 AAZ64302.1 211 Nitrobacter winogradskyi ABA05523.1 65 Anabaena variabilis ABA24268.1 213 Nitrosococcus oceani ATCC 19707 ABA57818.1 30 Pelobacter carbinolicus or Syntrophotalea ABA87615.1 carbinolica DSM 2380 223 Syntrophotalea carbinolica DSM 2380 ABA87701.1 142 Burkholderia lata ABB06563.1 143 Burkholderia lata ABB10136.1 178 Geobacter metallireducens ABB30662.1 179 Geobacter metallireducens ABB33038.1 216 Nitrosospira multiformis ATCC 25196 ABB75845.1 238 Rhodospirillum rubrum ATCC 11170 ABC20867.1 236 Rhodopseudomonas palustris ABD06434.1 167 Frankia casuarinae ABD10207.1 237 Rhodopseudomonas palustris ABD87279.1 145 Burkholderia xenovorans LB400 ABE35912.1 209 Nitrobacter hamburgensis ABE63461.1 230 Ralstonia metallidurans ABF11015.1 231 Ralstonia metallidurans ABF11268.1 146 Candidatus Koribacter versatilis Ellin345 ABF40741.1 239 Rubrobacter xylanophilus DSM 9941 ABG05671.1 268 Trichodesmium erythraeum ABG50159.1 214 Nitrosomonas eutropha ABI59752.1 192 Granulibacter bethesdensis ABI63005.1 29 Burkholderia ambifaria ABI91648.1 31 Rhodopseudomonas palustris ABJ08391.1 148 Candidatus Solibacter usitatus Ellin6076 ABJ82180.1 149 Candidatus Solibacter usitatus Ellin6076 ABJ82254.1 33 Syntrophobacter fumaroxidans ABK17672.1 33 Syntrophobacter fumaroxidans ABK18414.1 58 Acidothermus cellulolyticus ABK53469.1 106 Bacillus thuringiensis str. Al Hakam ABK86448.1 224 Pelobacter propionicus DSM 2379 ABK98395.1 225 Pelobacter propionicus DSM 2379 ABK98811.1 135 Burkholderia mallei SAVP1 ABM48844.1 187 Geotalea uraniireducens Rf4 ABQ25226.1 270 Acidiphilium cryptum ABQ30890.1 16 Bradyrhizobium sp. ABQ33590.1 95 Bacillus cytotoxicus ABS22481.1 66 Anaeromyxobacter sp. ABS28257.1 75 Bacillus velezensis FZB42 ABS74269.1 100 Bacillus pumilus SAFR-032 ABV62529.1 169 Frankia sp. ABW14125.1 168 Frankia sp. ABW15063.1 246 Acaryochloris marina ABW29816.1 137 Burkholderia multivorans ATCC 17616 ABX16859.1 136 Burkholderia multivorans ATCC 17616 ABX19650.1 114 Bacillus mycoides KBAB4 ABY44436.1 205 Methylobacterium sp. ACA20611.1 253 Streptomyces peucetius subsp. caesius ATCC ACA52082.1 27952 128 Burkholderia cenocepacia ACA95661.1 204 Methylobacterium radiotolerans ACB27373.1 155 Crocosphaera subtropica ATCC 51142 ACB53858.1 125 Burkholderia ambifaria MC40-6 ACB68303.1 203 Methylobacterium populi ACB79998.1 116 Beijerinckia indica subsp. indica ATCC 9039 ACB96717.1 138 Burkholderia phymatum ACC73258.1 217 Nostoc punctiforme PCC 73102 ACC84529.1 139 Burkholderia phytofirmans PsJN ACD21317.1 198 Methylacidiphilum infernorum ACD82457.1 177 Geobacter lovleyi ACD95949.1 234 Rhodopseudomonas palustris ACF02757.1 176 Geobacter bemidjiensis ACH40355.1 57 Acidithiobacillus ferrooxidans ACH84004.1 189 Gluconacetobacter diazotrophicus ACI51585.1 219 Afipia carboxidovorans ACI93782.1 206 Methylocella silvestris ACK52150.1 158 Rippkaea orientalis PCC 8801 ACK66841.1 156 Gloeothece citriformis PCC 7424 ACK71719.1 199 Methylorubrum extorquens CM4 ACK83067.1 200 Methylorubrum extorquens ACK86232.1 93 Bacillus cereus G9842 ACK95843.1 161 Cyanothece sp. PCC 7425 ACL45896.1 202 Methylobacterium nodulans ACL61886.1 180 Geotalea daltonii FRC-32 ACM21577.1 182 Geotalea daltonii FRC-32. ACM22003.1 34 Teredinibacter turnerae ACR13362.1 133 Burkholderia glumae BGR1 ACR30752.1 132 Burkholderia glumae BGR1 ACR32572.1 221 Paenibacillus sp. JDR-2 ACS99948.1 184 Geobacter sp. M21 ACT16952.1 150 Catenulispora acidiphila DSM 44928 ACU75510.1 240 Saccharomonospora viridis DSM 43017 ACU97316.1 162 Rippkaea orientalis PCC 8802 ACV02092.1 243 Sphaerobacter thermophilus DSM 20745 ACZ39437.1 309 Komagataeibacter xylinus E25 AHI26287.1 278 Bacillus thuringiensis AJI35613.1 286 Komagataeibacter nataicola AQU88860.1 267 Synechocystis sp. PCC 6803 BAA17978.1 218 Nostoc sp. PCC 7120 BAB72732.1 23 Thermosynechococcus elongatus BAC09861.1 245 Streptomyces avermitilis NBRC 14893 BAC69361.1 188 Gloeobacter violaceus PCC 7421 BAC91998.1 74 Aspergillus oryzae BAE63941.1 59 Adiantum capillus-veneris BAF93209.1 251 Streptomyces griseus ATCC 53653 BAG17791.1 164 Dryopteris crassirhizoma BAG68223.1 122 Brevibacillus brevis NBRC 100599 BAH44778.1 120 Acetobacter pasteurianus IFO 3283-01 BAH98349.1 24 or 27 Acetobacter pasteurianus BAH99456.1 227 Goniophlebium niponicum BAI48070.1 226 Goniophlebium niponicum BAI48071.1 119 Bradyrhizobium japonicum CAA60250.1 64 Alicyclobacillus acidoterrestris CAA61950.1 207 Methylococcus capsulatus CAA71098.1 235 Rhodopseudomonas palustris CAA71101.1 32 Streptomyces coelicolor CAB39697.1 233 Rhodopirellula baltica CAD74517.1 166 Frankia alni ACN14a CAJ60090.1 165 Frankia alni ACN14a CAJ61140.1 147 Candidatus Kuenenia stuttgartiensis CAJ71215.1 229 Cupriavidus necator H16 CAJ96989.1 72 Aspergillus niger CAK43501.1 121 Bradyrhizobium sp. ORS 278 CAL79893.1 241 Saccharopolyspora erythraea NRRL 2338 CAM03596.1 190 Gluconacetobacter diazotrophicus CAP55563.1 154 Cupriavidus taiwanensis LMG 19424 CAQ72562.1 130 Burkholderia cenocepacia J2315 CAR56694.1 129 Burkholderia cenocepacia J2315 CAR57099.1 201 Methylobacterium extorquens CAX24364.1 255 Streptomyces scabiei CBG68454.1 284 Gluconacetobacter xylinus CUW48332.1 287 Komagataeibacter xylinus AHI26287.1 77 Bacillus cereus G9241 EAL12758.1 70 Aspergillus fumigatus EAL84865.1 71 Aspergillus fumigatus EAL86291.2 153 Crocosphaera watsonii WH 8501 EAM53094.1 210 Nitrobacter sp. EAQ34404.1 118 Blastopirellula marina DSM 3645 EAQ78122.1 117 Blastopirellula marina DSM 3645 EAQ81955.1 212 Nitrococcus mobilis EAR22397.1 102 Bacillus sp. NRRL B-14911 EAR64404.1 67 Aspergillus clavatus EAW07713.1 208 Neosartorya fischeri NRRL 181 EAW20752.1 195 Leptospirillum rubarum. EAY57382 127 Burkholderia cenocepacia PC184 EAY66961.1 131 Burkholderia dolosa AU0158 EAY71311.1 160 Crocosphaera chwakensis EAZ91809.1 103 Bacillus sp. SG-1 EDL66148.1 69 Aspergillus fumigatus EDP50814.1 220 Paenibacillus sp. EDS49994.1 123 Burkholderia ambifaria IOP40-10 EDT05097.1 134 Burkholderia graminis C4D1M EDT12320.1 124 Burkholderia ambifaria MEX-5 EDT37649.1 126 Burkholderia ambifaria MEX-5 EDT42454.1 181 Geobacter sp. M21 EDV72707.1 101 Bacillus pumilus ATCC 7061 EDW21137.1 256 Streptomyces sp. EDX25760.1 265 Synechococcus sp. PCC 7335 EDX84551.1 159 Cyanothece sp. PCC 7822 EDX97382.1 157 Cyanothece sp. PCC 8802 EDY02410.1 173 Geobacillus thermodenitrificans EDY05760.1 151 Chthoniobacter flavus Ellin428 EDY15838.1 152 Chthoniobacter flavus Ellin428 EDY22035.1 257 Streptomyces sp. EDY46371.1 263 Streptomyces sviceus ATCC 29083 EDY55942.1 254 Streptomyces pristinaespiralis ATCC 25486 EDY61772.1 196 Leptospirillum sp. EDZ38599.1 141 Burkholderia sp. H160 EEA03553.1 242 Schizosaccharomyces japonicus EEB08219.1 140 Burkholderia pseudomallei EEC32728.1 163 Desulfovibrio salexigens DSM 2638 EEC62384.1 62 Alicyclobacillus acidocaldarius LAA1 EED08231.1 68 Aspergillus flavus EED48353.1 172 Geobacillus sp. EED61885.1 115 Pedosphaera parvula Ellin514 EEF59508.1 61 Histoplasma capsulatum G186AR EEH02950.1 79 Bacillus cereus m1293 EEK43841.1 76 Bacillus wiedmannii EEK66523.1 82 Bacillus cereus EEK77935.1 80 Bacillus cereus EEK82938.1 84 Bacillus cereus m1550 EEK88307.1 81 Bacillus cereus EEK99528.1 78 Bacillus cereus Rock3-42 EEL44583.1 90 Bacillus cereus Rock3-44 EEL49968.1 86 Bacillus cereus Rock4-18 EEL59884.1 85 Bacillus cereus F65185 EEL63943.1 88 Bacillus cereus EEL69857.1 83 Bacillus cereus EEL81079.1 89 Bacillus cereus AH1273 EEL92663.1 97 Bacillus mycoides DSM 2048 EEL98438.1 98 Bacillus pseudomycoides EEM04821.1 99 Bacillus pseudomycoides DSM 12442 EEM16144.1 107 Bacillus thuringiensis serovar tochigiensis BGSC EEM21409.1 4Y1 110 Bacillus thuringiensis Bt407 EEM27851.1 111 Bacillus thuringiensis serovar sotto str. T04001 EEM40716.1 112 Bacillus thuringiensis serovar pakistani str. EEM46814.1 T13001 109 Bacillus thuringiensis serovar kurstaki str. EEM52372.1 T03a001 108 Bacillus thuringiensis serovar huazhongensis EEM82653.1 BGSC 4BD1 113 Bacillus thuringiensis IBL 200 EEM94969.1 174 Geobacillus sp. Y412MC52 EEN95021.1 175 Geobacillus sp. Y412MC61 ACX79399.1 60 Histoplasma capsulatum H143 EER40510.1 308 Zymomonas mobilis EER62728.1 194 Leptospirillum ferrodiazotrophum EES53667.1 222 Paenibacillus sp. oral taxon 786 EES74793.1 56 Acidithiobacillus caldus EET25937.1 215 Nitrosomonas sp. AL212 EET32702.1 183 Geobacter sp. M18 EET34621.1 193 Hyphomicrobium denitrificans ATCC 51888 EET65847.1 248 Streptomyces flavogriseus ATCC 33331 EEW70811.1 144 Burkholderia sp. CCGE1002 EFA54357.1 171 Frankia sp. Eullc EFA59089.1 170 Frankia sp. Eullc EFA59873.1 285 Gluconobacter frateurii NBRC 103465 GAD08844.1 272 Acetobacter orleanensis JCM 7639 GAN69910.1 272 Acetobacter orleanensis JCM 7639 GAN69910.1 293 Thermoactinomyces sp. Gus2-1 KFZ40906.1 285 Gluconobacter frateurii NBRC 103465 GAD08844.1 295 Alicyclobacillus acidocaldarius P33247.4 232 Rhizobium sp. P55348.1 271 Acetobacter fabarum PAK78064.1 104 Bacillus subtilis Q796C3.1 277 Bacillus subtilis WP_004399534.1 288 Methylacidiphilum fumariolicum WP_009061034.1 289 Methylococcus capsulatus WP_010960137.1 23 Thermosynechococcus elongatus WP_011058142.1 294 Zymomonas mobilis WP_011241313.1 29 Syntrophobacter fumaroxidans WP_011698842.1 274 Acidothermus cellulolyticus WP_011720532.1 275 Alicyclobacillus acidocaldarius WP_012811690.1 273 Acetobacter pasteurianus WP_012812952.1 290 Sphaerobacter thermophiles WP_012872483.1 276 Bacillus megaterium WP_013083001.1 280 Chloracidobacterium thermophilum WP_014100779.1 292 Teredinibacter turnerae WP_015819476.1 281 Cohnella thermotolerans WP_027091823.1 279 Brevibacillus thermoruber WP_029099368.1 282 Geobacillus thermodenitrificans WP_029761705.1 310 Geobacillus vulcani WP_031409036 283 Geobacillus sp. WP_031409036.1 197 Magnetospirillum magnetotacticum ZP_00052068.2 269 Verrucomicrobium spinosum DSM 4136 ZP_02925563.1 94 Bacillus coahuilensis ZP_03226483.1 249 Streptomyces ghanaensis ATCC 14672 ZP_04684415.1 247 Streptomyces roseosporus NRRL 15998 ZP_04697579.1 244 Streptomyces albus ZP_04706071.1 261 Streptomyces sp. SPB74 ZP_04995097.1 260 Streptomyces sp. Mg1 ZP_05001249.1 266 Synechococcus sp. PCC 7335 ZP_05035816.1 258 Streptomyces sp. AA4 ZP_05479203.1 262 Streptomyces sp. SPB78 ZP_05490781.1 259 Streptomyces sp. ZP_05510126.1 252 Streptomyces lividans ZP_05522220.1 264 Streptomyces viridochromogenes DSM 40736 ZP_05535608.1 250 Streptomyces griseoflavus ZP_05537325.1 307 Gluconobacter morbifer EHH69691.1 55 Acetobacter pasteurianus IFO 3283-01 63 Alicyclobacillus acidocaldarius AAT70690.1 73 Aspergillus niger CAK45506.1 87 Bacillus cereus Rock4-18 EEL59884.2

    TABLE-US-00003 TABLE 3 Sources and accession numbers of preferred wild-type (WT) SHC enzymes. SEQ ID No. according to Reference WO 2010139719 (and incorporated US2012/0135477 (*) SHC Source Strain herein by or to the present (SHC name) reference) Accession No. disclosure (**) Alicyclobacillus acidocaldarius JP2009-060799 NBRC15652 SEQ ID No: 1 ** (AacSHC) (Kao) Neumann et al Biol Chem (1986) 367; 723-729 Zymomonas mobilis (ZmoSHC1) WO2010139719 ATCC31821 SEQ ID No. 1 * US20120135477 PF62207_2 SEQ ID NO: 13 ** Genpept SEQ ID No. 2 * Accession No. SEQ ID NO: 14 ** AAV90172 AAF12829.1 AVZ42714.1 Zymomonas mobilis (ZmoSHC2) Reipen et al (1995) EMBL/Genbank SEQ ID No. 15 ** Microbiology Accession No. 141: 155-161 X80766 Bradryhizobium japonicum (BjpSHC WO2010139719 PF62207_5 SEQ ID No. 5 * or BjaSHC) US2012/0135477 ABQ33590.1 SEQ ID NO: 16 ** Burkholderia ambifaria WO2010139719 SEQ ID No. 6 * US2012/0135477 SEQ ID NO: 17 ** Burkholderia ambifaria WO2010139719 SEQ ID No. 7 * US2012/0135477 SEQ ID NO: 18 ** Bacillus anthracis WO2010139719 SEQ ID No. 8 * US2012/0135477 SEQ ID NO: 19 ** Frankia alni WO2010139719 SEQ ID No. 9 * US2012/0135477 SEQ ID NO: 20 ** Rhodopseudomonas palustris WO2010139719 SEQ ID No. 10 * US2012/0135477 SEQ ID NO: 21 ** Gluconobacter morbifer (WT WO2018157021 EHH69691.1 SEQ ID NO: 22 ** GmoSHC) Thermosynechococcus elongatus BAC09861.1 SEQ ID NO: 23 ** (TelSHC) Acetobacter pasteurianus ASC07046.1 SEQ ID NO: 24 ** (ApaSHC1) Bacillus megaterium (BmeSHC) WP_016763969 SEQ ID NO: 25 ** Streptomyces albolongus SalSHC) AZN28579 SEQ ID NO: 26 ** Acetobacter pasteurianus WP_003625617 SEQ ID NO: 27 ** ApaSHCA) Burkholderia ambifaria BamSHC1) AJY25620.1 SEQ ID NO: 28 ** Burkholderia ambifaria (BamSHC2) ABI91648.1 SEQ ID NO: 29 ** Pelobacter carbinolicus (PcaSHC2) ABA87615.1 SEQ ID NO: 30 ** or Syntrophotalea carbinolica DSM 2380 Rhodopseudomonas palustris ABJ08391.1 SEQ ID NO: 31 ** (RpaSHC1) Streptomyces coelicolor (ScoSHC) CAB39697.1 SEQ ID NO: 32 ** Syntrophobacter fumaroxidans ABK17672.1 SEQ ID NO: 33 ** (SfuSHC) Teredinibacter turnerae (TtuSHC) ACR13362.1 SEQ ID NO: 34 **

    [0294] The sequences of the wild-type AacSHC, wild-type ZmoSHC1, wild-type ZmoSHC2, wild-type BjpSHC, wild-type GmoSHC, wild-type TeISHC and wild-type ApaSHC1, wild-type BmeSHC, wild-type SaISHC and wild-type ApaSHCA, are also disclosed herein in table 3.

    [0295] Most preferred wild-type SHC are: AacSHC (SEQ ID NO: 1) or ZmoSHC1 represented by SEQ ID NO:13 or ZmoSCH2 represented by SEQ ID NO:15 or Tel SHC represented by SEQ ID NO:23 or ScoSHC represented by SEQ ID NO:32.

    [0296] An alignment of WT SHC sequences prepared by Hoshino and Sato (2002 as cited above) indicates that multiple motifs were detected and consists of the core sequence Gln-X-X-X-Gly-X-Trp which is found six times in the SHC sequences of both Z. mobilis and A. acidocaldarius (See FIG. 3 of Reipen et al 1995, Microbiology 141, 155-161) (X can be any amino acid). Hoshino and Sato (2002 as cited above) report that aromatic amino acids are unusually abundant in SHCs and that two characteristic motifs were noted in the SHCs: one is a QW motif represented by specific amino acid motifs [(K/R)(G/A)X2-3(F/Y/W)(L/IV)3X3QX2-5GXW] and the alternative is a DXDDTA motif (SEQ ID NO:314) Wendt et al (1997, Science 277, 1811-1815 and 1999, J Mol Biol 286, 175-187) reported on the X-ray structure analysis of A. acidocaldarius SHC (X can be any amino acid). The DXDDTA motif appears to correlate with the SHC active site.

    [0297] A reference AacSHC protein as used herein may refer to the wild-type AacSHC protein as disclosed in SEQ ID NO: 1. AacSHC has the activity of a homofarnesol Ambrox cyclase (HAC) useful in the production of Ambrox derivatives through a biocatalytic reaction of SHC with a homofarnesol substrate. The main reaction of the AacSHC is the cyclisation of a linear or a non-linear substrate such as homofarnesol to produce Ambrox.

    [0298] Another reference AacSHC protein is SHC/AHC enzyme 215G2 SHC or 215G2 SHC as disclosed in SEQ ID NO: 3. SEQ ID NO:3 corresponds to SEQ ID NO:1 with the mutations M132R, A224V and 1432T.

    [0299] Another reference AacSHC protein is SHC/AHC enzyme variant #65 as disclosed in SEQ ID NO: 2. SEQ ID NO:2 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, 1432T, A557T and R613S and may be referred to as SHC/HAC enzyme variant #65 or SHC #65 variant herein.

    [0300] The wording functional homologs may be replaced by functional equivalents or by homologs.

    [0301] Functional homologs of the wild-type SHC/HAC enzymes or the SHC/HAC enzyme variants described herein are also suitable for use in cyclization reactions, for example for producing ()-Ambrox, for example in a recombinant host. Thus, the recombinant host may include one or more heterologous nucleic acid(s) encoding functional homologs of the polypeptides described above and/or a heterologous nucleic acid encoding a SHC/HAC derivative enzyme as described herein.

    [0302] A functional homolog is a polypeptide that has sequence identity and optionally sequence similarity to a reference polypeptide, and that carries out one or more of the biochemical or physiological function(s) of the reference polypeptide. A functional homolog and the reference polypeptide may be natural occurring polypeptides, and the sequence identity and optionally sequence similarity may be due to convergent or divergent evolutionary events. As such, functional homologs are sometimes designated in the literature as homologs, or orthologs, or paralogs. Variants of a naturally occurring functional homolog, such as polypeptides encoded by mutants of a wild-type coding sequence, may themselves be functional homologs. Functional homologs can also be created via site-directed mutagenesis of the coding sequence for a polypeptide, or by combining domains from the coding sequences for different naturally-occurring polypeptides (domain swapping). Techniques for modifying genes encoding functional homologs described herein are known and include, inter alia, directed evolution techniques, site-directed mutagenesis techniques and random mutagenesis techniques, and can be useful to increase specific activity of a polypeptide, alter substrate specificity, alter expression levels, alter subcellular location, or modify polypeptide:polypeptide interactions in a desired manner. Such modified polypeptides are considered functional homologs. The term functional homolog is sometimes applied to the nucleic acid that encodes a functionally homologous polypeptide.

    [0303] Functional homologs can be identified by analysis of nucleotide and polypeptide sequence alignments. For example, performing a query on a database of nucleotide or polypeptide sequences can identify homologs of the nucleic acid sequences encoding the SHC derivative polypeptides and the like.

    [0304] Hybridization can also be used to identify functional homologs and/or as a measure of homology between two nucleic acid sequences. A nucleic acid sequence encoding any of the proteins disclosed herein, or a portion thereof, can be used as a hybridization probe according to standard hybridization techniques. The hybridization of a probe to DNA or RNA from a test source (e.g. a mammalian cell) is an indication of the presence of the relevant DNA or RNA in the test source.

    [0305] Hybridization conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y., 6.3.1-6.3.6, 1991. Moderate hybridization conditions are defined as equivalent to hybridization in 2 sodium chloride/sodium citrate (SSC) at 30 C. followed by a wash in 1SSC, 0.1% SDS at 50 C. Highly stringent conditions are defined as equivalent to hybridization in 6 sodium chloride/sodium citrate (SSC) at 45 C. followed by a wash in 0.2SSC, 0.1% SDS at 65 C. Sequence analysis to identify functional homologs can also involve BLAST, Reciprocal BLAST, or PSI-BLAST analysis of non-redundant databases using a relevant amino acid sequence as the reference sequence. Amino acid sequence is, in some instances, deduced from the nucleotide sequence. Those polypeptides in the database that have greater than 40% sequence identity are candidates for further evaluation for suitability for use in the SHC/HAC bioconversion reaction. Amino acid sequence similarity allows for conservative amino acid substitutions, such as substitution of one hydrophobic residue for another or substitution of one polar residue for another. If desired, manual inspection of such candidates can be carried out in order to narrow the number of candidates to be further evaluated. Manual inspection can be performed by selecting those candidates that appear to have for e.g. conserved functional domains.

    [0306] Typically, polypeptides that exhibit at least about 30% amino acid sequence identity are useful to identify conserved regions. Conserved regions of related polypeptides exhibit at least 30%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, amino acid sequence identity. In some embodiments, a conserved region exhibits at least, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% amino acid sequence identity. Sequence identity can be determined as set forth above and below. Usually in this context, a region may comprise from 5 to 50 amino acids or from 10 to 150 or from 10 to 80 or from 10 to 100 amino acids.

    [0307] The SHC/HAC enzymes or enzyme variants described herein and used in the methods described herein may, for example, be based on an amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310 or of any of SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 or a variant, homologue, mutant, derivative or fragment thereof.

    [0308] In addition, the produced reference SHC enzyme may be based on an amino acid sequence produced from E. coli.

    [0309] Percent (%) identity with respect to the nucleotide sequence of a gene is defined as the percentage of nucleotides in a candidate DNA sequence that is identical with the nucleotides in the DNA sequence, after aligning the sequence and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent nucleotide sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. The terms polypeptide and protein are used interchangeably herein and mean any peptide-linked chain of amino acids, regardless of length or post-translational modification.

    [0310] As used herein the term derivative includes but is not limited to a variant. The terms derivative and variant are used interchangeably herein.

    [0311] In preferred embodiments, a variant enzyme usable in the present disclosure exhibits a total number of up to 200 (up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200) changes (alterations) in the amino acid sequence (i.e. exchanges, insertions, deletions, N-terminal truncations, and/or C-terminal truncations). The amino acid exchanges may be conservative and/or non-conservative. In preferred embodiments, a variant usable in the present disclosure differs from the protein or domain from which it is derived by up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acid exchanges, preferably conservative amino acid changes. Variants may additionally or alternatively comprise deletions of amino acids, which may be N-terminal truncations, C-terminal truncations or internal deletions or any combination of these. Such variants comprising N-terminal truncations, C-terminal truncations and/or internal deletions are referred to as deletion variants or fragments in the context of the present application. The terms deletion variant and fragment are used interchangeably herein. A deletion variant may be naturally occurring (e.g. splice variants) or it may be constructed artificially, preferably by gene-technological means. Typically, the protein or protein domain from which the deletion variant is derived is a wild-type protein. However, the deletion variants of the present disclosure may also be derived from homologs, orthologs, or paralogs of the parent polypeptide or from artificially constructed variants, provided that the deletion variants exhibit at least one biological activity of the parent polypeptide. Preferably, a deletion variant (or fragment) has a deletion of up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids at its N-terminus and/or at its C-terminus and/or internally as compared to the parent polypeptide.

    [0312] In certain embodiments, the SHC/HAC enzyme variants described herein only include substitutions and do not include any deletions or insertions.

    [0313] A variant as used herein, can alternatively or additionally be characterised by a certain degree of sequence identity or similarity to the parent polypeptide from which it is derived. A variant of the WT/reference SHC/HAC or the SHC/HAC Derivative of the present disclosure may have a sequence identity of at least 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to the respective reference polypeptide or to the respective reference polynucleotide.

    [0314] The expression at least 30%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity is used throughout the specification with regard to polypeptide and polynucleotide sequence comparisons. A polynucleotide belonging to a family of any of the enzymes disclosed herein or a protein can be identified based on its similarity to the relevant gene or protein, respectively. For example, the identification can be based on sequence identity. In certain preferred embodiments the disclosure features isolated nucleic acid molecules which are at least 30%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to (a) a nucleic acid molecule that encodes the polypeptide of a wild-type SHC/HAC enzyme (e.g. SEQ ID NO: 1, SEQ ID NO:13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310 or any other SHC/HAC disclosed in table 2, 3 or 16 disclosed herein (b) the nucleotide sequence SEQ ID NO: 35 and (c) a nucleic acid molecule which includes a segment of at least 30 (e.g. at least 30, 40, 50, 60, 80, 100, 125, 150, 175, 200, 250, 300, 400, 500, 600, 700, 800, 850, 900, 950, 1000, or 1010) nucleotides of SEQ ID NO: 35 (or a nucleotide sequence encoding a SHC/HAC enzyme as disclosed in table 2, 3 or 16).

    [0315] Preferably, the polypeptide in question and the reference polypeptide exhibit the indicated sequence identity or similarity over a continuous stretch of 20, 30, 40, 45, 50, 60, 70, 80, 90, 100 or more amino acids. Preferably, the polynucleotide in question and the reference polynucleotide exhibit the indicated sequence identity over a continuous stretch of 60, 90, 120, 135, 150, 180, 210, 240, 270, 300 or more nucleotides. In case where two sequences are compared and the reference sequence is not specified in comparison to which the sequence identity percentage is to be calculated, the sequence identity is to be calculated with reference to the longer of the two sequences to be compared, if not specifically indicated otherwise. If the reference sequence is indicated, the sequence identity is determined on the basis of the full length of the reference sequence (e.g. SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310 and any SHC/HAC enzyme as disclosed in table 2, 3 or 16) if not specifically indicated otherwise.

    [0316] For example, a peptide sequence consisting of 130 amino acids compared to the amino acids of full length of wild-type AacSHC with 631 amino acid residues may exhibit a maximum sequence identity percentage of 20.6% (130/631100) while a sequence with a length of 300 amino acids may exhibit a maximum sequence identity percentage of 47.5% (300/631100).

    [0317] The identity of nucleotide and amino acid sequences, i.e. the percentage of sequence identity, can be determined via sequence alignments. Such alignments can be carried out with several art-known algorithms, preferably with the mathematical algorithm of Karlin and Altschul (Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5877), with hmmalign (HMMER package, http://hmmer.wustl.edu/) or with the CLUSTAL algorithm (Thompson, J. D., Higgins, D. G. & Gibson, T. J. (1994) Nucleic Acids Res. 22, 4673-80) available e.g. on https://www.ebi.ac.uk/Tools/msa/clustalo/or the GAP program (mathematical algorithm of the University of Iowa) or the mathematical algorithm of Myers and Miller (1989Cabios 4: 11-17) or Clone Manager 9. Preferred parameters used are the default parameters as they are set on https://www.ebi.ac.uk/Tools/msa/clustalo/.

    [0318] The grade of sequence identity (sequence matching) may be calculated using e.g. BLAST, BLAT or BlastZ (or BlastX). A similar algorithm is incorporated into the BLASTN and BLASTP programs of Altschul et al (1990) J. Mol. Biol. 215, 403-410. BLAST polynucleotide searches are performed with the BLASTN program, score=100, word length=12, to obtain polynucleotide sequences that are homologous to those nucleic acids which encode the relevant protein.

    [0319] BLAST protein searches are performed with the BLASTP program, score=50, word length=3, to obtain amino acid sequences homologous to the SHC polypeptide. To obtain gapped alignments for comparative purposes, Gapped BLAST is utilized as described in Altschul et al (1997) Nucleic Acids Res. 25, 3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs are used. Sequence matching analysis may be supplemented by established homology mapping techniques like Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19 Suppl 1: 154-162) or Markov random fields. When percentages of sequence identity are referred to in the present application, these percentages are calculated in relation to the full length of the longer sequence, if not specifically indicated otherwise.

    [0320] In particular embodiments, % identity between two sequences is determined using CLUSTAL O (version 1.2.4).

    [0321] In an embodiment, similarity means the degree of sequence relatedness between amino acid sequences, as the case may be, as determined by the match between strings of such sequences.

    [0322] Similarity between two amino acid sequences is determined by comparing the amino acid sequence and its conserved amino acid substitutes of one polypeptide to the sequence of a second polypeptide. Identity and similarity can be readily calculated by known methods, including but not limited to those described in (Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heine, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math., 48:1073 (1988).

    [0323] Preferred parameters for polypeptide sequence comparison include the following: Algorithm: Needleman and Wunsch, J. Mol. Biol. 48:443-453 (1970); Comparison matrix: BLOSSUM62 from Hentikoff and Hentikoff, Proc. Natl. Acad. Sci. USA. 89:10915-10919 (1992); Gap Penalty: 12; and Gap Length Penalty: 4. A program useful with these parameters is publicly available as the Ogap program from Genetics Computer Group, located in Madison, WI. The aforementioned parameters are the default parameters for amino acid comparisons (along with no penalty for end gaps).

    [0324] Optionally, in determining the degree of amino acid similarity, the skilled person may also take into account so-called conservative amino acid substitutions, as will be clear to the skilled person. Similarity between two amino acid sequences is determined by comparing the amino acid sequence and its conserved amino acid substitutes of one polypeptide to the sequence of a second polypeptide. As used herein, conservative amino acid substitutions refer to the interchangeability of residues having similar side chains. Examples of classes of amino acid residues for conservative substitutions are given in the Tables below.

    TABLE-US-00004 TABLE 4 Classes of amino acid residues Acidic Residues Asp (D) and Glu (E) Basic Residues Lys (K), Arg (R), and His (H) Hydrophilic Uncharged Ser (S), Thr (T), Asn (N), and Residues Gln (Q) Aliphatic Uncharged Gly (G), Ala (A), Val (V), Leu (L), Residues and Ile (I) Non-polar Uncharged Residues Cys (C), Met (M), and Pro (P) Aromatic Residues Phe (F), Tyr (Y), and Trp (W)

    TABLE-US-00005 TABLE 5 Alternative conservative amino acid residue substitution classes 1 A S T 2 D E 3 N Q 4 R K 5 I L M 6 F Y W

    TABLE-US-00006 TABLE 6 Alternative physical and functional classifications of amino acid residues Alcohol group-containing residues S and T Aliphatic residues I, L, V, and M Cycloalkenyl-associated residues F, H, W, and Y Hydrophobic residues A, C, F, G, H, I, L, M, R, T, V, W, and Y Negatively charged residues D and E Polar residues C, D, E, H, K, N, Q, R, S, and T Positively charged residues H, K, and R Small residues A, C, D, G, N, P, S, T, and V Very small residues A, G, and S Residues involved in turn A, C, D, E, G, H, K, N, Q, R, formation S, P and T Flexible residues Q, T, K, S, G, P, D, E, and R

    [0325] For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulphur-containing side chains is cysteine and methionine. Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine. Substitutional variants of the amino acid sequence disclosed herein are those in which at least one residue in the disclosed sequences has been removed and a different residue inserted in its place. Preferably, the amino acid change is conservative. Preferred conservative substitutions for each of the naturally occurring amino acids are as follows: Ala to Ser; Arg to Lys; Asn to Gln or His; Asp to Glu; Cys to Ser or Ala; Gln to Asn; Glu to Asp; Gly to Pro; His to Asn or Gln; Ile to Leu or Val; Leu to lie or Val; Lys to Arg; Gln or Glu; Met to Leu or lie; Phe to Met, Leu or Tyr; Ser to Thr; Thr to Ser; Trp to Tyr; Tyr to Trp or Phe; and, Val to lie or Leu.

    [0326] Specific SHC/HAC enzymes and enzymes variants that may be used in the methods described herein are further described below.

    Variants of SHC/HAC with New Mutations

    [0327] It has surprisingly been found that SHC/HAC enzyme variants derived from Aac SHC/HAC enzyme (SEQ ID NO:1) or from variants of said Aac SHC/HAC enzyme (SEQ ID NO:2 or SEQ ID NO:3) or derived from other wild type SHC as identified herein (such as those identified in table 2, 3 or 16 especially such as those represented by SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310) or derived from other variants (such as those represented by SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54) and those disclosed in Table 14 of WO2016/170099 and/or Table 6 of WO2021/110848 (as provided below as represented by SEQ ID NO: 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383) exhibit modified/optimised activities/biological activities as earlier defined herein and as further demonstrated in the experimental part.

    [0328] SEQ ID NO:3 corresponds to SEQ ID NO:1 with the amino acid alterations (substitutions) M132R, A224V and 1432T.

    [0329] SEQ ID NO:2 corresponds to SEQ ID NO: 1 with the amino acid alterations (substitutions) M132R, A224V, 1432T, A557T and R613S.

    [0330] In an embodiment, the new SHC/HAC enzyme variants derived from SEQ ID NO:2 or 3 still comprise the amino acid alterations (substitutions) they had compared to SEQ ID NO:1. These amino acid alterations are the following: [0331] Variant derived from SEQ ID NO:3 may comprise the following amino acid alterations (substitutions): M132R, A224V and 1432T compared to SEQ ID NO:1, [0332] Variant derived from SEQ ID NO:2 may comprise the following amino acid alterations (substitutions): M132R, A224V, 1432T, A557T and R613S compared to SEQ ID NO:1, [0333] Variant derived from SEQ ID NO:2 may comprise the following amino acid alterations (substitutions): M132R and 1432T compared to SEQ ID NO:1, [0334] Variant derived from SEQ ID NO:2 may comprise the following amino acid alterations (substitutions): M132R and 1432T, A557T and R613S compared to SEQ ID NO:1.

    [0335] Variant derived from any one of the sequences listed in Table 14 of WO2016/170099 including but not limited to SEQ ID No. 5, 7, 9, 11, 13, 15, 17, 19, 171, 23, 25, 27, 29, 31, 33, 35, 37 or 39 (corresponding to SEQ ID NO:361-368, 378, 3, 369-377 of the present application respectively). (see table 7 below and sequences disclosed at the end of the experimental part) Variants derived from any one of the sequences listed in Table 6 of WO2021/110848 including but not limited to SEQ ID No. 5, 17, 18, 2 or 4 (see table 8 below and sequences disclosed at the end of the experimental part).

    TABLE-US-00007 TABLE 7 corresponding to Table 14 of WO 2016/170099: AacSHC Derivative amino acid and nucleotide SEQ ID No. SHC Deriva- Nucleotide Amino acid tive SEQ ID SEQ ID No. Mutation (s) name No. SEQ ID No. 5 T77A 6 SEQ ID No. 7 I92V 8 SEQ ID No. 9 F129L 10 SEQ ID No. 11 M132R 12 SEQ ID No. 13 A224V 14 SEQ ID No. 15 I432T 16 SEQ ID No. 17 Q579H 18 SEQ ID No. 19 F601Y 20 SEQ ID No. 171 F605W 170 SEQ ID No. 21 M132R + A224V + I432T 215G2 22 SEQ ID No. 23 M132R + I432T SHC26 24 SEQ ID No. 25 F601Y SHC3 26 SEQ ID No. 27 T77A + I92V + F129L 111C8 28 SEQ ID No. 29 Q579H + F601Y 101A10 30 SEQ ID No. 31 F129L SHC10 32 SEQ ID No. 33 F129L + F601Y SHC30 34 SEQ ID No. 35 F129L + M132R + I432T SHC31 36 SEQ ID No. 37 M132R + I432T + F601Y SHC32 38 SEQ ID No. 39 F129L + M132R + I432T + SHC33 40 F601Y

    TABLE-US-00008 TABLE 8 corresponding to Table 6 of WO2021/110848. Mutations in selected new SHC variant enzymes. SHC Variant Y81H T90A A172T M277K H431L A557T R613S 110B8 + + + (SEQ ID NO: 5) 90C7 + + (SEQ ID NO: 17) 115A7 + + (SEQ ID NO: 18) SHC 49 + + (SEQ ID NO: 2) SHC 65 + + (SEQ ID NO: 3) SHC 66 + + + (SEQ ID NO: 4) Note: these mutations appear in addition to the mutations present in 215G2 SHC: M132R, A224V, and I432T. SEQ ID NO: 2, 3, 4, 5, 17 and 18 of table 8 correspond to SEQ ID NO: 379, 2, 380, 381, 382 and 383.

    [0336] Sequences identified in tables 7 and 8 above are represented by any of SEQ ID NO: 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 in the sequence listing and as indicated at the end of the experimental part.

    [0337] In certain embodiments, the SHC/HAC enzyme variant may have equal to or less than about 30 amino acid alterations compared to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383. For example, the SHC/HAC enzyme variant may have equal to or less than about 25 or equal to or less than about 20 or equal to or less than about 15 or equal to or less than about 10 or equal to or less than about 9 or equal to or less than about 8 or equal to or less than about 7 or equal to or less than about 6 amino acid alterations compared to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383. For example, the SHC/HAC enzyme variant may have at least about 5 or at least about 6 amino acid alterations compared to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55. 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383. The amino acid alterations may, for example, be insertions, deletions and/or substitutions as described above.

    [0338] In certain embodiments, the only amino acid alterations in the SHC/HAC enzyme variant compared to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 are substitutions (i.e. there are no insertions or deletions).

    [0339] Amino acid alterations are defined relative to a reference sequence. An amino acid alteration relative to a reference sequence means that the amino acid sequence of the variant sequence is different to the reference sequence.

    [0340] Amino acids in the reference sequence and the variant sequence may be assigned a number, where the numbering starts with the amino acid at the N-terminus of the polypeptide (i.e. the amino acid at the N-terminus of the polypeptide is numbered 1, the next amino acid is numbered 2 etc.). The position of a reference sequence refers to a specific amino acid residue present in the reference sequence as identified by the specific numbering of the amino acids in the reference sequence. The position of a variant sequence refers to a specific amino acid residue present in the variant sequence as identified by the specific numbering of the amino acids in the variant sequence.

    [0341] Since the variant sequence may include deletions or insertions compared to the reference sequence, the amino acids in the variant sequence may be numbered differently to the same amino acids in the reference sequence. By way of example, if an amino acid is inserted between amino acids 131 and 132 of SEQ ID NO: 1, the amino acid following the insertion will have the numbering 133 in the variant sequence while it retains the numbering 132 in the reference sequence. In this example, the position of the variant sequence that corresponds to position 132 of the reference sequence is position 133. Therefore, amino acids in the variant sequence that have been retained from the reference sequence may be defined by referring to the corresponding position of the reference sequence. In other words, a position in the variant sequence may be defined by reference to a corresponding position in the reference sequence.

    [0342] In particular, substitutions in the variant sequence compared to the reference sequence may be defined by referring to the corresponding position of the reference sequence in spite of any insertions and/or deletions in the reference sequence. Where the amino acids of a reference sequence have been deleted, there is no corresponding position in the variant sequence. Where there are no insertions or deletions compared to the reference sequence (i.e. there are only substitutions), the corresponding position of the reference sequence will be the same as the position in the variant sequence.

    [0343] For example, position 169 in AacSHC represented by SEQ ID NO:1 corresponds to position 222 in ZmoSHC1 (SEQ ID NO:13 or 14), position 177 in ZmoSHC2 (SEQ ID NO:15), position 172 in TeISHC (SEQ ID NO:23) and position 196 in ScoSH1 (SEQ ID NO:32).

    [0344] For example, position 306 in AacSHC represented by SEQ ID NO:1 corresponds to position 368 in ZmoSHC1 (SEQ ID NO:13 or 14), position 321 in ZmoSHC2 (SEQ ID NO:15), position 311 in TeISHC (SEQ ID NO:23) and position 335 in ScoSH1 (SEQ ID NO:32).

    [0345] For example, position 600 in AacSHC represented by SEQ ID NO:1 corresponds to position 667 in ZmoSHC1 (SEQ ID NO:13 or 14), position 619 in ZmoSHC2 (SEQ ID NO:15), position 609 in TeISHC (SEQ ID NO:23) and position 629 in ScoSH1 (SEQ ID NO:32).

    [0346] In an embodiment, the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and wherein the SHC/HAC enzyme variant amino acid sequence has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, or 383 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme corresponding to W169, A306 and/or G600 of SEQ ID NO:1, 2, or 3.

    [0347] The SHC/HAC enzyme variant amino acid sequence has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme corresponding to W169, A306 and/or G600 of SEQ ID NO:1, 2, or 3.

    [0348] In an embodiment, the SHC/HAC enzyme or enzyme variant (also named type 1 variants) has an amino acid sequence with at least 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity or similarity to SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO: 53, SEQ ID NO: 54 and/or SEQ ID NO: 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307,308, 309, 310, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, or 3 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, and/or 54 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO:18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307,308, 309 or 310, corresponding to W169, A306 and/or G600 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, and/or 54.

    [0349] In a preferred embodiment, the SHC/HAC enzyme or enzyme variant has an amino acid sequence with at least 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity or similarity to SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, and has amino acid alterations relative to SEQ ID NO: 1, 2, 3 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, 3.

    [0350] In an embodiment, a SHC/HAC enzyme variant (also named type 2 variants) has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169 of SEQ ID NO: 1, 2, 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 47, 48, 49, 50, 51, 52, 53 or 54 corresponding to W169 of SEQ ID NO:1, 2, 3.

    [0351] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0352] In an embodiment, a SHC/HAC enzyme variant (also named type 3 variants) has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54. 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169 and G600M of SEQ ID NO: 1, 2, 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19 or 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295,296, 307, 308, 309 or 310 corresponding to W169 and G600M of SEQ ID NO:1, 2, 3.

    [0353] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0354] In an embodiment, a SHC/HAC enzyme variant (also named type 4 variants) has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169, A306 and G600 of SEQ ID NO: 1, 2, or 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19 or 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295,296, 307, 308, 309 or 310 corresponding to W169, A306 and G600 of SEQ ID NO:1, 2, or 3.

    [0355] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0356] All combinations of altered positions in the SHC/AHC enzyme variant identified above are encompassed by the present disclosure: [0357] W169 [0358] W169, A306 [0359] W169, A306, G600 [0360] W169, G600 [0361] A306, G600 [0362] A306 [0363] G600
    (when referring to SEQ ID NO:1)

    [0364] The new amino acid (X) at a position corresponding to position 169 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may be G, A or V or a functional equivalent thereof.

    [0365] A functional equivalent of G is P. A and V are functional equivalents. M, L and I are also functional equivalents of A and V. A preferred new amino acid at position 169 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 corresponding to 169 of SEQ ID NO:1, 2, or 3 is G, A or V. A most preferred new amino acid at position 169 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 corresponding to 169 of SEQ ID NO:1, 2, or 3 is G.

    [0366] For example, position 169 in AacSHC represented by SEQ ID NO:1 corresponds to position 222 in ZmoSHC1 (SEQ ID NO:13), position 177 in ZmoSHC2 (SEQ ID NO:15), position 172 in TeISHC (SEQ ID NO:23) and position 196 in ScoSH1 (SEQ ID NO:32).

    [0367] The new amino acid (X) at a position corresponding to position 306 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may be V or a functional equivalent thereof. A functional equivalent of V is A, M, L and I. A preferred new amino acid at position 306 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 corresponding to 306 of SEQ ID NO:1, 2, or 3 is V.

    [0368] For example, position 306 in AacSHC represented by SEQ ID NO:1 corresponds to position 368 in ZmoSHC1 (SEQ ID NO:13), position 321 in ZmoSHC2 (SEQ ID NO:15), position 311 in TeISHC (SEQ ID NO:23) and position 335 in ScoSH1 (SEQ ID NO:32).

    [0369] The new amino acid (X) at a position corresponding to position 600 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may be A, V, L, I or M or a functional equivalent thereof. All these amino acids are functional equivalents. A preferred new amino acid at position 600 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 corresponding to 600 of SEQ ID NO:1, 2, 3 is A, V, L, I, or M. A most preferred new amino acid at position 600 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 corresponding to 600 of SEQ ID NO:1, 2, or 3 is M.

    [0370] For example, position 600 in AacSHC represented by SEQ ID NO:1 corresponds to position 667 in ZmoSHC1 (SEQ ID NO:13), position 619 in ZmoSHC2 (SEQ ID NO:15), position 609 in TeISHC (SEQ ID NO:23) and position 629 in ScoSH1 (SEQ ID NO:32).

    TABLE-US-00009 TABLE 9 Positions of the three preferred mutated amino acids (AAs) in four different wild type SHC/HAC AA position Corresponding AA position in in AacSHC ZmoSHC1 ZmoSHC2 TelSHC ScoSHC 169 222 177 172 196 306 368 321 311 335 600 667 619 609 629

    [0371] In an embodiment, a SHC/HAC enzyme variant (also named type 5 variants) has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, or 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19 or 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 corresponding to W169, A306 and/or G600 of SEQ ID NO:1, 2, or 3 and such amino acid alterations are: [0372] the W at position 169 is replaced by G, A or V or a functional equivalent thereof, preferably wherein the W at position 169 is replaced by G, [0373] the A at position 306 is replaced by V or a functional equivalent thereof and/or [0374] the G at position 600 is replaced by A, V, L, I or M or a functional equivalent thereof, preferably wherein the G at position 600 is replace by M.

    [0375] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0376] In an embodiment, a SHC/HAC enzyme variant (also named type 6 variants) has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 and has an amino acid alteration relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at position corresponding to position W169 of SEQ ID NO: 1, 2, or 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 corresponding to W169 of SEQ ID NO:1, 2, or 3 and such amino acid alteration is the W at position 169 is replaced by G.

    [0377] In an embodiment, the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G.

    [0378] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0379] In an embodiment, a SHC/HAC enzyme variant (also named type 7 variants) has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169 and G600M of SEQ ID NO: 1, 2, 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19 or 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 corresponding to W169 and G600M of SEQ ID NO:1, 2, or 3 and such amino acid alterations are: [0380] the W at position 169 is replaced by G and [0381] the G at position 600 is replaced by M.

    [0382] In an embodiment, the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, and the G at position 600 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by M.

    [0383] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0384] In an embodiment, a SHC/HAC enzyme variant has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169 and A306 of SEQ ID NO: 1, 2, 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19 or 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 corresponding to W169 and A306 of SEQ ID NO:1, 2, or 3 and such amino acid alterations are: [0385] the W at position 169 is replaced by G and [0386] the A at position 306 is replaced by V.

    [0387] In an embodiment, the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, and [0388] the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V.

    [0389] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0390] In an embodiment, a SHC/HAC enzyme variant (also named type 8 variants) has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169, A306 and G600 of SEQ ID NO: 1, 2, 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 corresponding to W169, A306 and G600 of SEQ ID NO:1, 2, or 3 and such amino acid alterations are: [0391] the W at position 169 is replaced by G, [0392] the A at position 306 is replaced by V and [0393] the G at position 600 is replaced by M.

    [0394] In an embodiment, the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, [0395] the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V, and [0396] the G at position 600 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by M.

    [0397] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0398] In an embodiment, a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169 and G600 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and such amino acid alterations are: [0399] the W at position 169 is replaced by G, and [0400] the G at position 600 is replaced by M.

    [0401] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0402] In an embodiment, a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and [0403] has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169 and A306 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and such amino acid alterations are: [0404] the W at position 169 is replaced by G, and [0405] the A at position 306 is replaced by V.

    [0406] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0407] In an embodiment, a SHC/HAC enzyme variant (also named type 9 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and such amino acid alterations are: [0408] the W at position 169 is replaced by G, [0409] the A at position 306 is replaced by V and [0410] the G at position 600 is replaced by M.

    [0411] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0412] In a preferred embodiment, a SHC/HAC enzyme variant (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 305 or 306 and has amino acid alteration relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 305 or 306 at position W169 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 or 54 and such amino acid alteration is the W at position 169 is replaced by G.

    [0413] In an embodiment, each of the SHC/HAC enzyme variant (type 10 variant) having at least 70.0% identity or similarity with SEQ ID NO: 2, 3, 47, 48, 49, 50, 51, 53, 54, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 305 or 306 still has the same mutation(s) that differentiates it from SEQ ID NO:1. Each of these mutations has already been defined herein at least in the section entitled Summary of the sequences. In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0414] In a preferred embodiment, a SHC/HAC enzyme variant (ZmoSHC1 P1 variant, SEQ ID NO: 312) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 13 or 14 and has amino acid alteration relative to SEQ ID NO: 13 at position W222 of SEQ ID NO: 13 or 14 and such amino acid alteration is the W at position 222 is replaced by G.

    [0415] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:312 and that still has W222G.

    [0416] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0417] In a preferred embodiment, a SHC/HAC enzyme variant (ZmoSHC1 P2 variant: SEQ ID NO: 353) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 13 and has amino acid alterations relative to SEQ ID NO: 13 at positions W222 and G667 of SEQ ID NO: 13 and such amino acid alteration is the W at position 222 is replaced by G and G at position 667 is replaced by M.

    [0418] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0419] In a preferred embodiment, a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 13 and has amino acid alterations relative to SEQ ID NO: 13 at positions W222 and A368 of SEQ ID NO: 13 and such amino acid alteration is the W at position 222 is replaced by G and A at position 368 is replaced by V.

    [0420] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0421] In a preferred embodiment, a SHC/HAC enzyme variant (ZmoSHC1 P3 variant: SEQ ID NO: 354) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 13 and has amino acid alterations relative to SEQ ID NO: 13 at positions W222, A368 and G667 of SEQ ID NO: 13 and such amino acid alteration is the W at position 222 is replaced by G, A at position 368 is replaced by V, and G at position 667 is replaced by M.

    [0422] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0423] In a preferred embodiment, a SHC/HAC enzyme variant (ZmoSHC2 P1 variant, SEQ ID NO: 313) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO:15 and has amino acid alteration relative to SEQ ID NO: 15 at position W177of SEQ ID NO: 15 and such amino acid alteration is the W at position 177 is replaced by G.

    [0424] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:313 and that still has W177G.

    [0425] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0426] In a preferred embodiment, a SHC/HAC enzyme variant (ZmoSHC2 P2 variant, SEQ ID NO: 355) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO:15 and has amino acid alteration relative to SEQ ID NO: 15 at position W177 and G619 of SEQ ID NO: 15 and such amino acid alteration is the W at position 177 is replaced by G and the G at position 619 is replaced by M.

    [0427] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:313 or 355 and that still has W177G and G619M.

    [0428] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0429] In a preferred embodiment, a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO:15 and has amino acid alteration relative to SEQ ID NO: 15 at positions W177, and 321 of SEQ ID NO: 15 and such amino acid alteration is the W at position 177 is replaced by G and the A at position 321 is replaced by V.

    [0430] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:313 and that still has W177G and A321V.

    [0431] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0432] In a preferred embodiment, a SHC/HAC enzyme variant (ZmoSHC2 P3 variant, SEQ ID NO: 356) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO:15 and has amino acid alteration relative to SEQ ID NO: 15 at positions W177, A321 and G619 of SEQ ID NO: 15 and such amino acid alteration is the W at position 177 is replaced by G, A at position 321 is replaced by V, and the G at position 619 is replaced by M.

    [0433] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:313 and that still has W177G, A321V and G619M.

    [0434] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0435] In a preferred embodiment, a SHC/HAC enzyme variant (Tel SHC variant P1 SEQ ID NO: 304) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 23 and has amino acid alteration relative to SEQ ID NO: 23 at position W172 of SEQ ID NO: 23 and such amino acid alteration is the W at position 172 is replaced by G.

    [0436] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:304 and that still has W172G.

    [0437] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:302 and that still has W172G.

    [0438] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0439] In a preferred embodiment, a SHC/HAC enzyme variant (Tel SHC variant P2 SEQ ID NO: 359) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 23 and has amino acid alteration relative to SEQ ID NO: 23 at positions W172 and G609 of SEQ ID NO: 23 and such amino acid alteration is the W at position 172 is replaced by G and G at position 609 replaced by M.

    [0440] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:359 and that still has W172G and G609M.

    [0441] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0442] In a preferred embodiment, a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 23 and [0443] has amino acid alteration relative to SEQ ID NO: 23 at positions W172 and A311 of SEQ ID NO: 23 and such amino acid alteration is the W at position 172 is replaced by G and A at position 311 is replaced by V.

    [0444] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:360 and that still has W172G and A311V.

    [0445] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0446] In a preferred embodiment, a SHC/HAC enzyme variant (Tel SHC variant P3 SEQ ID NO: 360) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 23 and has amino acid alteration relative to SEQ ID NO: 23 at positions W172, A311 and G609 of SEQ ID NO: 23 and such amino acid alteration is the W at position 172 is replaced by G, A at position 311 is replaced by V, and G at position 609 replaced by M.

    [0447] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:360 and that still has W172G, A31 1V and G609M.

    [0448] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0449] In a preferred embodiment, a SHC/HAC enzyme variant (ScoSHC1 P1 variant SEQ ID NO: 311) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO:32 and has amino acid alteration relative to SEQ ID NO: 32 at position W196 of SEQ ID NO: 32 and such amino acid alteration is the W at position 196 is replaced by G.

    [0450] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:311 and that still has W196G.

    [0451] In a preferred embodiment, a SHC/HAC enzyme variant (ScoSHC1 P2 variant SEQ ID NO: 357) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO:32 and has amino acid alteration relative to SEQ ID NO: 32 at positions W196 and G629 of SEQ ID NO: 32 and such amino acid alteration is the W at position 196 is replaced by G and the G at position 629 is replaced by M.

    [0452] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:311 and that still has W196G and G629M.

    [0453] In a preferred embodiment, a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO:32 and has amino acid alteration relative to SEQ ID NO: 32 at positions W196, and A335 of SEQ ID NO: 32 and such amino acid alteration is the W at position 196 is replaced by G and the A at position 335 is replaced by V.

    [0454] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:311 and that still has W196G and A335V. In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0455] In a preferred embodiment, a SHC/HAC enzyme variant (ScoSHC1 P3 variant SEQ ID NO: 358) (also named type 10 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO:32 and has amino acid alteration relative to SEQ ID NO: 32 at positions W196, A335 and G629 of SEQ ID NO: 32 and such amino acid alteration is the W at position 196 is replaced by G, A at position 335 is replaced by V, and the G at position 629 is replaced by M.

    [0456] In a preferred embodiment, this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:311 and that still has W196G, A335V and G629M.

    [0457] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0458] In a preferred embodiment, the enzyme variant is as follows: [0459] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 1, 4, 5, 6 or 350 and has at least one of the following mutations: W169G, A306V and G600M or [0460] the SHC/HAC enzyme variant has an amino acid sequence having at least 90.0% identity to SEQ ID NO: 7, 8, 9 or 386 and has the following mutations: M132R, A224V, 1432T, A557T, R613S, and has at least one of the following mutations: W169G, A306V and G600M or [0461] the SHC/HAC enzyme variant has an amino acid sequence having at least 90.0% identity to SEQ ID NO: 10, 11, 12 or 385 and has the following mutations: M132R, A224V, 1432T and has at least one of the following mutations: W169G, A306V and G600M or [0462] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 23, 304, 359 or 360 and has at least one of the following mutations: W172G, A311V and G609M (Tel SHC/HAC variant) or [0463] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 32, 311, 357, or 358 and has the following mutations: W196G, A335V and G629M (Sco SHC/HAC variant) or [0464] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO:13, 312, 353 or 354 and has at least one of the following mutations: W222G, A368V and G667M (Zmo SHC1 variant) or [0465] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 15, 313, 355 or 356 and has at least one of the following mutations: W177G, A321V and G619M (Zmo SHC2 variant) or [0466] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 1 and has at least the following mutations: W169G, G600M, M132R and 1432T, or [0467] the SHC/HAC enzyme variant has an amino acid sequence having at least 90.0% identity to SEQ ID NO: 1 and has the following mutations: W169G, G600M, M132R and 1432T, or [0468] the SHC/HAC enzyme variant has an amino acid sequence having at least 95.0% identity to SEQ ID NO: land has the following mutations W169G, G600M, M132R and 1432T, or [0469] the SHC/HAC enzyme variant has an amino acid sequence having at least 96.0%, 97.0%, 99.0%, 99.0% identity to SEQ ID NO: 1 and has the following mutations W169G, G600M, M132R and 1432T.

    [0470] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0471] In a preferred embodiment, a SHC/HAC enzyme variant (also named type 11 variants) has an amino acid sequence having at least 70.0% identity or similarity to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169, and G600M of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 or 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and such amino acid alterations are: [0472] the W at position 169 is replaced by G and [0473] the G at position 600 is replaced by M.

    [0474] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0475] In an embodiment, the SHC/HAC enzyme variant (also named type 12 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 1 and has at least one of the following mutations relative to SEQ ID NO:1: W169G, A306V and G600M.

    [0476] In an embodiment, the SHC/HAC enzyme variant (also named type 13 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 4, and has at least the following mutation relative to SEQ ID NO:1: W169G.

    [0477] In an embodiment, the SHC/HAC enzyme variant (also named type 14 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 5, and has at least the following mutations relative to SEQ ID NO:1: W169G and G600M.

    [0478] In an embodiment, the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 350, and has at least the following mutations relative to SEQ ID NO:1: W169G and A306V.

    [0479] In an embodiment, the SHC/HAC enzyme variant (also named type 15 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 6, and has at least the following mutationS relative to SEQ ID NO:1: W169G, A306V and G600M.

    [0480] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0481] In an embodiment, the SHC/HAC enzyme variant (also named type 16 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 3, has the following mutations M132R, A224V, 1432T relative to SEQ ID NO: 1 and has at least one of the following mutations: W169G, A306V and G600M relative to SEQ ID NO: 3.

    [0482] In an embodiment, the SHC/HAC enzyme variant (also named type 17 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 10, has the following mutations M132R, A224V, 1432T relative to SEQ ID NO: 1 and has the following mutation: W169G relative to SEQ ID NO: 3.

    [0483] In an embodiment, the SHC/HAC enzyme variant (also named type 18 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 11, has the following mutations M132R, A224V, 1432T relative to SEQ ID NO: 1 and has the following mutations: W169G and G600M relative to SEQ ID NO: 3.

    [0484] In an embodiment, the SHC/HAC enzyme variant (also named type 32 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 385, has the following mutations M132R, A224V, 1432T relative to SEQ ID NO: 1 and has the following mutations: W169G and A306V relative to SEQ ID NO: 3.

    [0485] In an embodiment, the SHC/HAC enzyme variant (also named type 19 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 12, has the following mutations M132R, A224V, 1432T relative to SEQ ID NO: 1 and has the following mutations: W169G, A306V and G600M relative to SEQ ID NO: 3.

    [0486] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0487] In an embodiment, the SHC/HAC enzyme variant (also named type 20 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 2, has the following mutations: M132R, A224V, 1432T, A557T, R613S relative to SEQ ID NO: 1 and has at least one of the following mutations: W169G, A306V and G600M relative to SEQ ID NO: 2.

    [0488] In an embodiment, the SHC/HAC enzyme variant (also named type 21 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 7, has the following mutations M132R, A224V, 1432T, A557T, R613S relative to SEQ ID NO: 1 and has the following mutation: W169G relative to SEQ ID NO: 2.

    [0489] In an embodiment, the SHC/HAC enzyme variant (also named type 22 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 8, has the following mutations M132R, A224V, 1432T, A557T, R613S relative to SEQ ID NO: 1 and has the following mutations: W169G and G600M relative to SEQ ID NO: 2.

    [0490] In an embodiment, the SHC/HAC enzyme variant (also named type 33 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO:386, has the following mutations M132R, A224V, 1432T, A557T, R613S relative to SEQ ID NO: 1 and has the following mutations: W169G and A306V relative to SEQ ID NO: 2.

    [0491] In an embodiment, the SHC/HAC enzyme variant (also named type 23 variants) has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 9, has the following mutations M132R, A224V, 1432T, A557T, R613S relative to SEQ ID NO: 1 and has the following mutations: W169G, A306V and G600M relative to SEQ ID NO: 2.

    [0492] In this context, the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0493] In an embodiment, the SHC/AHC enzyme variant (also named type 34 variants) has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1-12, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47-54, 55-296, 301-313, 315-353, 354-383 wherein the W at position 169 or corresponding to position 169 of SEQ ID NO: 1, is replaced by G; wherein the A at position 306 or corresponding to position 306 of SEQ ID NO: 1, 2 or 3 is replaced by V; and/or wherein the G at position 600 or corresponding to 600 of SEQ ID NO: 1, 2 or 3 is replaced by M.

    [0494] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0495] In an embodiment, the SHC/AHC enzyme variant (also named type 24 variants) has an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10, 11, 12, 304, 311, 312, 313, 305, 306, 302, 359, 357, 353, 355, 360, 358, 354, 356.

    [0496] In an embodiment, the SHC/AHC enzyme variant (also named type 25 variants) has an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 350, 351, 352.

    [0497] In an embodiment, each of the SHC/HAC enzyme variants defined herein (type 1 to 34 variants) may have the following additional amino acid alteration wherein the (new) amino acid (X) at a position corresponding to position 168 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may be S or a functional equivalent thereof. A functional equivalent of S is C, T, N or Q. A preferred new amino acid at position 168 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295,296, 307, 308, 309 or 310 corresponding to 168 of SEQ ID NO:1, 2 or 3 is S.

    [0498] In a preferred embodiment, a SHC/HAC enzyme variant has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and [0499] has an amino acid alteration relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 at position corresponding to position W169 of SEQ ID NO: 1, 2, 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 to W169 of SEQ ID NO:1, 2, 3 and such amino acid alteration is the W at position 169 is replaced by G, and [0500] has amino acid S at position 168 relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at position corresponding to position S168 of SEQ ID NO: 1, 2, 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 corresponding to S168 of SEQ ID NO:1, 2, 3.

    [0501] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0502] In an embodiment, any SHC/HAC enzyme variant may comprise at least one of the following conserved amino acids L22, Q26, G30, W32, A44, L48, Q72, G76, W78, Y95, L98, G102, A113, 1117, G121, G122, F129, T130, L134, A135, G138, W142, P146, W169, A170, R171, F217, D222, R237, 1261, P263, P281, S309, P310, W312, D313, T314, A320, W339, Q344, G349, D350, W351, G361, G362, A364, F365, N369, Y372, P373, D374, D376, D377, W406, Q411, G415, A419, P433, D436, D442, P443, D447, V448, Q479, G483, W485, G487, R488, W489, G490, N492, Y495, G496, T497, L504, W522, Q527, G531, G532, W533, G534, E535, S539, Y540, G547, T552, T556, W558, A559, A565, L581, Q585, G589, W591, G600, F601, P602, F605, Y609, Y612, F616, P617, A620 and R623 by reference to the wild type Aac SHC/HAC having SEQ ID NO: 1 or any variant derived from SEQ ID NO:1 and having SEQ ID NO: 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383. This variant may also be derived from any wild type SHC/HAC enzyme as defined herein (e.g. SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310) wherein corresponding positions are identified corresponding to the ones identified above for SEQ ID NO: 1. This variant may be derived from any variant types defined earlier herein.

    [0503] There is therefore provided herein a process for making ()-Ambrox by enzymatically converting EEH to ()-Ambrox. There is also provided herein a process for making Ambra oxide by enzymatically converting E,E-bishomofarnesol to Ambra oxide. These processes may use any SHC/HAC enzyme variant described herein (especially of types 1 to 25).

    [0504] Percent (%) identity with respect to a polypeptide or nucleotide sequence is defined respectively as the percentage of amino acids or nucleotides in a candidate sequence that are identical with the amino acids or nucleotides in the reference sequence, after aligning the sequence and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. The terms polypeptide and protein are used interchangeably herein and mean any peptide-linked chain of amino acids, regardless of length or post-translational modification.

    [0505] The similarity of nucleotide and amino acid sequences, i.e. the percentage of sequence identity, can be determined via sequence alignments. Such alignments can be carried out with several art-known algorithms, preferably with the mathematical algorithm of Karlin and Altschul (Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5877), with hmmalign (HMMER package, http://hmmer.wustl.edu/) or with the CLUSTAL algorithm (Thompson, J. D., Higgins, D. G. & Gibson, T. J. (1994) Nucleic Acids Res. 22, 4673-80) available eg. on https://www.ebi.ac.uk/Tools/msa/clustalo/or the GAP program (mathematical algorithm of the University of Iowa) or the mathematical algorithm of Myers and Miller (1989Cabios 4: 11-17). Preferred parameters used are the default parameters as they are set on https://www.ebi.ac.uk/Tools/msa/clustalo/.

    [0506] Percentage sequence identity may be calculated using, for example, BLAST, BLAT or BlastZ (or BlastX). A similar algorithm is incorporated into the BLASTN and BLASTP programs of Altschul et al (1990) J. Mol. Biol. 215, 403-410. BLAST polynucleotide searches may be performed with the BLASTN program, score=100, word length=12, to obtain polynucleotide sequences that are homologous to those nucleic acids which encode the relevant protein. BLAST protein searches may be performed with the BLASTP program, score=50, word length=3, to obtain amino acid sequences homologous to the polypeptide.

    [0507] To obtain gapped alignments for comparative purposes, Gapped BLAST may be utilized as described in Altschul et al (1997) Nucleic Acids Res. 25, 3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs are used.

    [0508] Sequence matching analysis may be supplemented by established homology mapping techniques like Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19 Suppl 1: 154-162) or Markov random fields. When percentages of sequence identity are referred to in the present application, these percentages are calculated in relation to the full length of the longer sequence, if not specifically indicated otherwise.

    [0509] In particular embodiments, % identity between two sequences is determined using CLUSTAL O (version 1.2.4).

    [0510] Additional amino acid alterations may be present in the SHC/AHC variants disclosed herein. In an embodiment, examples of additional amino acid alterations relative to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 and are at positions corresponding to positions 81, 431, 90, 172, 277, 37, 174, 601, 77, 92, 129, 579, 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 5556, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 corresponding to 81, 431, 90, 272, 177, 37, 174, 601, 77, 92, 129, 579, 605 of SEQ ID NO:1, 2, or 3.

    [0511] Variant of type 26: In an embodiment, examples of additional amino acid alterations relative to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 and are at positions corresponding to positions 81 and/or 431 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 corresponding to 81, 431 of SEQ ID NO:1, 2, or 3.

    [0512] Variant of type 27: In an embodiment, examples of additional amino acid alterations relative to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 and are at positions corresponding to positions 90, 172 and/or 277 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 corresponding to 90, 272, 177 of SEQ ID NO:1, 2, or 3.

    [0513] Variant of type 28: In an embodiment, examples of additional amino acid alterations relative to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 and are at positions corresponding to positions 37, 174, 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 corresponding to 37, 174, 601 of SEQ ID NO:1, 2, or 3.

    [0514] Variant of type 29: In an embodiment, examples of additional amino acid alterations relative to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 are at positions corresponding to positions 77, 92, 129, 579, 601, 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 corresponding to 77, 92, 129, 579, 601, 605 of SEQ ID NO:1, 2, or 3.

    [0515] The amino acid alteration at a position corresponding to position 81 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 81 of SEQ ID NO:1, 2, or 3) may, for example, be Y81X. This refers to a substitution of the amino acid Y at position 81 of SEQ ID NO: 1 for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 81.

    [0516] The new amino acid (X) at a position corresponding to position 81 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 81 of SEQ ID NO:1, 2, 3) may, for example, be Met, Ala, Val, Leu, lie, Cys, Ser, Thr, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp, or Phe. For example, the amino acid alteration at a position corresponding to position 81 of SEQ ID NO: 1 may substitute the amino acid of SEQ ID NO: 1 (i.e. Y) for a basic amino acid (i.e. His, Lys or Arg). For example, the amino acid alteration at a position corresponding to position 81 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 81 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. Y) for histidine (i.e. the amino acid alteration at a position corresponding to position 81 of SEQ ID NO: 1 is Y81H).

    [0517] The amino acid alteration at a position corresponding to position 431 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 431 of SEQ ID NO:1, 2, 3) may, for example, be H431X. This refers to a substitution of the amino acid H at position 431 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 81 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 431.

    [0518] The new amino acid (X) at a position corresponding to position 431 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 81 of SEQ ID NO:1, 2, 3) may, for example, be Met, Ala, Val, Leu, lie, Cys, Ser, Thr, Asn, Gln, Asp, Glu, Lys, Arg, Gly, Pro, Trp, Tyr or Phe. For example, the amino acid alteration at a position corresponding to position 431 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19 or 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 81 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. H) for a hydrophobic amino acid (i.e. Met, Ala, Val, Leu or lie). For example, the amino acid alteration at a position corresponding to position 431 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 81 of SEQ ID NO:1, 2, 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. H) for leucine (i.e. the amino acid alteration at a position corresponding to position 431 of SEQ ID NO: 1 is H431L).

    [0519] The amino acid alteration at a position corresponding to position 90 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 90 of SEQ ID NO:1, 2, or 3) may, for example, be T90X. This refers to a substitution of the amino acid T at position 90 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 90 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 90.

    [0520] The new amino acid (X) at a position corresponding to position 90 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 90 of SEQ ID NO:1, 2, 3) may, for example, be Met, Ala, Val, Leu, lie, Cys, Ser, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp, Tyr or Phe. For example, the amino acid alteration at a position corresponding to position 90 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 90 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. T) for a hydrophobic amino acid (i.e. Met, Ala, Val, Leu, lie). For example, the amino acid alteration at a position corresponding to position 90 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 90 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. T) for alanine (i.e. the amino acid alteration at a position corresponding to position 90 of SEQ ID NO: 1 is T90A).

    [0521] The amino acid alteration at a position corresponding to position 172 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 172 of SEQ ID NO:1, 2, 3) may, for example, be A172X. This refers to a substitution of the amino acid T at position 172 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 172 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 172.

    [0522] The new amino acid (X) at a position corresponding to position 172 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 172 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Val, Leu, lie, Cys, Ser, Thr, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp, Tyr or Phe. For example, the amino acid alteration at a position corresponding to position 172 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 172 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. A) for a neutral hydrophilic amino acid (i.e. Cys, Ser, Thr, Asn, Gln). For example, the amino acid alteration at a position corresponding to position 172 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 172 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. A) for threonine (i.e. the amino acid alteration at a position corresponding to position 172 of SEQ ID NO: 1 is A172T).

    [0523] The amino acid alteration at a position corresponding to position 277 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 277 of SEQ ID NO:1, 2, or 3) may, for example, be M277X. This refers to a substitution of the amino acid M at position 277 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 277 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 277.

    [0524] The new amino acid (X) at a position corresponding to position 277 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 81 of SEQ ID NO:1, 2, or 3) may, for example, be Ala, Val, Leu, lie, Cys, Ser, Thr, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp, Tyr or Phe. For example, the amino acid alteration at a position corresponding to position 277 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19 or 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 277 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. M) for a basic amino acid (i.e. His, Lys, Arg). For example, the amino acid alteration at a position corresponding to position 277 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 277 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. M) for lysine i.e. the amino acid alteration at a position corresponding to position 277 of SEQ ID NO: 1 is M277K).

    [0525] The amino acid alteration at a position corresponding to position 37 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 37 of SEQ ID NO:1, 2, or 3) may, for example, be L37X. This refers to a substitution of the amino acid L at position 37 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 37 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 37.

    [0526] The new amino acid (X) at a position corresponding to position 37 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 37 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, lie, Cys, Ser, Thr, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp, Tyr or Phe. For example, the amino acid alteration at a position corresponding to position 37 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 37 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. L) for a neutral hydrophilic amino acid (i.e. Cys, Ser, Thr, Asn or Gln). For example, the amino acid alteration at a position corresponding to position 37 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 37 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. L) for glutamine (i.e. the amino acid alteration at a position corresponding to position 37 of SEQ ID NO: 1 is L37Q).

    [0527] The amino acid alteration at a position corresponding to position 174 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 174 of SEQ ID NO:1, 2, or 3) may, for example, be V174X. This refers to a substitution of the amino acid V at position 174 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 277 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 174.

    [0528] The new amino acid (X) at a position corresponding to position 174 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 174 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Leu, lie, Cys, Ser, Thr, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp, Tyr or Phe. The new amino acid (X) at a position corresponding to position 174 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 174 of SEQ ID NO:1, 2, or 3) may, for example, be a hydrophobic amino acid (i.e. Met, Ala, Leu or lie).

    [0529] For example, the amino acid alteration at a position corresponding to position 174 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 174 of SEQ ID NO:1, 2, 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. V) for isoleucine (i.e. the amino acid alteration at a position corresponding to position 174 of SEQ ID NO: 1 is V1741).

    [0530] The amino acid alteration at a position corresponding to position 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 601 of SEQ ID NO:1, 2, or 3) may, for example, be F601X. This refers to a substitution of the amino acid F at position 601 of SEQ ID NO: 1 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 601 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 601.

    [0531] The new amino acid (X) at a position corresponding to position 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 2, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 601 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu, lie, Cys, Ser, Thr, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp or Tyr. The new amino acid (X) at a position corresponding to position 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 601 of SEQ ID NO:1, 2, or 3) may, for example, be an aromatic acid (i.e. Trp, Tyr, Phe). For example, the amino acid alteration at a position corresponding to position 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 601 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. F) for tyrosine (i.e. the amino acid alteration at a position corresponding to position 601 of SEQ ID NO: 1 is F601Y).

    [0532] The amino acid alteration at a position corresponding to position 77 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 77 of SEQ ID NO:1, 2, or 3) may, for example, be T77X. This refers to a substitution of the amino acid T at position 77 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 77 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 77.

    [0533] The new amino acid (X) at a position corresponding to position 77 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 77 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu, lie, Cys, Ser, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp, Tyr or Phe. For example, the amino acid alteration at a position corresponding to position 77 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 77 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. T) for a hydrophobic amino acid (i.e. Met, Ala, Val, Leu or lie). For example, the amino acid alteration at a position corresponding to position 77 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 77 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. T) for alanine (i.e. the amino acid alteration at a position corresponding to position 77 of SEQ ID NO: 1 is T77A).

    [0534] The amino acid alteration at a position corresponding to position 92 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 92 of SEQ ID NO:1, 2, 3) may, for example, be 192X. This refers to a substitution of the amino acid I at position 92 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 92 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 92.

    [0535] The new amino acid (X) at a position corresponding to position 92 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 92 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu, Cys, Ser, Thr, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp, Tyr or Phe. For example, the amino acid alteration at a position corresponding to position 92 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 92 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. 1) for a hydrophobic amino acid (i.e. Met, Ala, Val, Leu or lie). For example, the amino acid alteration at a position corresponding to position 92 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 92 of SEQ ID NO:1, 2, 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. 1) for valine (i.e. the amino acid alteration at a position corresponding to position 92 of SEQ ID NO: 1 is 192V).

    [0536] The amino acid alteration at a position corresponding to position 129 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 129 of SEQ ID NO:1, 2, or 3) may, for example, be F129X. This refers to a substitution of the amino acid F at position 129 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 129 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 129.

    [0537] The new amino acid (X) at a position corresponding to position 129 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 129 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu, lie, Cys, Ser, Thr, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp or Tyr. For example, the amino acid alteration at a position corresponding to position 129 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 129 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. F) for a hydrophobic amino acid (i.e. Met, Ala, Val, Leu or lie). For example, the amino acid alteration at a position corresponding to position 129 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 129 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. F) for leucine (i.e. the amino acid alteration at a position corresponding to position 129 of SEQ ID NO: 1 is F129L).

    [0538] The amino acid alteration at a position corresponding to position 579 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383(or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 579 of SEQ ID NO:1, 2, or 3) may, for example, be Q579X. This refers to a substitution of the amino acid Q at position 579 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 579 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 579.

    [0539] The new amino acid (X) at a position corresponding to position 579 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 579 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu, lie, Cys, Ser, Thr, Asn, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp, Tyr or Phe. For example, the amino acid alteration at a position corresponding to position 579 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 579 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. Q) for a basic amino acid (i.e. His, Lys or Arg). For example, the amino acid alteration at a position corresponding to position 579 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 579 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. Q) for histidine (i.e. the amino acid alteration at a position corresponding to position 579 of SEQ ID NO: 1 is Q579H).

    [0540] The amino acid alteration at a position corresponding to position 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 605 of SEQ ID NO:1, 2, or 3) may, for example, be F605X. This refers to a substitution of the amino acid F at position 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 605 of SEQ ID NO:1, 2, or 3) for any different amino acid (X). As noted above, since the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 605.

    [0541] The new amino acid (X) at a position corresponding to position 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 605 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu, lie, Cys, Ser, Thr, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp or Tyr. The new amino acid (X) at a position corresponding to position 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 605 of SEQ ID NO:1, 2, or 3) may, for example, be an aromatic acid (i.e. Trp, Tyr, Phe). For example, the amino acid alteration at a position corresponding to position 605 of SEQ ID NO: 1, 2, or 3 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 605 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e. F) for tryptophan (i.e. the amino acid alteration at a position corresponding to position 601 of SEQ ID NO: 1 is F605W).

    [0542] For example, the SHC/HAC enzyme variant may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 132 and 432 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 132 and 432 of SEQ ID NO:1, 2, or 3).

    [0543] For example, the SHC/HAC enzyme variant is as earlier defined herein and may have an amino acid alteration (e.g. substitution) at a position corresponding to position 169, 306, 600, 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 601 of SEQ ID NO:1, 2, or 3).

    [0544] For example, the SHC/HAC enzyme variant is as earlier defined herein and may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 77, 92 and 129 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 77, 92, 129 of SEQ ID NO:1, 2, or 3).

    [0545] For example, the SHC/HAC enzyme variant is as earlier defined herein and may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 579 and 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33.34, 55-296, 307-310 corresponding to 169, 306, 600, 579 and 601 of SEQ ID NO:1, 2, or 3).

    [0546] For example, the SHC/HAC enzyme variant is as earlier defined herein and may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 129, 132 and 432 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 129, 132, 432 of SEQ ID NO:1, 2, or 3).

    [0547] For example, the SHC/HAC enzyme variant is as earlier defined herein and may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 132, 432 and 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 132, 432, 601 of SEQ ID NO:1, 2, or 3).

    [0548] For example, the SHC/HAC enzyme variant is as earlier defined herein and may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 129, 132, 432 and 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 129, 132, 432, 601 of SEQ ID NO:1, 2, or 3).

    [0549] The new SHC/HAC enzyme variants may, for example, exhibit attractive biological activities as earlier defined herein. The new enzyme variants may exhibit increased enzymatic activity for the conversion of EEH to ()-Ambrox or the conversion of BisEEH to Ambra oxide compared to the SHC/HAC enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, or 307-310. Increased enzymatic activity may refer to any aspect of the enzymatic conversion of EEH to ()-Ambrox or enzymatic conversion of BisEEH to Ambra oxide including, for example, increased total conversion of EEH or BisEEH, increased rate of conversion of EEH or BisEEH (e.g. in the first 3 hours or in the first 4 hours of reaction or in the first 5 hours of reaction), increased production of ()-Ambrox or Ambra oxide, and decreased production of by-products. Increased enzymatic activity may be defined by increased productivity in general, which may be defined in terms of ()-Ambrox or Ambra oxide produced per gram of biocatalyst, per hour and per liter of reaction.

    [0550] In an embodiment, the SHC/HAC enzyme variant disclosed herein exhibits: [0551] an increased substrate specificity for EEH (or for BisEEH) when homofarnesol or bis-homofarnesol substrates are used, [0552] an increased product selectivity for ()-Ambrox (or Ambra oxide) when homofarnesol or bis-homofarnesol substrates are used, [0553] an increased specificity for a particular isomer of substrates when substrates other than homofarnesol or bis-homofarnesol are used (eg ethyl-homofarnesol, hydroxyfarnesylacetone and the likesee, for example WO2021/110858 and WO2021/209482 respectively) [0554] an increased productivity and/or [0555] an increased degree of conversion of EEH (or BisEEH) as well as an increased conversion rate of EEH (or BisEEH) over the first 3 to 6 hours (or over the first 4, 5, or 6 hours) of the reaction,
    compared to the reference SHC enzyme (e.g. wild-type SHC such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 or 215G2 AacSHC or SHC #65 or a parent SHC enzyme the variant derives from such as those represented by SEQ ID NO:2, 3, 47-54).

    [0556] The new SHC/HAC enzyme variants as defined herein (variants of all types 1-34) may, for example, provide increased EEH or E,E-bishomofarnesol (BisEEH) conversion compared to the SHC/HAC wild-type enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310. Therefore, the process described herein may have an increased level of EEH or BisEEH conversion compared to the process using the SHC/HAC wild-type enzyme of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310. The new SHC/HAC enzyme variants may, for example, provide increased rate of EEH or BisEEH conversion compared to the SHC/HAC wild-type enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310. Therefore, the process described herein may have an increased rate of EEH or BisEEH conversion compared to the SHC/HAC wild-type enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310. The new SHC/HAC enzyme variants as defined herein (variants of all types 1-34) may, for example, provide increased rate of EEH or BisEEH conversion over the first 4 hours or over the first 3 hours or over the first 4 hours or over the first 5 hours or over the first 6 hours of the reaction compared to the SHC/HAC wild-type enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310.

    [0557] Therefore, the process described herein may have an increased rate of EEH or BisEEH conversion over the first 3 hours or over the first 4 hours or over the first 5 hours or over the first 6 hours compared to the SHC/HAC wild-type enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310. This may be assessed using the new enzyme versus the reference enzyme under the same reaction conditions (e.g. same pH and temperature) or using each enzyme under its respective optimized reaction conditions (e.g. optimized pH and temperature) which may be different to each other.

    [0558] For example, the new SHC/HAC enzyme variant as defined herein (variants of all types 1-34) may provide or the process may have at least about 40% EEH or BisEEH conversion in the first 6 hours of the reaction. For example, the new SHC/HAC enzyme variant may provide or the process may have at least about 45% or at least about 50% or at least about 55% or at least about 60% EEH or BisEEH conversion in the first 6 hours of the reaction. For example, the new SHC/HAC enzyme variant may provide or the process may have at least about 30% EEH or BisEEH conversion in the first 5 hours of the reaction. For example, the new SHC/HAC enzyme variant may provide or the process may have at least about 35% or at least about 45% or at least about 50% or at least about 55% EEH or BisEEH conversion in the first 6 hours of the reaction. This may be when compared to using both enzymes (i.e. the new SHC/HAC enzyme variant and the enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310) under the same reaction conditions (e.g. same pH and temperature) or when compared to using each enzyme under its respective optimized reaction conditions (e.g. optimized pH and temperature) which may be different to each other.

    [0559] The conversion of EEH to ()-Ambrox or the conversion of BisEEH to Ambra oxide or the conversion of hydroxyfarnesylacetone to Amberketal (see for example, WO2021/209482) may, for example, be determined using an activity assay as described above and may be calculated as gram of recoverable product per gram of feedstock (which can be calculated as a percent molar conversion rate).

    [0560] As used herein, any reference herein to a 99%/100% conversion rate for a homofarnesol substrate to ()-Ambrox is a reference to a 99%/100% conversion of the homofarnesol isomer (i.e. EEH) capable of conversion to ()-Ambrox using a SHC/HAC enzyme or enzyme variant.

    [0561] As used herein, any reference herein to a 99%/100% conversion rate for a bishomofarnesol substrate to Ambra oxide is a reference to a 99%/100% conversion of the bishomofarnesol isomer (i.e. BisEEH) capable of conversion to Ambra oxide using a SHC/HAC enzyme or enzyme variant.

    [0562] As used herein, any reference herein to a 99%/100% conversion rate for a hydroxyfarnesyl substrate to Amberketal is a reference to a 99%/100% conversion of the hydroxyfarnesyl substrate capable of conversion to Amberketal using a SHC/HAC enzyme or enzyme variant. The production of Amberketal from a hydroxyfarnesylacetone substrate using a WT SHC enzyme or an SHC variant is disclosed in WO2021/209482, the contents of which is incorporated herein by reference.

    [0563] The optimum temperature range for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants described herein may, for example, be from about 25 C. to about 55 C., from about 25 C. to about 50 C., from about 30 C. to about 55 C., or from about 30 C. to about 50 C.

    [0564] The optimum temperature for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants describe herein may, for example, be equal to or greater than about 35 C. For example, the optimum temperature for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may range from about 40 C. to about 50 C., for example from about 42 C. to about 48 C. or from about 44 C. to about 46 C. For example, the optimum temperature of the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may be about 45 C. The processes for making ()-Ambrox or Ambra oxide disclosed herein may be carried out at the optimum temperature of the SHC/HAC enzyme variant.

    [0565] The optimum pH range for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may from about 5 to about 7, from about 5 to about 6.5, or from about 5 to about 6.

    [0566] The optimum pH for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may, for example, be equal to or greater than about 5.4. For example, the optimum pH for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may range from about 5.2 to about 6.0, for example from about 5.4 to about 5.8, for example from about 5.6 to about 5.8. For example, the optimum pH of the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may be about 5.6 or about 5.8. The processes for making ()-Ambrox or Ambra oxide disclosed herein may be carried out at the optimum pH of the wild type SHC/HAC enzymes or the SHC/HAC enzyme variant.

    [0567] The optimum concentration of sodium dodecyl sulfate (SDS) in the reaction medium of the process for making ()-Ambrox or Ambra oxide disclosed herein may, for example, be from about 0.005 w/w % to about 0.04 w/w %, from about 0.010 w/w % to about 0.10 w/w %. For example, the optimum concentration of SDS may be from about 0.040 w/w % to about 0.080 w/w %, for example about 0.050 w/w % when the substrate (e.g. EEH or BisEEH) is used at 4 g/l with cells to an OD.sub.650 nm of 10. The optimum concentration of sodium dodecyl sulfate (SDS) in the reaction medium of the processes for making ()-Ambrox or Ambra oxide disclosed herein may, for example, be from about 1.0 w/w % to about 1.5 w/w % when the substrate (e.g. EEH or BisEEH) is used at 125 g/l with 250 g/l of cells. For example, the optimum concentration of SDS may be from about 1.2 w/w % to about 1.4 w/w %, for example about 1.3 w/w % when the substrate (e.g. EEH or BisEEH) is used at 125 g/l with 250 g/l of cells.

    [0568] The processes for making ()-Ambrox or Ambra oxide disclosed herein may be carried out at the optimum temperature range or optimum temperature and/or the optimum pH range or optimum pH and/or the SDS optimum concentration range or optimum SDS concentration for the specific enzyme used, as set out in the Table 7 the Examples below.

    [0569] As discussed above, it has surprisingly been found that SHC/HAC enzyme variants as defined herein (of all types 1-34) derived from an Aac SHC/HAC enzyme variant exhibit improved biological activity such as improved enzymatic activity for the conversion of EEH to ()-Ambrox and for the conversion of BisEEH to Ambra oxide. The new SHC/HAC enzyme variants have at least one, two or three amino acid alterations in addition to the amino acid substitutions already present in the 215G2 SHC/HAC (SEQ ID NO:3) or the SHC #65 (SEQ ID NO:2) enzyme variant.

    [0570] Additional SHC/HAC enzyme variants (variant of type 29) may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 81, 90, 172, 277, 431, 557 and 613 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 81, 90, 172, 277, 557, 613 of SEQ ID NO:1, 2, 3).

    [0571] In particular, it is expected that SHC/HAC enzyme variants derived from other non-Aac species but having one or more of the new amino acid alterations identified at positions 169, 306, 600, 81, 90, 172, 277, 431, 557 and 613 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 81, 90, 172, 277, 557, 613 of SEQ ID NO:1, 2, 3) will also provide enzymatic activity for the conversion of EEH to ()-Ambrox or BisEEH to Ambra oxide. In particular, it is expected that enzyme variants derived from ZmoSHC1, ZmoSHC2, BjpSHC, GmoSHC, TeISHC, ApaSHC1, BmeSHC, SaISHC, or ApaSHCA having one or more of the new amino acid alterations identified at positions 169, 306, 600, 81, 90, 172, 277, 431, 557 and 613 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 81, 90, 172, 277, 557, 613 of SEQ ID NO:1, 2, 3) will also provide enzymatic activity for the conversion of EEH to ()-Ambrox or BisEEH to Ambra oxide.

    [0572] There is therefore provided herein a process for making ()-Ambrox by enzymatically converting EEH to ()-Ambrox. There is also provided herein a process for making Ambra oxide by enzymatically converting E,E-bishomofarnesol to Ambra oxide. These processes may use any SHC/HAC enzyme variant described herein.

    [0573] In addition, there is provided herein a SHC/HAC enzyme variant (also named variant of type 30) having at least about 70.0% identity to a wild-type SHC/HAC enzyme amino acid sequence, wherein the SHC/HAC enzyme variant amino acid sequence has one or more amino acid alterations relative to the wild-type SHC/HAC enzyme at a position selected from positions corresponding to positions 169, 306, 600, 81, 90, 172, 277, 431, 557 and 613 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 81, 90, 172, 277, 557, 613 of SEQ ID NO:1, 2, or 3).

    [0574] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0575] In particular, there is provided herein a process for preparing ()-Ambrox or a mixture comprising ()-Ambrox, the process comprising enzymatically converting EEH or a mixture comprising EEH to ()-Ambrox or a mixture comprising ()-Ambrox using a SHC/HAC variant as defined herein. All SHC/AHC variants defined herein (all types 1-34) may be used in such a process.

    [0576] In particular, there is provided herein a process for preparing Ambra oxide or a mixture comprising Ambra oxide, the process comprising enzymatically converting BisEEH or a mixture comprising BisEEH to Ambra oxide or a mixture comprising Ambra oxide using a SHC/HAC variant having at least about 70.0% identity to a wild-type SHC/HAC enzyme amino acid sequence, wherein the SHC/HAC enzyme variant amino acid sequence has one or more amino acid alterations relative to the wild-type SHC/HAC enzyme at a position selected from positions corresponding to positions 169, 306, 600, 81, 90, 172, 277, 431, 557 and 613 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 81, 90, 172, 277, 557, 613 of SEQ ID NO:1, 2, or 3).

    [0577] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0578] In addition, there is provided herein a SHC/HAC enzyme variant (also named variant of type 31) having at least about 70.0% identity to a wild-type SHC/HAC enzyme amino acid sequence, wherein the SHC/HAC enzyme variant amino acid sequence has one or more amino acid alterations relative to the wild-type SHC/HAC enzyme at a position selected from positions corresponding to positions 169, 306, 600, 77, 92, 129, 579, 601, 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20. 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33 and/or 34, 55-296, 307-310 corresponding to 169, 306, 600, 77, 92, 129, 579, 601, 605 of SEQ ID NO:1, 2, or 3).

    [0579] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0580] In particular, there is provided herein a process for preparing Ambra oxide or a mixture comprising Ambra oxide, the process comprising enzymatically converting BisEEH or a mixture comprising BisEEH to Ambra oxide or a mixture comprising Ambra oxide using a SHC/HAC variant having at least about 70.0% identity to a wild-type SHC/HAC enzyme amino acid sequence, wherein the SHC/HAC enzyme variant amino acid sequence has one or more amino acid alterations relative to the wild-type SHC/HAC enzyme at a position selected from positions corresponding to positions 169, 306, 600, 77, 92, 129, 579, 601, 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33 and/or 34, 55-296, 307-310 corresponding to 169, 306, 600, 77, 92, 129, 579, 601, 605 of SEQ ID NO:1, 2, or 3).

    [0581] In this context, the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0582] In each of the type of SHC/HAC enzyme variants disclosed herein (types 1-34), the identity of the amino acid substituting a given position has already been earlier disclosed herein and each of these types may thus further be defined by the specific identity of the amino acid substituting the amino acid altered.

    [0583] Moreover, the identity of the amino acid substituting W169, A306 and G600 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600 of SEQ ID NO:1, 2, or 3) has already been disclosed herein. These specific key positions and identity of substituting amino acids are repeated below. [0584] the W at position 169 is replaced by G, A or V or a functional equivalent thereof, preferably wherein the W at position 169 is replaced by G, [0585] the A at position 306 is replaced by V or a functional equivalent thereof and/or [0586] the G at position 600 is replaced by A, V, L, I or M or a functional equivalent thereof, preferably wherein the G at position 600 is replace by M.

    [0587] In addition, in an embodiment, where the amino acid residue at position 168 has a large amino acid side chain (eg Tyrosine (Q), it is replaced by an amino acid residue with a smaller side chain (eg serine).

    [0588] In another embodiment, where the amino acid residue at position 168 is a serine (S) residue, it should be retained (as in WT AacSHC and WT TeISHC) Table 10: Conserved positions of amino acids located at the active site of the SHC/HAC (based on Aac SHC/HAC). Conserved positions can be seen for amino acid positions 169, 261, 312, 365, 489, 600, 609 and 612 for five different WT SHC enzymes. Differences in hydrogen binding pocket can be seen for Q, Y and C in ZmoSHC1, ZmoSHC2 and ScoSHC for the amino acid position 168.

    [0589] Sequence identity to AacSHC (%) 0 45.8 38.3 44.2 51.0 active site amino acid position based on AacSHC AacSHC ZmoSHC1 ZmoSHC2 TeISHC ScoSHC

    TABLE-US-00010 TABLE 10 Conserved positions of amino acids located at the active site of the SHC/HAC (based on Aac SHC/HAC). Conserved positions can be seen for amino acid positions 169, 261, 312, 365, 489, 600, 609 and 612 for five different WT SHC enzymes. Differences in hydrogen binding pocket can be seen for Q, Y and C in ZmoSHC1, ZmoSHC2 and ScoSHC for the amino acid position 168. active site amino acid Sequence identity to AacSHC (%) position based 0 45.8 38.3 44.2 51.0 on AacSHC AacSHC ZmoSHC1 ZmoSHC2 TelSHC ScoSHC 36 L V L L L 168 S Q Y S C 169 W W W W W 261 I I I I I 306 A A P P A 307 S T C C C 312 W W W W W 365 F F F F F 366 Q E Q E E 420 Y F F F F 489 W W W W W 600 G G G G G 607 L L L L I 609 Y Y Y Y Y 612 Y Y Y Y Y conserved (bold font) difference in hydrogen-binding pocket (italic font)

    Substrate: Homofarnesol

    [0590] Homofarnesol may have isomerism as shown below.

    TABLE-US-00011 TABLE 11 Homofarnesol isomers. Compound Abbreviation Name and Structure E,E-Homofarnesol EEH [00001]embedded image (3E,7E)-4,8,12-trimethyltrideca-3,7,11-trien-1-ol E,Z-Homofarnesol EZH [00002]embedded image (3Z,7E)-4,8,12-trimethyltrideca-3,7,11-trien-1-ol Z,E-Homofarnesol ZEH [00003]embedded image (3E,7Z)-4,8,12-trimethyltrideca-3,7,11-trien-1-ol Z,Z-Homofarnesol ZZH [00004]embedded image (3Z,7Z)-4,8,12-trimethyltrideca-3,7,11-trien-1-ol [00005]text missing or illegible when filed

    [0591] Beta-farnesene can be converted directly to E,E-homofarnesol (EEH) or indirectly to EEH via E,E-homofarnesate which is then converted to EEH. An overview on the production of ()-Ambrox from different substrates can be found in US2012/0135477A1, WO 2010/139719, US2013.0273619A1, WO 2013/156398A1 and the Seitz PhD thesis (2012 as cited above) and Schaefer 2011 (Chemie Unserer Zeit 45, 374-388), the contents of which are incorporated herein by reference.

    [0592] US2012/0135477A1 reports on the conversion of (3Z,7E) to ()-Ambrox using ZmoSHC but according to the disclosure in Schaefer (2011) (as cited above), (7E,3Z) is only converted to 9b-epi-Ambrox (i.e. compound (III) as outlined above) and not to ()-Ambrox. As used herein, a reference to (3Z,7E) homofarnesol is a reference to E,Z-homofarnesol which is also designated as EZH.

    [0593] Whilst homofarnesol may be a mixture of four isomers, the (3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E) isomers, it seems from the literature that ()-Ambrox is only obtained from (3E,7E) homofarnesol (see Neumann and Simon (1986) as cited above). As used herein, a reference to (3E,7E)-homofarnesol is a reference to E,E-homofarnesol which is also designated as EEH.

    [0594] The starting materials for the processes described herein for preparing ()-Ambrox may, for example, be (3E,7E)-homofarnesol or a mixture comprising (3E,7E)-homofarnesol, for example a mixture of isomers of homofarnesol comprising (3E,7E)-homofarnesol.

    [0595] Preferably the homofarnesol starting material comprises a mixture of (3E,7E) and (3Z,7E), termed herein an EE:EZ isomeric mixture. An EE:EZ isomeric mixture of homofarnesol has the CAS number of 35826-67-6.

    ##STR00006##

    [0596] The homofarnesol feedstock/starting material may be a mixture of isomers. Accordingly, the homofarnesol starting material may also comprise a mixture of the four isomers EE:EZ:ZZ:ZE which corresponds with (3E,7E), (3Z,7E), (3Z,7Z) and (3E,7Z). Preferably, the homofarnesol starting material is selected from one of more of the following mixture: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)].

    [0597] Preferably the homofarnesol starting material is selected from one or more of the following mixtures: [(3E,7E), (3Z,7E)] and/or [(3Z,7E), (3E/7E) and (3E,7Z)], also designated [EE:EZ] and [EE:EZ:ZE] respectively.

    [0598] Accordingly, in certain embodiments, the ratio of EEH:EZH is about 100:00; 99:01; 98:02; 97:03; 96:04; 95:05; 94:06; 93:07; 92:08; 91:09; 90:10; 89:11; 88:12; 87:13; 86:14; 85:15; 84:16; 83:17; 82:18; 81:19; 80:20; 79:21; 78:22; 77:23; 76:24; 75:25; 74:26; 73:27; 72:28; 71:29; 70:30; 69:31; 68:32; 67:33; 66:34; 65:35; 64:36; 63:37; 62:38:61:39; 60:40; 59:41; 58:42; 57:43; 56:44; 55:45:54:46; 53:47:52:48; 51:49; or about 50:50. For example, the ratio of EEH:EZH may range from about 50:50 to about 100:00 or from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.

    [0599] In some embodiments the homofarnesol starting material comprises >90% E,E-homofarnesol (EEH).

    [0600] In other embodiments, the homofarnesol starting material comprises an EE:EZ weight ratio of 86:14.

    [0601] In certain embodiments, the homofarnesol starting material comprises an EE:EZ weight ratio of 80:20.

    [0602] In certain embodiments, the homofarnesol starting material comprises an EE:EZ weight ratio of 70:30.

    [0603] In further embodiments, the homofarnesol starting material comprises an EE:EZ weight ratio of 69:31.

    [0604] The number of homofarnesol isomers present may influence the speed of the reaction. A SHC/HAC enzyme or enzyme variant may be capable of converting E,E-homofarnesol to ()-Ambrox from a complex mixture of homofarnesol isomers (e.g. EE:EZ:ZE:ZZ). However, a lower conversion rate may be observed, which is consistent with the view that homofarnesol isomers other than EEH may compete with EEH for access to the SHC/HAC derivative enzymes and thus may act as competitive inhibitors for the conversion of EEH to ()-Ambrox and/or also act as alternative substrates (see for example, Eichhorn et al (2018) Adv. Synth. Catal. 360: 2339-2351, the contents of which are incorporated here by reference). Accordingly, the homofarnesol substrate may comprise a isomeric mixture of 2-4 isomers, preferably two isomers.

    [0605] Accordingly, the homofarnesol substrate may consist of or consist essentially of a isomeric mixture of 2-4 isomers, preferably two isomers.

    [0606] Preferably the homofarnesol substrate comprises an EE:EZ isomeric mixture. Preferably the homofarnesol substrate consists of or consists essentially of an EE:EZ isomeric mixture.

    [0607] If, for example, an EE:EZ isomer mixture is used, then compounds (eg compounds II, Ill and IV as set out in Table 3) other than ()-Ambrox are in an oily form (rather than a solid form) which facilates the stirring of the reaction mixture and ths resulting bioconversion process. In addition when the P1/P2/P3 SHC variants as disclosed and described herein are used to cyclise homofarnesol in a bioconversion process for producing ()-Ambrox, a reduced cell:homofarnesol substrate ratio may be used leading to a reduction in the amount of solid material (eg cells and ()-Ambrox)) in the reaction mixture which is advantageous not only for the stirrability of the reaction mixture but also for downstream processing (especially as regards filtration) as the solid cell mass is reduced meaning that there is less likelihood of filtration membrane congestion and the like.

    [0608] In an embodiment, a cell to EEH ratio of 0.5 or 0.4 or 0.3 or 0.2 or 0.1 is used. In an embodiment, when such a cell to EEH ratio is used, the EEH conversion is of at least 50%, 60%, 70%, 80%, 90%, 95% or 98%. In an embodiment, such a cell to EEH ratio is used even when 100 or 150 or 200 or even 250 g/l EEH is present. In an embodiment when such cell to EEH ratio is used and such concentration of EEH is used a conversion of up to 4.5 or 5.0 or 5.5 or even 5.9 or 6.0 g of EEH is converted per gram of cells. Such results have been obtained in the experimental part (see example 9). In the context of the reference to the cell to EEH ratio, EEH may be present in a mixture with other isomer of homofarnesol as described herein. We refer to the total concentration of EEH present even if other isomer of homofarnesol may be present.

    Bishomofarnesol Bishomofarnesol may have isomerism as shown in Table 12 below.

    TABLE-US-00012 TABLE 12 Bishomofarnesol isomers. Compound Abbreviation Name and Structure E,E-Bisomofarnesol BisEEH [00007]embedded image (4E,8E)-5,9,13-trimethyltetradeca-4,8,12-trien-1-ol E,Z-Bishomofarnesol BisEZH [00008]embedded image (4Z,8E)-5,9,13-trimethyltetradeca-4,8,12-trien-1-ol Z,E-Bishomofarnesol BisZEH [00009]embedded image (4E,8Z)-5,9,13-trimethyltetradeca-4,8,12-trien-1-ol Z,Z-Bishomofarnesol BisZZH [00010]embedded image (4Z,8Z)-5,9,13-trimethyltetradeca-4,8,12-trien-1-ol

    [0609] Bishomofarnesol may be produced from E-Nerolidol as described in WO 2021/110848. For example, bishomofarnesol may be produced as a mixture of two or more isomers (e.g. a mixture of E,E-bishomofarnesol and E,Z-bishomofarnesol). Whilst bishomofarnesol may present as a mixture of four isomers (the (Z,Z), (E,Z), (Z,E) and (E,E) isomers) it seems that Ambra oxide is only obtained from E,E-bishomofarnesol.

    [0610] The starting materials for the processes described herein for preparing Ambra oxide may, for example, be E,E-bishomofarnesol or a mixture comprising E,E-bishomofarnesol, for example a mixture of isomers of bishomofarnesol comprising E,E-bishomofarnesol.

    [0611] Preferably the bishomofarnesol starting material comprises a mixture of (BisEEH) and (BisEZH), termed herein an EE:EZ isomeric mixture.

    [0612] The bishomofarnesol feedstock/starting material may be a mixture of isomers. Accordingly, the bishomofarnesol starting material may also comprise a mixture of the four isomers EE:EZ:ZZ:ZE.

    [0613] Accordingly, in certain embodiments, the ratio of BisEEH:BisEZH is about 100:00; 99:01; 98:02; 97:03; 96:04; 95:05; 94:06; 93:07; 92:08; 91:09; 90:10; 89:11; 88:12; 87:13; 86:14; 85:15; 84:16; 83:17; 82:18; 81:19; 80:20; 79:21; 78:22; 77:23; 76:24; 75:25; 74:26; 73:27; 72:28; 71:29; 70:30; 69:31; 68:32; 67:33; 66:34; 65:35; 64:36; 63:37; 62:38:61:39; 60:40; 59:41; 58:42; 57:43; 56:44; 55:45:54:46; 53:47:52:48; 51:49; or about 50:50. For example, the ratio of BisEEH:BisEZH may range from about 50:50 to about 100:00 or from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.

    [0614] In some embodiments preferably the bishomofarnesol starting material comprises >90% E,E-bishomofarnesol (EEH).

    [0615] In other embodiments, the bishomofarnesol starting material comprises an BisEEH:BisEZH weight ratio of 86:14. In certain embodiments, the bishomofarnesol starting material comprises a BisEEH:BisEZH weight ratio of 80:20.

    [0616] In certain embodiments, the bishomofarnesol starting material comprises a BisEEH:BisEZH weight ratio of 70:30.

    [0617] In further embodiments, the bishomofarnesol starting material comprises an BisEEH:BisEZH weight ratio of 69:31 or 65:35 The number of bishomofarnesol isomers present may influence the speed of the reaction. A SHC/HAC enzyme or enzyme variant may be capable of converting E,E-bishomofarnesol to Ambra oxide from a complex mixture of bishomofarnesol isomers (e.g. EE:EZ:ZE:ZZ). However, a lower conversion rate may be observed, which is consistent with the view that bishomofarnesol isomers other than BisEEH may compete with BisEEH for access to the SHC/HAC enzyme or enzyme variant and thus may act as competitive inhibitors for the conversion of BisEEH to Ambra oxide and/or also act as alternative substrates. Accordingly, the bishomofarnesol substrate may comprise a isomeric mixture of 2-4 isomers, preferably two isomers.

    [0618] Accordingly, the bishomofarnesol substrate may consist of or consist essentially of a isomeric mixture of 2-4 isomers, preferably two isomers.

    [0619] Preferably the bishomofarnesol substrate comprises an EE:EZ isomeric mixture.

    [0620] Preferably the bishomofarnesol substrate consists of or consists essentially of an EE:EZ isomeric mixture.

    Nucleic Acids and Methods of Making Nucleic Acids

    [0621] There is further provided herein nucleic acids encoding a SHC/HAC enzyme variant as described herein. (of types 1 to 30). The nucleic acid may, for example, be an isolated nucleic acid.

    [0622] In particular, there is provided herein a construct comprising a nucleic acid sequence encoding a SHC/HAC enzyme variant as described herein. As used herein, a construct is an artificially created segment of nucleic acid that is to be transfected into a target cell. The construct may comprise the nucleic acid encoding the SHC/HAC enzyme or enzyme variant and an expression controller (e.g. promoter).

    [0623] There is further provided herein a vector comprising a construct as described herein. As used herein, a vector is a DNA molecule that is used as a vehicle to artificially carry foreign genetic material into a cell where it can be replicated and/or expressed. The vector may, for example, be a plasmid, a viral vector, a cosmid, or an artificial chromosome.

    [0624] The terms construct and vector may overlap, for example where the construct is a plasmid.

    [0625] In particular, there is provided herein a nucleic acid encoding an amino acid sequence of any one of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12 and as identified below: In an embodiment, SEQ ID NO: 38 is the nucleotide sequence encoding the AacSHC P1 represented by SEQ ID NO:4.

    [0626] In an embodiment, SEQ ID NO: 39 is the nucleotide sequence encoding the AacSHC P2 represented by SEQ ID NO:5.

    [0627] In an embodiment, SEQ ID NO: 40 is the nucleotide sequence encoding the AacSHC P3 represented by SEQ ID NO:6.

    [0628] In an embodiment, SEQ ID NO: 41 is the nucleotide sequence encoding the SHC #65 P1 variant represented by SEQ ID NO:7.

    [0629] In an embodiment, SEQ ID NO: 42 is the nucleotide sequence encoding the SHC #65 P2 variant represented by SEQ ID NO:8.

    [0630] In an embodiment, SEQ ID NO: 43 is the nucleotide sequence encoding the SHC #65 P3 variant represented by SEQ ID NO:9.

    [0631] In an embodiment, SEQ ID NO: 44 is the nucleotide sequence encoding the 215G2 P1 variant represented by SEQ ID NO:10.

    [0632] In an embodiment, SEQ ID NO: 45 is the nucleotide sequence encoding the 215G2 P2 variant represented by SEQ ID NO:11.

    [0633] In an embodiment, SEQ ID NO: 46 is the nucleotide sequence encoding the 215G2 P3 variant represented by SEQ ID NO:12.

    [0634] The term nucleic acid or nucleic acid molecule as used herein shall specifically refer to polynucleotides of the disclosure which can be DNA, cDNA, genomic DNA, synthetic DNA, or RNA, and can be double-stranded or single-stranded, the sense and/or an antisense strand. The term nucleic acid or nucleic acid molecule shall particularly apply to the polynucleotide(s) as used herein, e.g. as full-length nucleotide sequence or fragments or parts thereof, which encode a polypeptide with enzymatic activity, e.g. an enzyme of a metabolic pathway, or fragments or parts thereof, respectively.

    [0635] The term also includes a separate molecule such as a cDNA where the corresponding genomic DNA has introns and therefore a different sequence; a genomic fragment that lacks at least one of the flanking genes; a fragment of cDNA or genomic DNA produced by polymerase chain reaction (PCR) and that lacks at least one of the flanking genes; a restriction fragment that lacks at least one of the flanking genes; a DNA encoding a non-naturally occurring protein such as a fusion protein (e.g. a His tag), mutein, or fragment of a given protein; and a nucleic acid which is a degenerate variant of a cDNA or a naturally occurring nucleic acid. In addition, it includes a recombinant nucleotide sequence that is part of a hybrid gene, i.e. a gene encoding a non-naturally occurring fusion protein. Fusion proteins can add one or more amino acids (such as but not limited to Histidine (His)) to a protein, usually at the N-terminus of the protein but also at the C-terminus or fused within regions of the protein. Such fusion proteins or fusion vectors encoding such proteins typically serve three purposes: (i) to increase production of recombinant proteins; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by providing a ligand for affinity purification.

    [0636] The term nucleic acid or nucleic acid molecule also includes codon optimised sequences suitable for expression in a particular microbial host cell (e.g. E. coli host cell). As used herein, the term codon optimized means a nucleic acid protein coding sequence which has been adapted for expression in a prokaryotic or a eukaryotic host cell, particularly bacterial host cells such as E. coli host cells by substitution of one or more or preferably a significant number of codons with codons that are more frequently used in bacterial (e.g. E. coli) host cell genes.

    [0637] In this regard, the nucleotide sequence encoding the reference amino acid sequence (SEQ ID NO: 1 or 2 or 3 or the gene can be codon-optimized for the selected host organisms, such as e.g. E. coli.

    [0638] A nucleotide sequence encoding the wild type Aac SHC (SEQ ID NO:1) is SEQ ID NO:35.

    [0639] A nucleotide sequence encoding the parent SHC (SEQ ID NO:2) is SEQ ID NO:36.

    [0640] A nucleotide sequence encoding the other patent SHC (SEQ ID NO:3) is SEQ ID NO:37.

    [0641] A ribonucleic acid (RNA) molecule can be produced by in vitro transcription. Segments of DNA molecules are also considered within the scope of the disclosure, and can be produced by, for example, the polymerase chain reaction (PCR) or generated by treatment with one or more restriction endonucleases. Segments of a nucleic acid molecule may be referred to as DNA fragments of a gene, in particular those that are partial genes. A fragment can also contain several open reading frames (ORF), either repeats of the same ORF or different ORF's. The term shall specifically refer to coding nucleotide sequences, but shall also include nucleotide sequences which are non-coding, e.g. untranscribed or untranslated sequences, or encoding polypeptides, in whole or in part. The genes as used herein, e.g. for assembly, diversification or recombination can be non-coding sequences or sequences encoding polypeptides or protein encoding sequences or parts or fragments thereof having sufficient sequence length for successful recombination events. More specifically, said genes have a minimum length of 3 bp, preferably at least 100 bp, more preferred at least 300 bp. It will be apparent from the foregoing that a reference to an isolated DNA does not mean a DNA present among hundreds to millions of other DNA molecules within, for example, cDNA or genomic DNA libraries or genomic DNA restriction digests in, for example, a restriction digest reaction mixture or an electrophoretic gel slice. An isolated nucleic acid molecule of the present disclosure encompasses segments that are not found as such in the natural state.

    [0642] As used herein, the term isolated DNA can refer to (1) a DNA that contains sequence not identical to that of any naturally occurring sequence, a polynucleotide or nucleic acid which is not naturally occurring, (e.g. is made by the artificial combination (e.g. artificial manipulation of isolated segments of nucleic acids, e.g. by genetic engineering techniques) of two otherwise separated segments of sequences through human intervention) or (2), in the context of a DNA with a naturally-occurring sequence (e.g. a cDNA or genomic DNA), a DNA free of at least one of the genes that flank the gene containing the DNA of interest in the genome of the organism in which the gene containing the DNA of interest naturally occurs.

    [0643] The term isolated DNA as used herein, specifically with respect to nucleic acid sequences may also refer to nucleic acids or polynucleotides produced by recombinant DNA techniques, e.g. a DNA construct comprising a polynucleotide heterologous to a host cell, which is optionally incorporated into the host cell. A chimeric nucleotide sequence may specifically be produced as a recombinant molecule. The term recombination shall specifically apply to assembly of polynucleotides, joining together such polynucleotides or parts thereof, with or without recombination to achieve a cross-over or a gene mosaic. For example, it is performed to join together nucleic acid segments of desired functions to generate a desired combination of functions. A recombinant gene encoding a polypeptide described herein may include the coding sequence for that polypeptide, operably linked, in sense orientation, to one or more regulatory regions suitable for expressing the polypeptide. Because many microorganisms are capable of expressing multiple gene products from a polycistronic mRNA, multiple polypeptides can be expressed under the control of a single regulatory region for those microorganisms, if desired. A coding sequence and a regulatory region are considered to be operably linked when the regulatory region and coding sequence are positioned so that the regulatory region is effective for regulating transcription or translation of the sequence.

    [0644] The term recombinant as used herein, specifically with respect to enzymes shall refer to enzymes produced by recombinant DNA techniques, i.e. produced from cells transformed by an exogenous DNA construct encoding the desired enzyme. Synthetic enzymes are those prepared by chemical synthesis. A chimeric enzyme may specifically be produced as recombinant molecule. The term recombinant DNA therefore includes a recombinant DNA incorporated into a vector into an autonomously replicating plasmid or virus, or into the genomic DNA of a prokaryote or eukaryote (or the genome of a homologous cell, at a position other than the natural chromosomal location).

    [0645] In a further aspect the nucleic acid molecule(s) of the present disclosure is/are operatively linked to expression control sequences allowing expression in prokaryotic and/or eukaryotic host cells. As used herein, operatively linked means incorporated into a genetic construct so that expression control sequences effectively control expression of a coding sequence of interest. The transcriptional/translational regulatory elements referred to above include but are not limited to inducible and non-inducible, constitutive, cell cycle regulated, metabolically regulated promoters, enhancers, operators, silencers, repressors and other elements that are known to those skilled in the art and that drive or otherwise regulate gene expression. Such regulatory elements include but are not limited to regulatory elements directing constitutive expression or which allow inducible expression like, for example, CUP-1 promoter, the tet-repressor as employed, for example, in the tet-on or tet-off systems, the lac system, the trp system regulatory elements. By way of example, Isopropyl p-D-1-thiogalactopyranoside (IPTG) is an effective inducer of gene expression in the concentration range of 100 M to 1.0 mM. This compound is a molecular mimic of allolactose, a lactose metabolite that triggers transcription of the lac operon, and it is therefore used to induce gene expression when the gene is under the control of the lac operator. Another example of a regulatory element which induces gene expression is lactose. Similarly, the nucleic acid molecule(s) of the present disclosure can form part of a hybrid gene encoding additional polypeptide sequences, for example, a sequence that functions as a marker or reporter. Examples of marker and reporter genes including beta-lactamase, chloramphenicol acetyltransferase (CAT), adenosine deaminase (ADA), aminoglycoside phosphotransferase dihydrofolate reductase (DHFR), hygromycin-B-phosphotransferase (HPH), thymidine kinase (TK), lacZ (encoding beta-galactosidase), and xanthine guanine phosphoribosyltransferase (XGPRT). As with many of the standard procedures associated with the practice of the disclosure, skilled artisans will be aware of additional useful reagents, for example, additional sequences that can serve the function of a marker or reporter.

    [0646] In some embodiments, the present disclosure provides a recombinant polynucleotide encoding the SHC/HAC enzyme or variant thereof, which may be inserted into a vector for expression and optional purification. One type of vector is a plasmid representing a circular double stranded DNA loop into which additional DNA segments are ligated. Certain vectors can control the expression of genes to which they are functionally linked. These vectors are called expression vectors. Usually expression vectors suitable for DNA recombination techniques are of the plasmid type. Typically, an expression vector comprises a gene such as the SHC/HAC enzyme or variant thereof as described herein. In the present description, the terms plasmid and vector may be used interchangeably since the plasmid is the vector type most often used. Such vectors can include DNA sequences which include but are not limited to DNA sequences that are not naturally present in the host cell, DNA sequences that are not normally transcribed into RNA or translated into a protein (expressed) and other genes or DNA sequences which one desires to introduce into the non-recombinant host. It will be appreciated that typically the genome of a recombinant host described herein is augmented through the stable introduction of one or more recombinant genes. However, autonomous or replicative plasmids or vectors can also be used within the scope of this disclosure. Moreover, the present disclosure can be practiced using a low copy number, e.g. a single copy, or high copy number (as exemplified herein) plasmid or vector.

    [0647] In a preferred embodiment, the vector of the present disclosure includes plasmids, phagemids, phages, cosmids, artificial bacterial and artificial yeast chromosomes, knock-out or knock-in constructs, synthetic nucleic acid sequences or cassettes and subsets may be produced in the form of linear polynucleotides, plasmids, megaplasmids, synthetic or artificial chromosomes, such as plant, bacterial, mammalian or yeast artificial chromosomes.

    [0648] It is preferred that the proteins encoded by the introduced polynucleotide are expressed within the cell upon introduction of the vector. The diverse gene substrates may be incorporated into plasmids. The plasmids are often standard cloning vectors, e.g. bacterial multicopy plasmids. The substrates can be incorporated into the same or different plasmids. Often at least two different types of plasmid having different types of selectable markers are used to allow selection for cells containing at least two types of vectors.

    [0649] Typically, bacterial or yeast cells may be transformed with any one or more nucleotide sequences as is well known in the art. For in vivo recombination, the gene to be recombined with the genome or other genes is used to transform the host using standard transforming techniques. In a suitable embodiment DNA providing an origin of replication is included in the construct. The origin of replication may be suitably selected by the skilled person. Depending on the nature of the genes, a supplemental origin of replication may not be required if sequences are already present with the genes or genome that are operable as origins of replication themselves.

    Host Cells, Methods of Making Host Cells, and Methods of Making Ambrox and Ambra Oxide Using Host Cells

    [0650] There is further provided herein a recombinant host cell comprising a nucleic acid sequence or a construct or a vector as described herein. There is further provided herein a recombinant host cell that produces a SHC/HAC enzyme or enzyme variant as described herein. A recombinant host cell may also be named an engineered cell or a cell.

    [0651] The processes described herein for producing ()-Ambrox or Ambra oxide may, for example, comprise culturing a recombinant host cell as described herein. As used herein, the term culturing refers to a process of producing living cells such that they produce a SHC/HAC enzyme or enzyme variant as described herein (such as those of the types 1 to 30) that can be used in a process for producing ()-Ambrox or Ambra oxide as described herein. It is not necessary for the cells to divide and replicate themselves, although this is not excluded.

    [0652] A bacterial or yeast cell may be transformed by exogenous or heterologous DNA when such DNA has been introduced inside the cell. The transforming DNA may or may not be integrated, i.e. covalently linked into the genome of the cell. In prokaryotes, and yeast, for example, the transforming DNA may be maintained on an episomal element such as a plasmid. With respect to eukaryotic cells, a stably transfected cell is one in which the transfected DNA has become integrated into a chromosome so that it is inherited by daughter cells through chromosome replication. This stability is demonstrated by the ability of the eukaryotic cell to establish cell lines or clones comprised of a population of daughter cells containing the transforming DNA.

    [0653] Generally, the introduced DNA is not originally resident in the host that is the recipient of the DNA, but it is within the scope of the disclosure to isolate a DNA segment from a given host, and to subsequently introduce one or more additional copies of that DNA into the same host, e.g. to enhance production of the product of a gene or alter the expression pattern of a gene. In some instances, the introduced DNA will modify or even replace an endogenous gene or DNA sequence, e.g. by homologous recombination or site-directed mutagenesis. Suitable recombinant hosts include microorganisms, plant cells, and plants.

    [0654] The present disclosure also features recombinant hosts. The term recombinant host, also referred to as a genetically modified host cell or a transgenic cell denotes a host cell that comprises a heterologous nucleic acid or the genome of which has been augmented by at least one incorporated DNA sequence. A host cell of the present disclosure may be genetically engineered with the polynucleotide or the vector as outlined above.

    [0655] The host cells that may be used for purposes of the disclosure include but are not limited to prokaryotic cells such as bacteria (for example, E. coli and B. subtilis), which may, for example, be transformed with, for example, recombinant bacteriophage DNA, plasmid DNA, bacterial artificial chromosome, or cosmid DNA expression vectors containing the polynucleotide molecules of the disclosure; simple eukaryotic cells like yeast (for example, Saccharomyces and Pichia), which may, for example, be transformed with, for example, recombinant yeast expression vectors containing the polynucleotide molecule of the disclosure. Depending on the host cell and the respective vector used to introduce the polynucleotide of the disclosure the polynucleotide can integrate, for example, into the chromosome or the mitochondrial DNA or can be maintained extrachromosomally like, for example, episomally or can be only transiently comprised in the cells.

    [0656] The term cell as used herein in particular with reference to genetic engineering and introducing one or more genes or an assembled cluster of genes into a cell, or a production cell is understood to refer to any prokaryotic or eukaryotic cell. Prokaryotic and eukaryotic host cells are both contemplated for use according to the disclosure, including bacterial host cells like E. coli or Bacillus sp, yeast host cells, such as S. cerevisiae, insect host cells, such as Spodoptora frugiperda or human host cells, such as HeLa and Jurkat.

    [0657] Specifically, the cell is a eukaryotic cell, preferably a fungal, mammalian or plant cell, or a prokaryotic cell. Suitable eukaryotic cells include, for example, without limitation, mammalian cells, yeast cells, or insect cells (including Sf9), amphibian cells (including melanophore cells), or worm cells including cells of Caenorhabditis (including Caenorhabditis elegans). Suitable mammalian cells include, for example, without limitation, COS cells (including Cos-1 and Cos-7), CHO cells, HEK293 cells, HEK293T cells, HEK293 T-Rex cells, or other transfectable eucaryotic cell lines. Suitable bacterial cells include without limitation E. coli.

    [0658] Preferably prokaryotes, such as E. coli, Bacillus, Streptomyces, or mammalian cells, like HeLa cells or Jurkat cells, or plant cells, like Arabidopsis, may be used.

    [0659] The cell may, for example, be selected from prokaryotic, yeast, plant, and/or insect host cells. Preferably the cell is an Aspergillus sp. or a fungal cell, preferably, it can be selected from the group consisting of the genera Saccharomyces, Candida, Kluyveromyces, Hansenula, Schizosaccharomyces, Yarrowia, Pichia and Aspergillus.

    [0660] Preferably, the cell us a bacteria cells, for example, having a genus selected from Escherichia, Streptomyces, Bacillus, Pseudomonas, Lactobacillus and Lactococcus. For example, the bacteria may be E. coli.

    [0661] Preferably the E. coli host cell is an E. coli host cell which is recognized by the industry and regulatory authorities (including but not limited to an E. coli K12 host cell or an E. coli BL21 host cell).

    [0662] One preferred host cell to use with the present disclosure is E. coli, which may be recombinantly prepared as described herein. Thus, the recombinant host may be a recombinant E. coli host cell. There are libraries of mutants, plasmids, detailed computer models of metabolism and other information available for E. coli, allowing for rational design of various modules to enhance product yield. Methods similar to those described above for Saccharomyces can be used to make recombinant E. coli micro-organisms.

    [0663] In one embodiment, the recombinant E. coli microorganism comprises nucleotide sequences encoding SHC/HAC enzyme or enzyme variant genes.

    [0664] Preferably, the recombinant E. coli microorganism comprises a vector construct as described herein. In another preferred embodiment, the recombinant E. coli microorganism comprises nucleotide sequences encoding the SHC/HAC enzymes and enzyme variants disclosed herein.

    [0665] Another preferred host cell to use with the present disclosure is S. cerevisiae which is a widely used chassis organism in synthetic biology. Thus, the recombinant host may be S. cerevisiae. There are libraries of mutants, plasmids, detailed computer models of metabolism and other information available for S. cerevisiae, allowing for rational design of various modules to enhance product yield. Methods are known for making recombinant S. cerevisiae microorganisms.

    [0666] Culturing of cells may be performed in a conventional manner. The culture medium may contain a carbon source, at least one nitrogen source and inorganic salts, and vitamins are added to it. The constituents of this medium can be the ones which are conventionally used for culturing the species of microorganism in question. Carbon sources of use in the instant method include any molecule that can be metabolized by the recombinant host cell to facilitate growth and/or production of ()-Ambrox or Ambra oxide. Examples of suitable carbon sources include, but are not limited to, sucrose (e.g. as found in molasses), fructose, xylose, glycerol, glucose, cellulose, starch, cellobiose or other glucose containing polymer.

    [0667] In embodiments employing yeast as a host, for example, carbon sources such as sucrose, fructose, xylose, ethanol, glycerol, and glucose are suitable. The carbon source can be provided to the host organism throughout the cultivation period or alternatively, the organism can be grown for a period of time in the presence of another energy source, e.g. protein, and then provided with a source of carbon only during the fed-batch phase.

    [0668] The suitability of a recombinant host cell microorganism for use in the methods of the present disclosure may be determined by simple test procedures using well known methods. For example, the microorganism to be tested may be propagated in a rich medium (e.g. LB-medium, Bacto-tryptone yeast extract medium, nutrient medium and the like) at a pH, temperature and under reaction conditions commonly used for propagation of the microorganism. Once recombinant microorganisms (i.e. recombinant host cells) are selected that produce the desired products of bioconversion, the products are typically produced by a production host cell line on the large scale by suitable expression systems and fermentations, e.g. by microbial production in cell culture. In one embodiment of the present disclosure, a defined minimal medium such as M9A is used for cell cultivation.

    [0669] The components of M9A medium comprise: 14 g/l KH.sub.2PO.sub.4, 16 g/l K2HPO.sub.4, 1 g/l Na.sub.3Citrate.Math.2H.sub.2O, 7.5 g/l (NH.sub.4).sub.2SO.sub.4, 0.25 g/l MgSO.sub.4.Math.7H.sub.2O, 0.015 g/l CaCl.sub.2.Math.2H.sub.2O, 5 g/l glucose and 1.25 g/l yeast extract).

    [0670] In another embodiment of the present disclosure, nutrient rich medium such as LB was used. The components of LB medium comprise: 10 g/l tryptone, 5 g/l yeast extract, 5 g/l NaCl. Other examples of Mineral Medium and M9 Mineral Medium are disclosed, for example, in U.S. Pat. No. 6,524,831B2 and US 2003/0092143A1.

    [0671] Another example of a minimal medium may be prepared as follows: for 350 ml culture: to 35 ml citric acid/phosphate stock (133 g/l KH.sub.2PO.sub.4, 40 g/l (NH.sub.4).sub.2HPO.sub.4, 17 g/l citric acid.Math.H.sub.2O with pH adjusted to 6.3) was added 307 ml H.sub.2O, the pH adjusted to 6.8 with 32% NaOH as required. After autoclaving 0.850 ml 50% MgSO.sub.4, 0.035 ml trace elements solution (see below) solution, 0.035 ml Thiamin solution and 7 ml 20% glucose were added.

    [0672] Trace elements solution: 50 g/l Na.sub.2EDTA.Math.2H.sub.2O, 20 g/l FeSO.sub.4.Math.7H.sub.2O, 3 g/l H.sub.3BO.sub.3, 0.9 g/l MnSO.sub.4.Math.2H.sub.2O, 1.1 g/l COCl.sub.2, 80 g/L CuCl.sub.2, 240 g/l NiSO.sub.4.Math.7H.sub.2O, 100 g/l KI, 1.4 g/l (NH.sub.4).sub.6Mo.sub.7O.sub.24.Math.4H.sub.2O, 1 g/l ZnSO.sub.4.Math.7H.sub.2O, in deionized water

    [0673] Thiamin solution: 2.25 g/l Thiamin.Math.HCl in deionized water

    [0674] MgSO.sub.4 solution: 50% (w/v) MgSO.sub.4.Math.7H.sub.2O in deionized water

    [0675] The recombinant microorganism may be grown in a batch, fed batch or continuous process or combinations thereof. Typically, the recombinant microorganism is grown in a fermentor at a defined temperature(s) in the presence of a suitable nutrient source, e.g. a carbon source, for a desired period of time to produce sufficient enzyme to convert homofarnesol to Ambrox or to convert bishomofarnesol to Ambra oxide and to produce a desired amount of Ambrox including ()-Ambrox or a desired amount of Ambra oxide of formula (X). The recombinant host cells may be cultivated in any suitable manner, for example by batch cultivation or fed-batch cultivation.

    [0676] As used herein, the term batch cultivation is a cultivation method in which culture medium and/or nutrients is/are neither added nor withdrawn during the cultivation.

    [0677] As used herein, the term fed-batch means a cultivation method in which culture medium and/or nutrients is/are added during the cultivation but no culture medium is withdrawn.

    [0678] One embodiment of the present disclosure provides a method (or a process) of producing ()-Ambrox or Ambra oxide in a cellular system comprising producing SHC/HAC enzymes or enzyme variants under suitable conditions in a cellular system, adding homofarnesol or bishomofarnesol to the cellular system, converting homofarnesol to ()-Ambrox or converting bishomofarnesol to Ambra oxide using the SHC/HAC enzymes or enzyme variants produced using the cellular system, collecting ()-Ambrox or Ambra oxide from cellular system and optionally isolating the ()-Ambrox materials or Ambra oxide of formula (X) from the system.

    [0679] Each of the SHC/HAC enzyme variants earlier disclosed herein may be used in this process, (especially each of the types 1-30 disclosed earlier herein) of SHC/HAC enzyme variants.

    [0680] In an embodiment, there is provided a process for preparing ()-Ambrox or a mixture comprising ()-Ambrox, the process comprising enzymatically converting (3E,7E)-homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to ()-Ambrox or a mixture comprising ()-Ambrox using an SHC/HAC enzyme variant amino acid sequence that has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme corresponding to W169, A306 and/or G600 of SEQ ID NO:1, 2, or 3.

    [0681] In an embodiment, there is provided a process for preparing ()-Ambrox or a mixture comprising ()-Ambrox, the process comprising enzymatically converting (3E,7E)-homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to ()-Ambrox or a mixture comprising ()-Ambrox using a SHC/HAC enzyme variant having an amino acid sequence with at least 30%, identity or similarity to SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34 and/or SEQ ID NO: 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 and having amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19 or SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO:55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 corresponding to W169, A306 and/or G600 of SEQ ID NO:1, 2, or 3.

    [0682] In this context, the identity or similarity may be at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0683] In an embodiment, the amino acid alterations in the SHC/HAC variants used in said process are the following: [0684] the W at position 169 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, A or V or a functional equivalent thereof, preferably wherein the W at position 169 is replaced by G, [0685] the A at position 306 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V or a functional equivalent thereof and/or [0686] the G at position 600 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by A, V, L, I or M or a functional equivalent thereof.

    [0687] In an embodiment, the amino acid alterations in the SHC/HAC variants used in said process are the following: [0688] the amino acid at position 168 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is S or the amino acid at a position in an amino acid sequence of a wild type SHC corresponding to 168 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is S.

    [0689] In an embodiment, the SHC/HAC variants used in said process are the following: [0690] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 1, 4, 5, 6 or 350 and has at least one of the following mutations: W169G, A306V and G600M or [0691] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 1, 4, 5, 6 or 350 and have mutation W169G or [0692] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 1, 4, 5, 6 or 350 and have the following mutations: W169G and G600M or [0693] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 1, 4, 5, 6 or 350 and has at least one of the following mutations: W169G and A306V or [0694] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 1, 4, 5, 6 or 350 and have the following mutations: W169G, A306V and G600M or [0695] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 7, 8, 9 or 386, has the following mutations: M132R, A224V, 1432T, A557T, R613S, and has at least one of the following mutations: W169G, A306V and G600M or [0696] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 10, 11, 12 or 385 has the following mutations: M132R, A224V, 1432T and has at least one of the following mutations: W169G, A306V and G600M.

    [0697] In this context, the identity or similarity may be at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [0698] In an embodiment, the amino acid alterations in the SHC/HAC variants used in said process have an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10, 11, 12, 305, 306, 302, 304, 311, 312, 313, 353, 354, 355, 356, 357, 358, 359, 360, 350, 386 or 385.

    [0699] In an embodiment, the amino acid alterations in the SHC/HAC variants used in said process have an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 350, 351 or 352.

    [0700] Expression of other nucleotide sequences may serve to enhance the method. The bioconversion method can include the additional expression of other nucleotide sequences in the cellular system. The expression of other nucleotide sequences may enhance the bioconversion pathway for making ()-Ambrox or Ambra oxide. A further embodiment of the present disclosure is a bioconversion method of making ()-Ambrox or Ambra oxide comprising growing host cells comprising SHC/HAC enzyme or enzyme variant genes, producing SHC/HAC enzyme variants in the host cells, feeding homofarnesol (e.g. EEH) or bishomofarnesol (e.g. bisEEH) to the host cells, incubating the host cells under conditions of pH, temperature and solubilizing agent suitable to promote the conversion of homofarnesol to ()-Ambrox or conversion of bishomofarnesol to Ambra oxide and collecting ()-Ambrox or Ambra oxide of formula (X). The production of the SHC/HAC enzymes or enzyme variants in the host cells provides a method of making ()-Ambrox or Ambra oxide of formula (X) when homofarnesol or bishomofarnesol is added to the host cells under suitable reaction conditions. Achieved conversion may be enhanced by adding more biocatalyst and SDS to the reaction mixture.

    [0701] The recombinant host cell microorganism may be cultured in a number of ways in order to provide cells in suitable amounts producing the SHC/HAC enzymes or enzyme variants for the subsequent bioconversion step. Since the microorganisms applicable for the bioconversion step vary broadly (e.g. yeasts, bacteria and fungi), culturing conditions are, of course, adjusted to the specific requirements of each species and these conditions are well known and documented. Any of the art known methods for growing cells of recombinant host cell microorganisms may be used to produce the cells utilizable in the subsequent bioconversion step of the present disclosure.

    [0702] Typically, the cells are grown to a particular density (measurable as optical density (OD)) to produce a sufficient biomass for the bioconversion reaction.

    [0703] The cultivation conditions chosen influence not only the amount of cells obtained (the biomass) but the quality of the cultivation conditions also influences how the biomass becomes a biocatalyst. The recombinant host cell microorganism expressing the SHC/HAC enzyme or enzyme variant gene and producing the SHC/HAC enzyme or enzyme variant is termed a biocatalyst which is suitable for use in a bioconversion reaction. In some embodiments the biocatalyst is a recombinant whole cell producing SHC/HAC enzymes or enzyme variants or it may be in suspension or an immobilized format. In other embodiments, the biocatalyst is a membrane fraction or a liquid fraction prepared from the recombinant whole cell producing the SHC/HAC enzyme or enzyme variant (as disclosed for example in Seitz et al 2012as cited above). The recombinant biocatalyst producing SHC/HAC enzymes or enzyme variants includes whole cells collected from the fermenter (for the bioconversion reaction) or the cells in the fermenter (which are then used in a one-pot reaction). The recombinant biocatalyst producing SHC/HAC enzymes or enzyme variants can include intact recombinant whole cell and/or cell debris and/or permeabilized cells and/or spheroplasts (see https://chemrxiv.org/engage/chemrxiv/search-dashboard?text=Hauer) and/or cell extracts and/or cell membranes. Either way, the SHC/HAC enzyme or enzyme variant is associated with a membrane (such as a cell membrane) in some way in order to receive and/or interact with a substrate (e.g. homofarnesol or bishomofarnesol), which membrane (such as a cell membrane) can be part of or comprise a whole cell (e.g. a recombinant whole cell). The SHC/HAC enzymes or enzyme variants may also be in an immobilized form (e.g. associated with an enzyme carrier) which allows the SHC/HAC enzymes or enzyme variants to interact with a substrate (e.g. homofarnesol or bishomofarnesol). The SHC/HAC enzymes or enzyme variants may also be used in a soluble form.

    [0704] In a preferred embodiment, the process of the disclosure is carried out using recombinant whole cells as biocatalyst. Without wishing to be bound by theory the use of whole cells in the appropriate amount is advantageous because (i) the integrity of the SHC enzyme (which is membrane associated) appears to be maintained, and (ii) the cells may have a positive contribution in the distribution of an oily (ie liquid) substrate in the reaction. The use of a recombinant whole cell as biocatalyst may assist in the distribution of the substrate (which is in liquid form) but not the ()-Ambrox product (which is in a solid form).

    [0705] In one embodiment, the biocatalyst is produced in sufficient amounts (to create a sufficient biomass), harvested and washed (and optionally stored (e.g. refrigerated, frozen or lyophilized)) before starting the bioconversion step.

    [0706] In a further embodiment, the cells are produced in sufficient amounts (to create a sufficient biocatalyst) and the reaction conditions are then adjusted without the need to harvest and wash the biocatalyst for the bioconversion reaction. This one step (or one pot) method is advantageous as it simplifies the process while possibly reducing costs. The culture medium used to grow the cells is also suitable for use in the bioconversion reaction provided that the reaction conditions are adjusted to facilitate the bioconversion reaction.

    [0707] The optimum pH for growing the cells is in the range of 6.0-7.0. The optimum pH for the bioconversion reaction is dependent on the type of SHC/HAC enzyme or enzyme variant used in the bioconversion reaction. The pH is regulated using techniques which are well known to the Skilled Person.

    [0708] Whilst the terms mixture or reaction mixture may be used interchangeably with the term medium in the present disclosure (especially as it relates to a one pot reaction), it should be noted that growing the cells to create a sufficient biomass requires a cell culture/fermentation medium but a medium is not required for the bioconversion step as a reaction buffer will suffice at a suitable pH.

    [0709] The bioconversion methods of the present disclosure are carried out under conditions of time, temperature, pH and solubilizing agent to provide for conversion of the homofarnesol or bishomofarnesol feedstock (e.g. comprising EEH or bisEEH) to ()-Ambrox or Ambra oxide.

    [0710] The pH of the reaction mixture may be in the range of 4-8, preferably, 5 to 6.5, more preferably 4.8-6.0 for the SHC/HAC enzyme variants and in the range of from about pH 5.0 to about pH 7.0 for the wild-type SHC/HAC enzymes and can be maintained by the addition of buffers to the reaction mixture. Exemplary buffers for this purpose include but are not limited to a citric acid buffer, a phosphate buffer, an acetic acid buffer and/or a succinic acid buffer.

    [0711] The optimum pH range for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may from about 5 to about 7, from about 5 to about 6.5, or from about 5 to about 6.

    [0712] The preferred temperature is between from about 15 C. and about 60 C., for example from about 15 C. to about 50 C. or from about 15 C. to about 45 C. or from about 30 C. to about 60 C. or from about 30 C. to about 40 C. or from about 35 C to about 40 C. or or from about 40 C. to about 45 C. from about 40 C. to about 50 C. The temperature can be kept constant or can be altered during the bioconversion process.

    [0713] The optimum temperature range for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants described herein may, for example, be from about 25 C. to about 55 C., from about 25 C. to about 50 C., from about 30 C. to about 55 C., or from about 30 C. to about 50 C.

    [0714] The Applicant has demonstrated that it may be useful to include a solubilizing agent (e.g. a surfactant, detergent, solubility enhancer, water miscible organic solvent and the like) in the bioconversion reaction.

    [0715] As used herein, the term surfactant means a component that lowers the surface tension (or interfacial tension) between two liquids or between a liquid and a solid. Surfactants may act as detergents, wetting agents, emulsifiers, foaming agents, and dispersants. Examples of surfactants include but are not limited to Triton X-100, Tween 80, taurodeoxycholate, Sodium taurodeoxycholate, Sodium dodecyl sulfate (SDS), and/or sodium lauryl sulfate (SLS).

    [0716] Whilst Triton X-100 may be used to partially purify the SHC/HAC enzyme or enzyme variant (in soluble or membrane fraction/suspension form), it may also be used in the bioconversion reaction (see for example the disclosure in Seitz (2012 PhD thesis as cited above) as well as the disclosure in Neumann and Simon (1986as cited above) and JP2009060799. However, surprisingly, the Applicant selected and identified SDS as a particularly useful solubilizing agent from a long list of other less useful solubilizing agents. In particular, the Applicant identified SDS as a remarkably better solubilizing agent than e.g. Triton X-100 in terms of reaction velocity and yield for the homofarnesol to ()-Ambrox bioconversion reaction (when EEH is used at both 4 g/l and 125 g/l. For at least one SHC/HAC derivative enzyme, that maximal homofarnesol to ()-Ambrox bioconversion activity with Triton X-100 (at a concentration range of about 0.005% to 0.48%) in the reaction may be only around 20% of the activity obtained with SDS (at a concentration of about 0.07%) with EEH at 4 g/l and cells at an OD.sub.650 nm of 10.

    [0717] Without wishing to be bound by theory, the use of SDS with recombinant microbial host cells may be advantageous as the SDS may interact advantageously with the host cell membrane in order to make the SHC/HAC enzyme or enzyme variant (which is a membrane bound enzyme) more accessible to the homofarnesol substrate. In addition, the inclusion of SDS at a suitable level in the reaction mixture may improve the properties of the emulsion (homofarnesol in water) and/or improve the access of the homofarnesol substrate to the SHC enzyme within the host cell while at the same time preventing the disruption (e.g. denaturation of the SHC (WT or SHC/HAC variant) enzyme). The concentration of the solubilising agent (e.g. SDS) used in the bioconversion reaction is influenced by the biomass amount and the substrate (EEH) concentration. That is, there is a degree of interdependency between the solubilising agent (e.g. SDS) concentration, the biomass amount and the substrate (EEH) concentration. By way of example, as the concentration of homofarnesol substrate increases, sufficient amounts of biocatalyst and solubilising agent (e.g. SDS) are required for an efficient bioconversion reaction to take place. If, for example, the solubilising agent (e.g. SDS) concentration is too low, a suboptimal homofarnesol conversion may be observed. On the other hand, if, for example, the solubilising agent (e.g. SDS) concentration is too high, then there may be a risk that the biocatalyst is affected through either the disruption of the intact microbial cell and/or denaturation/inactivation of the SHC/HAC enzyme or enzyme variant. The selection of a suitable concentration of SDS in the context of the biomass amount and, substrate (EEH) concentration is within the knowledge of the Skilled Person. By way of example, a predictive model can be developed by the Skilled Person to determine the suitable SDS, substrate (EEH) and biomass concentrations. SDS in the range of 0.010-0.075% may be appropriate when 4 g/l EEH and biocatalyst to an OD of 10.0 (650 nm) are used. When 125 g/l EEH is used with 2 the wet weight of biomass, an adjusted SDS concentration (1.3%) may be appropriate. However, an investigation of the percent EEH conversion to ()-Ambrox using different SDS/cells ratio values indicated that the correct selection of the ratio of biocatalyst, homofarnesol substrate and solubilising agent (e.g. SDS) facilitates the development of a robust bioconversion reaction system which demonstrates a degree of tolerance to a range of SDS concentrations and pH ranges.

    [0718] The temperature of the bioconversion reaction for a WT SHC enzyme (eg. AacSHC) or SHC/HAC variant may be from about 25 C. to about 55 C., from about 25 C. to about 50 C., from about 30 C. to about 55 C., or from about 30 C. to about 50 cm from about 30 C. to about 60 C., for example from about 45 C. to about 60 C., for example from about 50 C. to about 60 C., for example about 55 C.

    [0719] The pH range of the bioconversion reaction for a WT SHC enzyme (eg. AacSHC) or SHC/HAC variant may be from about 5.0 to 7.0, from about 5 to about 6.5, or from about 5 to about 6, more preferably from about 5.6 to about 6.2, even more preferably about 6.0.

    [0720] The temperature of the bioconversion reaction for a SHC/HAC enzyme variant may be about 30 C. to about 55 C., for example from about 40 C. to about 50 C., for example about 45 C.

    [0721] The pH of the bioconversion reaction for a SHC/HAC enzyme variant may be about 4.8-6.4, preferably about 5.2-6.0.

    [0722] Preferably the solubilising agent used in the bioconversion reaction is SDS. The SDS concentration used in the bioconversion reaction for the WT SHC enzyme (e.g. AacSHC) may be in the range of about 0.010-0.075%, preferably about 0.030% when EEH at about 4 g/l and cells at an OD.sub.650 nm of 10 is used.

    [0723] The SDS concentration used in the bioconversion reaction for the SHC/HAC enzyme variant may be in the range of about 0.005 w/w % to about 0.04 w/w %, from about 0.010 w/w % to about 0.10 w/w %, from about 0.0025-0.090%, preferably about 0.050% when EEH at about 4 g/l and cells at an OD.sub.650 nm of 10 is used.

    [0724] The biocatalyst may be loaded to the reaction to an OD of about 10.0 (650 nm) when the reaction is loaded with homofamesol at an EEH concentration of about 4 g/l EEH.

    [0725] The [SDS]/[cells] ratio may be in the range of about, 10:1-20:1, preferably about 15:1-18:1, preferably about 16:1 when the ratio of biocatalyst to EEH homofamesol is about 2:1 in the bioconversion reaction.

    [0726] The SDS concentration in the bioconversion reaction for a SHC variant enzyme may be in the range of about 1-2%, preferably in the range of about 1.4-1.7%, even more preferably about 1.5% when the homofamesol concentration is about 125 g/l EEH and the biocatalyst concentration is 250 g/l (corresponding to an OD of about 175 (650 nm)).

    [0727] The ratio of biocatalyst to EEH homofamesol substrate may be in the range of about 0.5:1-2:1, in some embodiments 2:1, preferably about 1:1 or 0.5:1.

    [0728] The weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture in a weight ratio of 80:20 is about 2:1, 1:1 or about 0.5:1 or about 0.1:1.

    [0729] The weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture in a weight ratio of EEH:EZH is about 100:00; 99:01; 98:02; 97:03; 96:04; 95:05; 94:06; 93:07; 92:08; 91:09; 90:10; 89:11; 88:12; 87:13; 86:14; 85:15; 84:16; 83:17; 82:18; 81:19; 80:20; 79:21; 78:22; 77:23; 76:24; 75:25; 74:26; 73:27; 72:28; 71:29; 70:30; 69:31; 68:32; 67:33; 66:34; 65:35; 64:36; 63:37; 62:38:61:39; 60:40; 59:41; 58:42; 57:43; 56:44; 55:45:54:46; 53:47:52:48; 51:49; or about 50:50 is about 2:1, 1:1 or about 0.5:1 or about 0.1:1.

    [0730] The weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture in a weight ratio of from about 50:50 to about 100:00 or from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5. preferably 80:20 is about 2:1, 1:1 or about 0.5:1 or about 0.1:1.

    [0731] In an embodiment, a cell (or biocatalyst) to EEH ratio of 0.5 or 0.4 or 0.3 or 0.2 or 0.1 is used. In an embodiment, when such a cell (or biocatalyst) to EEH ratio is used, the EEH conversion is of at least 50%, 60%, 70%, 80%, 90%, 95% or 98%. In an embodiment, such a cell (or biocatalyst) to EEH ratio is used even when 100 or 150 or 200 or even 250 g/l EEH is present. In an embodiment when such cell (or biocatalyst) to EEH ratio is used and such concentration of EEH is used a conversion of up to 4.5 or 5.0 or 5.5 or even 5.9 or 6.0 g of EEH is converted per gram of cells (or biocatalyst). Such results have been obtained in the experimental part (see example 9). In the context of the reference to the cell (biocatalyst) to EEH ratio, EEH may be present in a mixture with other isomer of homofarnesol as described herein. We refer to the total concentration of EEH present even if other isomer of homofarnesol may be present.

    [0732] As Example 9 demonstrates, under certain reaction conditions using the SHC variants disclosed and described herein, the [cells]:[EEH] ratio was lowered further down to values of 0.3, 0.2, and 0.1. The reaction time was extended to approx. 200 h to possibly allow for reaching a plateau in E,E-Homofarnesol conversion. Approx. 98% EEH conversion was obtained with a [cells]:[EEH] ratio of 0.3, approx. 84% EEH conversion with a [cells]:[EEH] ratio of 0.2, and approx. 59% with a [cells]:[EEH] of 0.1. The plateau reached in the reaction with a [cells]:[EEH] ratio of 0.1 indicated the possibility of converting approx. 5.9 g of E,E-Homofarnesol per gram of cells under the reaction conditions applied which represents about a three fold improvement over reference bioconversion reactions.

    [0733] Furthermore in Example 17, it was demonstrated that using 450 g/l EEH and a [cells]:[EEH] ratio of 0.4, full EEH conversion was obtained in 72 h. Full conversion was obtained in 24 h with 250 g/l EEH at [cells]:[EEH] ratio of 1.0. This indicated the possibility for full conversion of up to 450 g/l EEH in 3 days using an appropriate amount of cells, and that this was possible with a [cells]:[EEH] ratio at least as low as 0.4 under the conditions tested.

    [0734] Therefore, in an embodiment, a process is provided wherein the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture is 0.4 and the concentration of EEH is 450 g/l.

    [0735] Therefore, in an embodiment, a process is provided wherein the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture is in a range of 0.1-0.5, preferably 0.4 and the concentration of EEH is in the range of 250 g/l to 650 g/l, preferably 450 g/l.

    [0736] In another embodiment, a process is provided wherein the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture is 1 and the concentration of EEH is 250 g/l.

    [0737] This improvement can be attributed to an increase in total turnover number when certain SHC mutations (eg P2 mutations) are introduced into a reference SHC enzyme (eg SHC #65). This increased total turnover number may be the result of an increased catalytic potential or an increased stability of the new SHC variant (eg SHC #65 P2 enzyme variant), or a combination of the two. An increased stability may be the result of the optimal reaction conditions for the new SHC variant (eg SHC #65 P2) with significantly lower temperature and SDS concentration.

    [0738] The optimum temperature for the SHC/HAC enzyme variants may, for example, be equal to or greater than about 35 C. For example, the optimum temperature for the SHC/HAC enzyme variants may range from about 40 C. to about 50 C., for example from about 42 C. to about 48 C. or from about 44 C. to about 46 C. For example, the optimum temperature of the SHC/HAC enzyme variants may be about 45 C. The processes for making ()-Ambrox or Ambra oxide disclosed herein may be carried out at the optimum temperature of the SHC/HAC enzyme variant.

    [0739] The optimum pH for the SHC/HAC enzyme variants may, for example, be equal to or greater than about 5.4. For example, the optimum pH for the SHC/HAC enzyme variants may range from about 5.2 to about 6.0, for example from about 5.4 to about 5.8, for example from about 5.6 to about 5.8. For example, the optimum pH of the SHC/HAC enzyme variants may be about 5.6 or about 5.8. The process for making ()-Ambrox or Ambra oxide disclosed herein may be carried out at the optimum pH of the SHC/HAC enzyme variant.

    [0740] The optimum concentration of sodium dodecyl sulfate (SDS) in the reaction medium of the process for making ()-Ambrox or Ambra oxide disclosed herein may, for example, be from about 0.005 w/w % to about 0.04 w/w %, from about 0.010 w/w % to about 0.10 w/w %. For example, the optimum concentration of SDS may be from about 0.040 w/w % to about 0.080 w/w %, for example about 0.050 w/w % when the substrate (e.g. EEH or BisEEH) is used at 4 g/l with cells to an OD.sub.650 nm of 10 The process for making ()-Ambrox or Ambra oxide disclosed herein may be carried out using the optimum concentration of SDS described herein. The optimum concentration of sodium dodecyl sulfate (SDS) in the reaction medium of the processes for making ()-Ambrox or Ambra oxide disclosed herein may, for example, be from about 1.0 w/w % to about 1.5 w/w % when the substrate (e.g. EEH or BisEEH) is used at 125 g/l with 250 g/l of cells. For example, the optimum concentration of SDS may be from about 1.2 w/w % to about 1.4 w/w %, for example about 1.3 w/w % when the substrate (e.g. EEH or BisEEH) is used at 125 g/l with 250 g/l of cells or about 0.65 w/w % when the substrate (e.g. EEH or BisEEH) is used at 125 g/l with 125 g/l of cells.

    [0741] The processes for making ()-Ambrox or Ambra oxide disclosed herein may be carried out within the optimum temperature range or at the optimum temperature and/or within the optimum pH range or at the optimum pH and/or within the SDS optimum concentration range or at the optimum SDS concentration for the specific enzyme used, as set out in Table 15 in the Examples below.

    [0742] In some embodiments, ()-Ambrox is produced using a biocatalyst to which the homofamesol substrate is added.

    [0743] In some embodiments, Ambra oxide is produced using a biocatalyst to which the bishomofamesol substrate is added.

    [0744] It is possible to add the substrate by feeding using known means (e.g. peristaltic pump, infusion syringe and the like). Homofamesol and bishomofarnesol may be oil soluble compounds and provided in an oil format. Given that the biocatalyst (microbial cells such as intact recombinant whole cell and/or cell debris and/or immobilised enzyme) is present in an aqueous phase, the bioconversion reaction may be regarded as a three phase system (comprising an aqueous phase, a solid phase and an oil phase) when homofarnesol or bishomofarnesol is added to the bioconversion reaction mixture. This is the case even when SDS is present. By way of clarification, when a soluble WT SHC or a SHC/HAC enzyme variant is used as a biocatalyst, this is considered a two phase system.

    [0745] A fermenter may be used to grow recombinant host cells expressing the SHC/HAC enzyme or enzyme variant gene and producing active SHC/HAC enzymes or enzyme variants to a sufficient biomass concentration suitable for use as a biocatalyst in the same fermenter vessel which is used to convert the homofarnesol source to ()-Ambrox, for example in admixture with one or more of the by-products (II), (IV) and/or (III) or bishomofarnesol source to Ambra oxide, for example in admixture with one or more of the by-products (XI), (XII) and/or (XIII). Within the application, each molecule may be called a compound or a by-product depending on the context in which reference is made to said molecule. Usually, the wording by-product is used when said molecule is not desired but can be accepted under certain conditions in the end product. If a by-product is included in an end product (eg either alone or as part of a composition), it may be referred to as a compound rather than a by-product). By way of example, a by-product may be acceptable in an end product if does not impact or substantially impact on the olfactory profile of the end product or the composition comprising the by-product.

    [0746] In an embodiment, the SHC/HAC variants disclosed herein are so selective for an EEH substrate isomer and so selective for the production of ()-Ambrox that using pure EEH as the sole substrate isomer allows for the production of ()-Ambrox and undetectable by-product (IV), even though no further downstream processing (such as filtration/selective crystallization/distillation) is carried out.

    [0747] In an embodiment, the SHC/HAC variants disclosed herein are so selective for an EEH substrate isomer and so selective for the production of ()-Ambrox that using pure EEH as the sole substrate isomer allows for the production of ()-Ambrox. Moreover, by-product (IV) is undetectable, even though no further downstream processing (such as filtration/selective crystallization/distillation) is carried out.

    [0748] In an embodiment, the SHC/HAC variants disclosed herein are so selective for an EEH substrate isomer and so selective for the production of ()-Ambrox that using a mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers being the EEH and the EZH isomers and being selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)] allows for the production of only ()-Ambrox and by-product (III). In such embodiment, by-products (II) and (IV) are not detectable, even though no further downstream processing (such as filtration/selective crystallization/distillation) is carried out. This has been demonstrated in example 7 (FIG. 6).

    [0749] In an embodiment, the mixture comprises EEH and EZH. In an embodiment, the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH. In an embodiment, the ratio of EEH:EZH within this mixture may range from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.

    [0750] In an embodiment, the SHC/HAC variants disclosed herein are so selective for an EEH substrate isomer and so selective for the production of ()-Ambrox that using a mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers being the EEH and the EZH isomers and being selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)] allows the production of (-only ()-Ambrox and at least by-product (II).

    [0751] In an embodiment, the mixture comprises EEH and EZH. In an embodiment, the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH. In an embodiment, the ratio of EEH:EZH within this mixture may range from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.

    [0752] In an embodiment, the SHC/HAC variants disclosed herein are so selective for EEH and so selective for the production of ()-Ambrox that using a mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers being the EEH and the EZH isomers and being selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)] allows the production of only ()-Ambrox and at least by-product Ill but wherein by-products (II) and (IV) are not detected.

    [0753] In an embodiment, the mixture comprises EEH and EZH. In an embodiment, the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH. In an embodiment, the ratio of EEH:EZH within this mixture may range from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.

    [0754] The Skilled Person will understand that higher cumulative production titers can be achieved by implementing a continuous process, such as product removal, substrate feed, and biomass addition or (partial) replacement. Preferably the bioconversion of EEH into ()-Ambrox or BisEEH to Ambra oxide in the presence of a recombinant host cell comprising a SHC/HAC enzyme or enzyme variant generates an ()-Ambrox or Ambra oxide yield of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, given in mol percent and based on the mols of EEH or BisEEH employed; especially preferably, the yield is between 5 and 100, 10 and 100, and 100, 25 and 100, 30 and 100, 35 and 100, in particular between 40 and 100, 45 and 100, 50 and 100, 60 and 100, 70 and 100 mol percent.

    [0755] The activity of the SHC/HAC enzyme or enzyme variant is defined via the reaction rate (amount of product/(amount of product+amount of remaining starting material))100) in mol percent.

    [0756] Preferably, the bioconversion of EEH into ()-Ambrox or BisEEH into Ambra oxide in the presence of a SHC/HAC enzyme or enzyme variant produces an ()-Ambrox or Ambra oxide yield of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, given in mol percent and based on the mols of EEH or BisEEH employed; especially preferably, the yield is between 5 and 100, 10 and 100, 20 and 100, 25 and 100, 30 and 100, 35 and 100, in particular between 40 and 100, 45 and 100, 50 and 100, 60 and 100, 70 and 100.

    [0757] In a preferred embodiment of the invention, the yield and/or the reaction rate are determined over a defined time period of, for example, 4, 6, 8, 10, 12, 16, 20, 24, 36 or 48 hours, during which EEH is converted into ()-Ambrox or BisEEH is converted into Ambra oxide by a recombinant host cell comprising a nucleotide sequence encoding a SHC/HAC enzyme or enzyme variant. In a further variant, the reaction is carried out under precisely defined conditions of, for example, 25 C., 30 C., 40 C., 50 C. or 60 C. In particular, the yield and/or the reaction rate are determined by carrying out the reaction of converting EEH into ()-Ambrox or BisEEH into Ambra oxide by the SHC/HAC enzymes or enzyme variants according to the invention at 35 C. over a period of 24-72 hours.

    [0758] In a further embodiment of the present invention, a recombinant host cell comprising a nucleotide sequence encoding a SHC/HAC enzyme variant is characterized in that it shows a 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 11-, 12-, 13-, 14-, 15-, 16-, 17-, 18-, 19-, 20-, 21-, 22-, 23-, 24-, 25-, 26-, 27-, 28-, 29-, 30-, 31-, 32-, 33-, 34-, 35-, 36-, 37-, 38-, 39-, 40-, 41-, 42-, 43-, 44-, 45-, 46-, 47-, 48- , 49-, 50-, 51-, 52-, 53-, 54-, 55-, 56-, 57-, 58-, 59-, 60-, 61-, 62-, 63-, 64-, 65-, 66-, 67-, 68-, 69- , 70-, 71-, 72-, 73-, 74-, 75-, 76-, 77-, 78-, 79-, 80-, 81-, 82-, 83-, 84-, 85-, 86-, 87-, 88-, 89-, 90- , 91-, 92-, 93-, 94-, 95-, 96-, 97-, 98-, 99-, 100-, 200-, 500-, 1000-fold or higher yield and/or reaction rates in the reaction of homofamesol to give ()-Ambrox or in the reaction of bishomofarnesol to give Ambra oxide in comparison with the WT SHC or SHC/HAC derivative enzyme under the same conditions. Here, the term condition relates to reaction conditions such as substrate concentration, enzyme concentration, reaction period and/or temperature.

    [0759] The successful development of a bioconversion process for making ()-Ambrox from homofamesol in a recombinant strain of E. coli comprising a nucleotide sequence encoding a WT/reference SHC or a SHC/HAC derivative can offer a low cost and industrially economical process for ()-Ambrox production.

    [0760] The successful development of a bioconversion process for making Ambra oxide from bishomofamesol in a recombinant strain of E. coli comprising a nucleotide sequence encoding a WT/reference SHC or a SHC/HAC derivative can offer a low cost and industrially economical process for Ambra oxide production.

    Ambrox and Uses Thereof

    [0761] There is further provided herein the reaction products made by the processes described herein. The reaction products may, for example, comprise, consist essentially of consist of ()-Ambrox and one or more further compounds, for example one or more of a compound of formula (II), a compound of formula (III) and a compound of formula (IV).

    [0762] As used herein, the term Ambrox includes ()-Ambrox of formula (I) below as well as ()-Ambrox in isomerically pure form or in a mixture with one or more of the following molecules of formula (II), (III), and/or (IV),

    ##STR00011##

    [0763] The nomenclature for the reaction products of formulae (I), (II), (III), and (IV) is set out below.

    TABLE-US-00013 TABLE 13 Nomenclature for the reaction products of formulae (I), (II), (III) and (IV). Compound Description Name and Structure (I) (-)-Ambrox [00012]embedded image (3aR,5aS,9aS,9bR)-3a,6,6,9a- tetramethyldodecahydronaphtho[2,1-b]furan (II) Macrocycle [00013]embedded image (7aS,11aS,Z)-5,8,8,11a-tetramethyl-2,3,6,7,7a,8,9,10,11,11a- decahydrobenzo[b]oxonine (III) 9b-epi-Ambrox [00014]embedded image (3aR,5aS,9aS,9bS)-3a,6,6,9a-tetramethyldodeca- hydronaphtho[2,1-b]furan (IV) Escher et al (1990) [00015]embedded image (3aS,5aS,9aS,9bS)-3a,6,6,9a-tetramethyldodeca- hydronaphtho[2,1-6]furan

    [0764] ()-Ambrox is known commercially as Ambrox (Firmenich), Ambroxan (Henkel), Ambrofix (Givaudan), Amberlyn (Quest), Cetalox Laevo (Firmenich), Ambermor (Aromor) and/or Norambrenolide Ether (Pacific).

    [0765] ()-Ambrox is an industrially important aroma compound and has been used in the fragrance industry for a long time. The special desirable sensory benefits from ()-Ambrox come from the () isomer rather than the (+) one. The odour of the () isomer is described as musk-like, woody, warm or ambery whereas the (+)-Ambrox enantiomer has a relatively weak odour note. The odour and odour thresholds for Ambrox like products are also different. While various ()-Ambrox enriched materials are available commercially, it is desirable to produce highly enriched ()-Ambrox materials, ideally pure ()-Ambrox. The processes described herein may make ()-Ambrox of formula (II) alone or in a mixture with by-products such as the compounds shown in formulae (II), (III) and/or (IV) above.

    [0766] ()-Ambrox can be produced from sclareolide according to the production process as described below. Sclareol is a product extracted from the natural plant clary sage. However, because a natural starting material is used in this process, there are potential problems in that it involves a multistage reaction, its operation is circuitous, the quantity and stability of supply of starting material may not always be satisfactory, and the reaction may not be environmentally friendly because an oxidizing agent such as chromic acid or a permanganate is used in the step of (+)-sclareol oxidative degradation.

    ##STR00016##

    [0767] ()-Ambrox may also be synthesized from homofarnesol using different routes. By way of example, homofarnesol can be obtained by brominating, cyanating, and hydrolysing nerolidol to give homofarnesylic acid, followed by reduction. Alternatively, homofarnesol may be obtained from farnesol, farnesylchloride, beta-farnesene or other substrates.

    [0768] The processes described herein may make ()-Ambrox of formula (II) alone or in a mixture with by-products such as the compound shown in formulae (II), (III) and/or (IV). For example, other stereoisomers of formula (I) may be made by the processes described herein. As explained earlier herein, in an embodiment, when only EE homofarnesol is present the process described herein allows the production of ()-Ambrox with no by-product (IV) or undetectable by-product (IV) indicating a high substrate specificity and product selectivity for the SHC/HAC enzyme variant described herein.

    [0769] There is therefore provided herein a compound of formula (I) or a composition comprising a compound of formula (I) obtained by or obtainable by the processes described herein, including all embodiments thereof.

    [0770] In certain embodiments, not all of the homofarnesol (e.g. EEH) is converted to ()-Ambrox or a by-product of the reaction. Therefore, the compositions described herein, for example the compositions obtained by obtainable by the processes described herein may comprise homofarnesol (e.g. EEH, for example in addition to the compound of formula (I) and/or compounds of formula (II), (III) and/or (IV)). Any remaining homofarnesol may be separated from the other reaction products such that the ()-Ambrox product does not comprise homofarnesol. In other embodiments, all of the homofarnesol starting material is converted to ()-Ambrox of formula (I) or a by-product of the reaction by the processes described herein.

    [0771] Therefore, the compositions described herein may comprise, consist essentially of or consist of one or more of a compound of formula (I), a compound of formula (II), a compound of formula (III), a compound of formula (IV), homofarnesol starting material (e.g. EEH) and other stereoisomers of the compound of formula (I).

    [0772] For example, the compositions described herein may comprise, consist essentially of or consist of a compound of formula (I) and one or more of a compound of formula (II), a compound of formula (III) and a compound of formula (IV).

    [0773] For example, the compositions described herein may comprise, consist essentially of or consist of a compound of formula (I) and of a compound of formula (II) and a compound of formula (III).

    [0774] Therefore, in an embodiment, when only the EE homofarnesol isomer is present in the bioconversion reaction, the compound of formula (IV) is not detectable even though no isolation/purification/downstream processing steps has been carried out.

    [0775] For example, the compositions described herein may comprise, consist essentially of or consist of a compound of formula (I) and a compound of formula (III).

    [0776] Therefore, in an embodiment, when the EE/EZ homofarnesol isomers are present in the bioconversion reaction the compound of formula (II) and (IV) are not detectable even though no purification/downstream processing steps had been carried out.

    [0777] The compositions described herein may therefore comprise equal to or greater than about equal to or greater than about 50 wt % of the compound of formula (II) based on the total weight of the compound of formula (II), the compound of formula (II), the compound of formula (III) and the compound of formula (IV). For example, the compositions described herein may comprise equal to or greater than about 55 wt % or equal to or greater than about 60 wt % or equal to or greater than about 65 wt % or equal to or greater than about 70 wt % or equal to or greater than about 75 wt % or equal to or greater than about 80 wt % or equal to or greater than about 85 wt % or equal to or greater than about 90 wt % or equal to or greater than about 95 wt % of the compound of formula (I) based on the total weight of the compound of formula (II), the compound of formula (II), the compound of formula (III) and the compound of formula (IV). The compositions described herein may, for example, comprise equal to or less than about 100 wt % of the compound of formula (II) based on the total weight of the compound of formula (II), the compound of formula (II), the compound of formula (III) and the compound of formula (IV). For example, the mixture may comprise equal to or less than about 99 wt % or equal to or less than about 98 wt % or equal to or less than about 97 wt % of the compound of formula (II) based on the total weight of compound of formula (II), the compound of formula (II), the compound of formula (III) and the compound of formula (IV). For example, the compositions described herein may comprise from about 50 wt % to about 100 wt % or from about 60 wt % to about 99 wt % or from about 70 wt % to about 98 wt % or from about 80 wt % to about 97 wt % or from about 90 wt % to about 97 wt % of the compound of formula (II) based on the total weight of the compound of formula (II), the compound of formula (II), the compound of formula (III) and the compound of formula (IV).

    [0778] The weight ratio of the compound of formula (II) to the total weight of the compound of formula (II), the compound of formula (III) and the compound of formula (IV) in the compositions described herein may, for example, range from about 60:40 to about 99:1. For example, the weight ratio of the compound of formula (II) to the total weight of the compound of formula (II), the compound of formula (III) and the compound of formula (IV) may range from about 65:35 to about 99:1 or from about 70:30 to about 99:1 or from about 75:25 to about 99:1 or from about 80:20 to about 99:1 or from about 85:15 to about 99:1 or from about 90:10 to about 99:1 or from about 95:5 to about 99:1. For example, the weight ratio of the compound of formula (II) to the total weight of the compound of formula (II), the compound of formula (III) and the compound of formula (IV) may range from about 65:35 to about 98:2 or from about 70:30 to about 97:3 or from about 75:25 to about 96:4 or from about 80:20 to about 95:5 or from about 85:15 to about 90:10.

    [0779] The compositions described herein may therefore comprise equal to or greater than about equal to or greater than about 50 wt % of the compound of formula (II) based on the total weight of the compound of formula (I), the compound of formula (II) and the compound of formula (III). For example, the compositions described herein may comprise equal to or greater than about 55 wt % or equal to or greater than about 60 wt % or equal to or greater than about 65 wt % or equal to or greater than about 70 wt % or equal to or greater than about 75 wt % or equal to or greater than about 80 wt % or equal to or greater than about 85 wt % or equal to or greater than about 90 wt % or equal to or greater than about 95 wt % of the compound of formula (II) based on the total weight of the compound of formula (II), the compound of formula (II) and the compound of formula (III). The compositions described herein may, for example, comprise equal to or less than about 100 wt % of the compound of formula (II) based on the total weight of the compound of formula (II), the compound of formula (II) and the compound of formula (III). For example, the mixture may comprise equal to or less than about 99 wt % or equal to or less than about 98 wt % or equal to or less than about 97 wt % of the compound of formula (II) based on the total weight of compound of formula (II), the compound of formula (II) and the compound of formula (III). For example, the compositions described herein may comprise from about 50 wt % to about 100 wt % or from about 60 wt % to about 99 wt % or from about 70 wt % to about 98 wt % or from about 80 wt % to about 97 wt % or from about 90 wt % to about 97 wt % of the compound of formula (II) based on the total weight of the compound of formula (II), the compound of formula (II) and the compound of formula (III).

    [0780] The weight ratio of the compound of formula (II) to the total weight of the compound of formula (II) and the compound of formula (III) in the compositions described herein may, for example, range from about 60:40 to about 99:1. For example, the weight ratio of the compound of formula (II) to the total weight of the compound of formula (II) and the compound of formula (III) may range from about 65:35 to about 99:1 or from about 70:30 to about 99:1 or from about 75:25 to about 99:1 or from about 80:20 to about 99:1 or from about 85:15 to about 99:1 or from about 90:10 to about 99:1 or from about 95:5 to about 99:1. For example, the weight ratio of the compound of formula (I) to the total weight of the compound of formula (II) and the compound of formula (III) may range from about 65:35 to about 98:2 or from about 70:30 to about 97:3 or from about 75:25 to about 96:4 or from about 80:20 to about 95:5 or from about 85:15 to about 90:10.

    [0781] The compositions described herein may therefore comprise equal to or greater than about equal to or greater than about 50 wt % of the compound of formula (II) based on the total weight of the compound of formula (II) and the compound of formula (III). For example, the compositions described herein may comprise equal to or greater than about 55 wt % or equal to or greater than about 60 wt % or equal to or greater than about 65 wt % or equal to or greater than about 70 wt % or equal to or greater than about 75 wt % or equal to or greater than about 80 wt % or equal to or greater than about 85 wt % or equal to or greater than about 90 wt % or equal to or greater than about 95 wt % of the compound of formula (II) based on the total weight of the compound of formula (I) and the compound of formula (III). The compositions described herein may, for example, comprise equal to or less than about 100 wt % of the compound of formula (II) based on the total weight of the compound of formula (II) and the compound of formula (III). For example, the mixture may comprise equal to or less than about 99 wt % or equal to or less than about 98 wt % or equal to or less than about 97 wt % of the compound of formula (II) based on the total weight of compound of formula (II) and the compound of formula (III). For example, the compositions described herein may comprise from about 50 wt % to about 100 wt % or from about 60 wt % to about 99 wt % or from about 70 wt % to about 98 wt % or from about 80 wt % to about 97 wt % or from about 90 wt % to about 97 wt % of the compound of formula (II) based on the total weight of the compound of formula (II) and the compound of formula (III).

    [0782] The weight ratio of the compound of formula (II) to the total weight of the compound of formula (III) in the compositions described herein may, for example, range from about 60:40 to about 99:1.

    [0783] For example, the weight ratio of the compound of formula (II) to the total weight of the compound of formula (III) may range from about 65:35 to about 99:1 or from about 70:30 to about 99:1 or from about 75:25 to about 99:1 or from about 80:20 to about 99:1 or from about 85:15 to about 99:1 or from about 90:10 to about 99:1 or from about 95:5 to about 99:1. For example, the weight ratio of the compound of formula (II) to the total weight of the compound of formula (III) may range from about 65:35 to about 98:2 or from about 70:30 to about 97:3 or from about 75:25 to about 96:4 or from about 80:20 to about 95:5 or from about 85:15 to about 90:10.

    [0784] The weight ratio of the compound of formula (II) to homofarnesol (e.g. EEH) in the compositions described herein may, for example, range from about 90:10 to about 100:0. For example, the weight ratio of the compound of formula (II) to homofarnesol (e.g. EEH) in the compositions described herein may range from about 92:8 to about 100:0 or from about 94:6 to about 100:0 or from about 95:5 to about 100:0 or from about 96:4 to about 99.5:0.5 or from about 97:3 to about 99.0:1.0 or from about 98:2 to about 99.0:1.0.

    [0785] The amount of the compound of formula (II), the compound of formula (II), the compound of formula (III) and the compound of formula (IV) in a mixture of stereoisomers may, for example, be quantified by gas chromatography and/or identified by NMR spectroscopy.

    [0786] ()-Ambrox as synthesized by the processes described herein (e.g. using SHC/HAC enzymes or variants thereof and optionally recombinant host cells) may, for example, be in a solid form. The solid form may be amorphous form or in crystalline form.

    [0787] The ()-Ambrox produced by the methods described herein (e.g. using SHC/HAC enzymes or variants thereof and optionally recombinant host cells) may be isolated by steam extraction/distillation or organic solvent extraction using a non-water miscible solvent (to separate the reaction products and unreacted substrate from the biocatalyst which stays in the aqueous phase) followed by subsequent evaporation of the solvent to obtain a crude reaction product as determined by gas chromatographic (GC) analysis. The steam extraction/distillation and organic solvent extraction methods are known to those skilled in the art.

    [0788] ()-Ambrox is present in the solid phase as crystals or in amorphous form and can be separated from the remaining solid phase (cell material or debris thereof) and the liquid phase (of the reaction mixture (eg unreacted homofarnesol and/or by products (II and/or Ill and/or IV) and/or reaction buffer) by means of filtration (eg using a belt filter or press filters or any filter of appropriate mesh size). Alternatively, the solid phase of the reaction mixture that may comprise ()-Ambrox can be separated from the liquid phase by, for example, centrifugation.

    [0789] ()-Ambrox may be extracted from the solid phase (eg cell material, debris and ()-Ambrox crystals) using a water miscible solvent (for example ethanol) or a non-water miscible solvent (for example toluene). Alternatively, the resulting ()-Ambrox may be extracted from the solid phase of the reaction mixture using a mixture of solvents (eg water miscible and non water miscible solvents).

    [0790] ()-Ambrox can also be extracted from the whole reaction mixture where it is extracted with a non-water miscible solvent (for example toluene).

    [0791] Examples of suitable water miscible and non-water miscible organic solvents suitable for use in the extraction and/or selective crystallization of ()-Ambrox include but are not limited to aliphatic hydrocarbons, preferably those having 5 to 8 carbon atoms, such as pentane, cyclopentane, hexane, cyclohexane, heptane, octane or cyclooctane, halogenated aliphatic hydrocarbons, preferably those having one or two carbon atoms, such as dichloromethane, chloroform, carbon tetrachloride, dichloroethane or tetrachloroethane, aromatic hydrocarbons, such as benzene, toluene, the xylenes, chlorobenzene or dichlorobenzene, aliphatic acyclic and cyclic ethers or alcohols, preferably those having 4 to 8 carbon atoms, such as ethanol, isopropanol, diethyl ether, methyl tert.-butyl ether, ethyl tert.-butyl ether, dipropyl ether, diisopropyl ether, dibutyl ether, tetrahydrofuran or esters such as ethyl acetate or n-butyl acetate or ketones such as methyl isobutyl ketone or dioxane or mixtures of these. The solvents which are especially preferably used are the abovementioned heptane, Methyl tert-butyl ether (also known as MTBE, tert-butyl methyl ether, tertiary butyl methyl ether and tBME), diisopropyl ether, tetrahydrofuran, ethyl acetate and/or mixtures thereof. Preferably, a water miscible solvent such as ethanol is used for the extraction of ()-Ambrox from the solid phase of the reaction mixture. The use of ethanol is advantageous because it is easy to handle, it is non-toxic and it is environmentally friendly.

    [0792] By way of example, the resulting ()-Ambrox may be extracted from the whole reaction mixture using an organic solvent such as a non-water miscible solvent (for example toluene). Alternatively, the resulting ()-Ambrox may be extracted from the solid phase of the reaction mixture (obtained by, for example, centrifugation or filtration) using a water miscible solvent (for example ethanol) or a non-water miscible solvent (for example toluene). Alternatively, the resulting ()-Ambrox may be extracted from the solid phase of the reaction mixture using a mixture of solvents. By way of further example, ()-Ambrox is present in the solid phase as crystals or in amorphous form and can be separated from the remaining solid phase (cell material or debris thereof) and the liquid phase also by means of filtration. By way of further example, at a temperature above the melting point of ()-Ambrox (around. 75 C.), the ()-Ambrox may form an oil layer on top of aqueous phase, which oil layer can be removed and collected. In order to ensure a complete recovery of ()-Ambrox after the oil layer is removed, an organic solvent may be added to the aqueous phase containing the biomass in order to extract any residual ()-Ambrox contained in, or on or about the biomass. The organic layer can be combined with the oil layer, before the whole is further processed to isolate and purify ()-Ambrox.

    [0793] The ()-Ambrox may be further selectively crystallised to remove by-products (II), (IV) and (III) and any unreacted homofarnesol substrate from the final ()-Ambrox product. The term selective crystallization refers to a process step whereby ()-Ambrox is caused to crystallise from a solvent whilst the compounds (II), (III) and (IV) remain dissolved in the crystallising solvent to such an extent that isolated crystalline material contains only ()-Ambrox product, or if it contains any of the other compounds (II), (III) or (IV), then they are present only in olfactory acceptable amounts.

    [0794] The ()-Ambrox may, for example, be free or substantially free of by-products (II), (III) and (IV). The selective crystallisation step may use a water miscible solvent such as ethanol or the like. The selective crystallisation of ()-Ambrox may be influenced by the presence of unreacted homofarnesol substrate and also the ratio of ()-Ambrox to the other detectable by-products (II), (III) and/or (IV). Even if only 10% conversion of the homofarnesol substrate to ()-Ambrox is obtained, the selective crystallisation of ()-Ambrox is still possible.

    [0795] In the event that by-products (II) and/or (IV) may not be produced, the ()-Ambrox may be further selectively crystallised to remove all or substantially all of by-product (III) and any unreacted homofarnesol substrate from the final ()-Ambrox product. The term selective crystallization refers to a process step whereby ()-Ambrox is caused to crystallise from a solvent whilst the compound (III) remains dissolved in the crystallising solvent to such an extent that isolated crystalline material contains only ()-Ambrox product, or if it contains compound (III), then it is present only in olfactory acceptable amounts. The ()-Ambrox may, for example, be free or substantially free of by-products (III). The selective crystallisation step may use a water miscible solvent such as ethanol or the like. The selective crystallisation of ()-Ambrox may be influenced by the presence of unreacted homofarnesol substrate and also the ratio of ()-Ambrox to the other detectable by-product (III), Even if only 10% conversion of the homofarnesol substrate to ()-Ambrox is obtained, the selective crystallisation of ()-Ambrox is still possible.

    [0796] The olfactive purity of the final ()-Ambrox product may be determined using a 10% ethanol extract in water or by testing the crystalline material. The final ()-Ambrox product is tested against a commercially available reference of ()-Ambrox product for its olfactive purity, quality and its sensory profile. The ()-Ambrox material is also tested in application studies by experts in order to determine if the material meets the specifications with respect to its organoleptic profile.

    [0797] The term olfactively pure as it is used in relation to ()-Ambrox, is intended to mean that ()-Ambrox is free of compounds (II), (III) or (IV), or any other material found in the reaction mixture, or that if such compounds or materials should be present, they are present in olfactory acceptable amounts, as that term is defined herein.

    [0798] In an embodiment of the invention ()-Ambrox in olfactively pure form contains less than 5% by weight of any of the compounds (II), (III) and/or (IV).

    [0799] In an embodiment of the invention ()-Ambrox in olfactively pure form contains less than 5% by weight of any of the compounds (II), (III), (IV) and/or any other material found in the reaction mixture.

    [0800] In more particular embodiments, ()-Ambrox in olfactively pure form contains less than 4%, less than 3%, less than 2%, less than 1%, less than 0.9%, less than 0.8%, less than 0.7%, less than 0.6%, less than 0.5%, less than 0.4%, less than 0.3%, less than 0.2%, less than 0.1%, or less than 0.05% by weight of each of the compounds (II), (III) and/or (IV).

    [0801] In more particular embodiments, ()-Ambrox in olfactively pure form contains less than 4%, less than 3%, less than 2%, less than 1%, less than 0.9%, less than 0.8%, less than 0.7%, less than 0.6%, less than 0.5%, less than 0.4%, less than 0.3%, less than 0.2%, less than 0.1%, or less than 0.05% by weight of each of the compounds (II), (III), (IV) and/or any other material found in the reaction mixture.

    [0802] In more particular embodiments, ()-Ambrox in olfactively pure form contains less than 4%, less than 3%, less than 2%, less than 1%, less than 0.9%, less than 0.8%, less than 0.7%, less than 0.6%, less than 0.5%, less than 0.4%, less than 0.3%, less than 0.2%, less than 0.1%, or less than 0.05% by weight but greater than 0% of each of the compounds (II), (III), (IV) and/or any other material found in the reaction mixture

    [0803] The quality of separation of ()-Ambrox from the mixture of the compounds (II), (III) and/or (IV) by selective crystallization may be influenced by the composition of the mixture from which it is separated. More particularly, the quality of the separation of ()-Ambrox from a mixture of compounds (II), (III) and/or (IV) by crystallization was improved when the weight ratio of ()-Ambrox to the other compounds (II), (III) and (IV) in the mixture was greater than 70:30, more particularly 80:20, more particularly 90:10, still more particularly 95:5, and more particularly still 97:3.

    [0804] The quality of separation of ()-Ambrox from the mixture of the compounds (II), (III), (IV) and/or any other material found in the reaction mixture by selective crystallization may be influenced by the composition of the mixture from which it is separated. More particularly, the quality of the separation of ()-Ambrox from a mixture of compounds (II), (III), (IV) and/or any other material found in the reaction mixture by crystallization was improved when the weight ratio of ()-Ambrox to the other compounds (II), (III), (IV) and any other material found in the reaction mixture in the mixture was greater than 70:30, more particularly 80:20, more particularly 90:10, still more particularly 95:5, and more particularly still 97:3.

    [0805] Furthermore, the quality of the separation of ()-Ambrox by crystallization may be influenced by the amount of unreacted homofarnesol present in the mixture from which it is separated. More particularly, the quality of separation is improved when the level of unreacted homofarnesol is less than 30% by weight, more particularly less than 20 wt %, more particularly less than 10% by weight, more particularly still less than 5 wt % and still more particularly less than 3% by weight, still more particularly less than 2% by weight, and more particularly still less than 1% by weight, based on the weight of the mixture from which ()-Ambrox is crystallized.

    [0806] Preferably, the reagents and reaction conditions employed in the bioconversion process of the present invention are such that the reaction proceeds with 100% conversion of homofarnesol, or substantially so, thus leaving no unreacted homofarnesol in the bioconversion medium. However, if unreacted homofarnesol is present, although economically disadvantageous, it can be separated from ()-Ambrox and other by-products by distillation, or washing crystals of ()-Ambrox with a suitable solvent, for example.

    [0807] Accordingly, in a particular embodiment of the invention, there is provided a method of isolating and purifying ()-Ambrox from a mixture comprising one or more of the compounds (II), (III) and (IV), which mixture is free, or substantially free, of homofarnesol. In a more particular embodiment, the isolation and purification of ()-Ambrox from a mixture comprising one or more of the compounds (II), (III) and (IV), and free or substantially free of homofarnesol, is achieved by the selective crystallization of ()-Ambrox.

    [0808] ()-Ambrox obtained according to a method of the present invention is obtained in olfacti-vely pure form. Olfactively pure ()-Ambrox forms another aspect of the present invention.

    [0809] The term isolated as used herein refers to a bioconversion product such as ()-Ambrox which has been separated or purified from components which accompany it. An entity that is produced in a cellular system different from the source from which it naturally originates is isolated, because it will necessarily be free of components which naturally accompany it. The degree of isolation or purity can be measured by any appropriate method, e.g. gas chromatography (GC), HPLC or NMR analysis.

    [0810] In some embodiments, the end product (()-Ambrox) is isolated and purified to homogeneity (e.g. at least 70%, 71%.72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, or 89.5% pure or 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% pure).

    [0811] Desirably, the amount of ()-Ambrox produced can be from about 1 mg/l to about 20,000 mg/l (20 g/l) or higher such as from about 20 g/l to about 200 g/l or from 100-200 g/l, preferably about 125 g/l or 150 g/l or about 188 g/l or about 200 g/l or about 250 g/l or about 300 g/l or about 350 g/l or about 400 g/l or about 450 g/l

    [0812] Desirably, the amount of ()-Ambrox produced can be from about 1 mg/l to about 20,000 mg/l (20 g/l) or higher such as from about 20 g/l to about 200 g/l or from 100-200 g/l, preferably about 125 g/l or 150 g/l or about 188 g/l or about 200 g/l or about 250 g/l or about 300 g/l or about 350 g/l or about 400 g/l or about 450 g/l

    [0813] At least 125 g/l ()-Ambrox may be produced in a bioconversion reaction using a recombinant E. coli host cell producing a SHC/HAC enzyme or enzyme variant over about 2 days. It is possible to run bioconversions at 188 g/l EEH or higher (e.g. 400 g/l or 450 g/l) provided efficient mixing is achieved as stirring efficiency may be the only limitation of the system. In addition, a biocatalyst with improved activity and/or selectivity (e.g. in terms of SHC variants with further improved activity or in terms of increased SHC enzyme production and/or in terms of substrate selectivity or product selectivity) may improve or maintain productivity using less biomass or increasing substrate concentration which is advantageous with respect to mixing efficiencies.

    [0814] For example about 1 to about 100 mg/l, about 30 to about 100 mg/l, about 50 to about 200 mg/l, about 100 to about 500 mg/l, about 100 to about 1,000 mg/l, about 250 to about 5,000 mg/l, about 1,000 (1 g/l) to about 15,000 mg/l (15 g/l), or about 2,000 (2 g/l) to about 10,000 mg/l (10 g/l) or about 2,000 (2 g/l) to about 25,000 mg/l (25 g/l) or about 2,000 (2 g/l) to about 25,000 mg/l (25 g/l), 26,000 mg/l (26 g/l), 27,000 mg/l (27 g/l), 28,000 mg/l (28 g/l), 29,000 mg/l (29 g/l), 30,000 mg/l (30 g/l), 40 g/l, 50 g/l, 60 g/l, 70 g/l, 80 g/l, 90 g/l, 100 g/l, 110 g/l, 120 g/l, 125 g/l, 130 g/l, 140 g/l, 150 g/l, 160 g/l, 170 g/l, 180 g/l, 190 g/l or 200 g/l or 300 g/l or 400 g/l or 450 g/l or 500 g/l of ()-Ambrox is produced.

    [0815] Preferably ()-Ambrox at a concentration of at least 100 g/l is produced within a period of time of from 48 to 72 hours.

    [0816] Preferably ()-Ambrox at a concentration of about 150 g/l is produced within a time period of from about 48 to 72 hours. Preferably ()-Ambrox at a concentration of about 200 g/l is produced within a time period of from about 48 to 72 hours.

    [0817] Preferably ()-Ambrox at a concentration of about 250 g/l is produced within a time period of from about 48 to 72 hours.

    [0818] Preferably ()-Ambrox at a concentration of about 300 g/l is produced within a time period of from about 48 to 72 hours.

    [0819] Preferably ()-Ambrox at a concentration of about 400 g/l is produced within a time period of from about 48 to 72 hours.

    [0820] Preferably ()-Ambrox at a concentration of about 450 g/l is produced within a time period of from about 48 to 72 hours.

    [0821] The bioconversion of homofarnesol to ()-Ambrox according to the present disclosure produces ()-Ambrox as a predominant compound but may also produce compounds other than ()-Ambrox which may or may not impart pleasant olfactive notes to the bioconversion mixture and so may contribute in a positive or negative manner to the sensory character of the ()-Ambrox end product. Accordingly, a sensory analysis is carried out using well established sensory tests utilized by trained Experts (e.g. Perfumers) so that the testing can assist in determining if a chemically relevant product is also an olfactively relevant end product relative to a reference product. The removal of one of more by-product compounds from ()-Ambrox can improve the odor of the reaction product mixture comprising ()-Ambrox even if the removed compounds are actually odorless compounds per se. That is, an ()-Ambrox odor enhancement may be observed in the absence of compounds 1l, Ill and IV.

    [0822] Various applications for ()-Ambrox include but are not limited to a fine fragrance or a consumer product such as fabric care, toiletries, beauty care and cleaning products, detergent products, and soap products, including essentially all products where the currently available Ambrox ingredients are used commercially, including but not limited to: Ambrox (Firmenich), Ambroxan (Henkel), Ambrofix (Givaudan), Amberlyn (Quest), Cetalox Laevo (Firmenich), Ambermor (Aromor) and Norambrenolide Ether (Pacific) products.

    [0823] Thus, there is further provided herein a use of ()-Ambrox obtained by or obtainable by a process described herein as part of a fragrance or a cosmetic or a consumer product. There is also provided herein a product comprising ()-Ambrox obtained by or obtainable by a process described herein. The product may, for example, be a fragrance or a cosmetic or a consumer product.

    Ambra Oxide and Uses Thereof

    [0824] There is further provided herein the reaction products made by the processes described herein. The reaction products may, for example, comprise, consist essentially of consist of Ambra oxide and one or more further compounds, for example one or more of a compound of formula (XI), a compound of formula (XII) and a compound of formula (XIII).

    [0825] As used herein, the term Ambra oxide includes Ambra oxide of formula (X) below as well as Ambra oxide of formula (X) in isomerically pure form or in a mixture with one or more of the following molecules of formula (XI), (XII) and/or (XIII),

    ##STR00017##

    [0826] The nomenclature for the reaction products of formulae (X), (XI), (XII) and (XIII) is set out below.

    TABLE-US-00014 TABLE 14 Nomenclature for the reaction products of formulae (X), (XI), (XII) and (XIII). Compound Name and Structure (X) [00018]embedded image (4aR,6aS,10aS,10bR)-4a,7,7,10a- tetramethyldodecahydro-1H-benzo[f]chromene] (Ambra oxide) (XI) [00019]embedded image [(4aR,6aS,10aS,10bS)-4a,7,7,10a- tetramethyldodecahydro-1H-benzo[f]chromene] (XII) [00020]embedded image [3-((1S,4aS,8aS)-5,5,8a-trimethyl-2- methylenedecahydronaphthalen-1-yl)propan-1-ol] (XIII) [00021]embedded image [(8aS,12aS,Z)-6,9,9,12a-tetramethyl- 3,4,7,8,8a,9,10,11,12,12a-decahydro-2H-benzo[b]oxecine]

    [0827] Ambra oxide can be produced from (+)-Larixol as described in Bolster et al., Tetrahedron, 2002, 58(26), pages 5275-5285. However, it is desirable to provide alternative or improved methods for producing Ambra oxide.

    [0828] The processes described herein may make Ambra oxide of formula (X) alone or in a mixture with by-products such as the compound shown in formulae (XI), (XII) and/or (XIII). For example, other stereoisomers of formula (X) may be made by the processes described herein.

    [0829] There is therefore provided herein a compound of formula (X) or a composition comprising a compound of formula (X) obtained by or obtainable by the processes described herein, including all embodiments thereof.

    [0830] In certain embodiments, not all of the bishomofarnesol (e.g. BisEEH) is converted to Ambra oxide or a by-product of the reaction. Therefore, the compositions described herein, for example the compositions obtained by obtainable by the processes described herein may comprise bishomofarnesol (e.g. bisEEH, for example in addition to the compound of formula (X) and/or compounds of formula (XI), (XII) and/or (XIII)). Any remaining homofarnesol may be separated from the other reaction products such that the Ambra oxide product does not comprise bishomofarnesol. In other embodiments, all of the bishomofarnesol starting material is converted to Ambra oxide of formula (X) or a by-product of the reaction by the processes described herein.

    [0831] Therefore, the compositions described herein may comprise, consist essentially of or consist of one or more of a compound of formula (X), a compound of formula (XI), a compound of formula (XII), a compound of formula (XIII), bishomofarnesol starting material (e.g. bisEEH) and other stereoisomers of the compound of formula (X). For example, the compositions described herein may comprise, consist essentially of or consist of a compound of formula (X) and one or more of a compound of formula (XI), a compound of formula (XII) and a compound of formula (XIII).

    [0832] For example, the compositions described herein may comprise, consist essentially of or consist of a compound of formula (X) and one or more of a compound of formula (XI), a compound of formula (XII).

    [0833] For example, the compositions described herein may comprise, consist essentially of or consist of a compound of formula (X) and a compound of formula (XII) Example 12 demonstrates that the SHC/HAC variants described herein exhibit: [0834] an increased substrate specificity for E,E-Bis-homofarnesol (see FIG. 10), when a bis-homofarnesol substrate is used [0835] an increased product selectivity for the E,E isomer of Bis-homofarnesol, when a bis-homofarnesol substrates are used, [0836] an increased degree of conversion of BisEEH) as well as an increased conversion rate of BisEEH) over the first 3 to 6 hours (or over the first 4, 5, or 6 hours) of the reaction, compared to the reference SHC enzyme (e.g. wild-type SHC such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, 310 or 215G2 AacSHC or SHC #65 or a parent SHC enzyme the variant derives from such as those represented by SEQ ID NO:2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383.

    [0837] Overall the observations regarding substrate specificity and product selectivity were in line with the ones described with Homofarnesol earlier herein. It was concluded that the effect of P2 mutations can be transferred to substrates other than E,E-homofarnesol, E,E-Bis-homofarnesol being one example.

    [0838] The compositions described herein may therefore comprise equal to or greater than about equal to or greater than about 50 wt % of the compound of formula(X) based on the total weight of the compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII). For example, the compositions described herein may comprise equal to or greater than about 55 wt % or equal to or greater than about 60 wt % or equal to or greater than about 65 wt % or equal to or greater than about 70 wt % or equal to or greater than about 75 wt % or equal to or greater than about 80 wt % or equal to or greater than about 85 wt % or equal to or greater than about 90 wt % or equal to or greater than about 95 wt % of the compound of formula (X) based on the total weight of the compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII). The compositions described herein may, for example, comprise equal to or less than about 100 wt % of the compound of formula (X) based on the total weight of the compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII). For example, the mixture may comprise equal to or less than about 99 wt % or equal to or less than about 98 wt % or equal to or less than about 97 wt % of the compound of formula (X) based on the total weight of compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII). For example, the compositions described herein may comprise from about 50 wt % to about 100 wt % or from about 60 wt % to about 99 wt % or from about 70 wt % to about 98 wt % or from about 80 wt % to about 97 wt % or from about 90 wt % to about 97 wt % of the compound of formula (X) based on the total weight of the compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII).

    [0839] The weight ratio of the compound of formula (X) to the total weight of the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII) in the compositions described herein may, for example, range from about 60:40 to about 99:1. For example, the weight ratio of the compound of formula (X) to the total weight of the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII) may range from about 65:35 to about 99:1 or from about 70:30 to about 99:1 or from about 75:25 to about 99:1 or from about 80:20 to about 99:1 or from about 85:15 to about 99:1 or from about 90:10 to about 99:1 or from about 95:5 to about 99:1. For example, the weight ratio of the compound of formula (X) to the total weight of the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII) may range from about 65:35 to about 98:2 or from about 70:30 to about 97:3 or from about 75:25 to about 96:4 or from about 80:20 to about 95:5 or from about 85:15 to about 90:10.

    [0840] The weight ratio of the compound of formula (X) to bishomofarnesol (e.g. bisEEH) in the compositions described herein may, for example, range from about 90:10 to about 100:0. For example, the weight ratio of the compound of formula (X) to bishomofarnesol (e.g. bisEEH) in the compositions described herein may range from about 92:8 to about 100:0 or from about 94:6 to about 100:0 or from about 95:5 to about 100:0 or from about 96:4 to about 99.5:0.5 or from about 97:3 to about 99.0:1.0 or from about 98:2 to about 99.0:1.0.

    [0841] The amount of the compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII) in a mixture of stereoisomers may, for example, be quantified by gas chromatography and/or identified by NMR spectroscopy.

    [0842] Ambra oxide synthesized by the processes described herein (e.g. using SHC/HAC enzymes or variants thereof and optionally recombinant host cells) may, for example, be present in the solid phase. It may be in amorphous form or crystalline form.

    [0843] The Ambra oxide produced by the methods described herein (e.g. using SHC/HAC enzymes or variants thereof and recombinant host cells) may be isolated by steam extraction/distillation or organic solvent extraction using a non-water miscible solvent (to separate the reaction products and unreacted substrate from the biocatalyst which stays in the aqueous phase) followed by subsequent evaporation of the solvent to obtain a crude reaction product as determined by gas chromatographic (GC) analysis. The steam extraction/distillation and organic solvent extraction methods are known to those skilled in the art.

    [0844] By way of example, the resulting Ambra oxide may be extracted from the whole reaction mixture using an organic solvent such as a non-water miscible solvent (for example toluene). Alternatively, the resulting Ambra oxide may be extracted from the solid phase of the reaction mixture (obtained by, for example, centrifugation or filtration) using a water miscible solvent (for example ethanol) or a non-water miscible solvent (for example toluene). By way of further example, Ambra oxide is formed as solid. It may be present in the solid phase as crystals or in amorphous form and can be separated from the remaining solid phase (cell material or debris thereof) and the liquid phase also by means of filtration.

    [0845] By way of further example, at a temperature above the melting point of Ambra oxide, the Ambra oxide may form an oil layer on top of aqueous phase, which oil layer can be removed and collected. In order to ensure a complete recovery of Ambra oxide after the oil layer is removed, an organic solvent may be added to the aqueous phase containing the biomass in order to extract any residual Ambra oxide contained in, or on or about the biomass. The organic layer can be combined with the oil layer, before the whole is further processed to isolate and purify Ambra oxide. The Ambra oxide may be further selectively crystallised to remove by-products (XI), (XII) and (XIII) and any unreacted bishomofarnesol substrate from the final Ambra oxide product. The term selective crystallization refers to a process step whereby Ambra oxide is caused to crystallise from a solvent whilst the compounds (XI), (XII) and (XIII) remain dissolved in the crystallising solvent to such an extent that isolated crystalline material contains only Ambra oxide product, or if it contains any of the other compounds (X), (XII) or (XIII), then they are present only in olfactory acceptable amounts. The Ambra oxide may, for example, be free or substantially free of by-products (XI), (XII) and (XIII). The selective crystallisation step may use a water miscible solvent such as ethanol or the like. The selective crystallisation of Ambra oxide may be influenced by the presence of unreacted homofarnesol substrate and also the ratio of Ambra oxide to the other detectable by-products (XI), (XII) and/or (XIII). Even if only 10% conversion of the homofarnesol substrate to Ambra oxide is obtained, the selective crystallisation of Ambra oxide is still possible.

    [0846] The olfactive purity of the final Ambra oxide product may be determined using a 10% ethanol extract in water or by testing the crystalline material. The final Ambra oxide product is tested against a commercially available reference of Ambra oxide product for its olfactive purity, quality and its sensory profile. The Ambra oxide material is also tested in application studies by experts in order to determine if the material meets the specifications with respect to its organoleptic profile.

    [0847] Examples of suitable water miscible and non-water miscible organic solvents suitable for use in the extraction and/or selective crystallization of Ambra oxide include but are not limited to aliphatic hydrocarbons, preferably those having 5 to 8 carbon atoms, such as pentane, cyclopentane, hexane, cyclohexane, heptane, octane or cyclooctane, halogenated aliphatic hydrocarbons, preferably those having one or two carbon atoms, such as dichloromethane, chloroform, carbon tetrachloride, dichloroethane or tetrachloroethane, aromatic hydrocarbons, such as benzene, toluene, the xylenes, chlorobenzene or dichlorobenzene, aliphatic acyclic and cyclic ethers or alcohols, preferably those having 4 to 8 carbon atoms, such as ethanol, isopropanol, diethyl ether, methyl tert.-butyl ether, ethyl tert.-butyl ether, dipropyl ether, diisopropyl ether, dibutyl ether, tetrahydrofuran or esters such as ethyl acetate or n-butyl acetate or ketones such as methyl isobutyl ketone or dioxane or mixtures of these. The solvents which are especially preferably used are the abovementioned heptane, Methyl tert-butyl ether (also known as MTBE, tert-butyl methyl ether, tertiary butyl methyl ether and tBME), diisopropyl ether, tetrahydrofuran, ethyl acetate and/or mixtures thereof. Preferably, a water miscible solvent such as ethanol is used for the extraction of Ambra oxide from the solid phase of the reaction mixture. The use of ethanol is advantageous because it is easy to handle, it is non-toxic and it is environmentally friendly.

    [0848] The term isolated as used herein refers to a bioconversion product such as Ambra oxide which has been separated or purified from components which accompany it. An entity that is produced in a cellular system different from the source from which it naturally originates is isolated, because it will necessarily be free of components which naturally accompany it. The degree of isolation or purity can be measured by any appropriate method, e.g. gas chromatography (GC), HPLC or NMR analysis.

    [0849] In some embodiments, the end product (Ambra oxide) is isolated and purified to homogeneity (e.g. at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, or 89.5% pure or 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.5% pure).

    [0850] Desirably, the amount of Ambra oxide produced can be from about 1 mg/l to about 20,000 mg/l (20 g/l) or higher such as from about 20 g/l to about 200 g/l or from 100-200 g/l, preferably about 125 g/l or 150 g/l or about 188 g/l

    [0851] For example about 1 to about 100 mg/l, about 30 to about 100 mg/l, about 50 to about 200 mg/l, about 100 to about 500 mg/l, about 100 to about 1,000 mg/l, about 250 to about 5,000 mg/l, about 1,000 (1 g/l) to about 15,000 mg/l (15 g/l), or about 2,000 (2 g/l) to about 10,000 mg/l (10 g/l) or about 2,000 (2 g/l) to about 25,000 mg/l (25 g/l) or about 2,000 (2 g/l) to about 25,000 mg/l (25 g/l), 26,000 mg/l (26 g/l), 27,000 mg/l (27 g/l), 28,000 mg/l (28 g/l), 29,000 mg/l (29 g/l), 30,000 mg/l (30 g/l), 40 g/l, 50 g/l, 60 g/l, 70 g/l, 80 g/l, 90 g/l, 100 g/l, 110 g/l, 120 g/l, 125 g/l, 130 g/l, 140 g/l, 150 g/l, 160 g/l, 170 g/l, 180 g/l, 190 g/l or 200 g/l or 300 g/l or 400 g/l or 500 g/l of Ambra oxide is produced. Preferably Ambra oxide at a concentration of at least 100 g/l is produced within a period of time from 48 to 72 hours.

    [0852] Preferably Ambra oxide at a concentration of about 150 g/l is produced within a time period of from about 48 to 72 hours. Preferably Ambra oxide at a concentration of about 200 g/l is produced within a time period of from about 48 to 72 hours.

    [0853] Preferably Ambra oxide at a concentration of about 250 g/l is produced within a time period of from about 48 to 72 hours.

    [0854] The bioconversion of bishomofarnesol to Ambra oxide according to the present disclosure produces Ambra oxide as a predominant compound but may also produce compounds other than Ambra oxide which may or may not impart pleasant olfactive notes to the bioconversion mixture and so may contribute in a positive or negative manner to the sensory character of the Ambra oxide end product. Accordingly, a sensory analysis is carried out using well established sensory tests utilized by trained Experts (e.g. Perfumers) so that the testing can assist in determining if a chemically relevant product is also an olfactively relevant end product relative to a reference product. The removal of one of more by-product compounds from Ambra oxide can improve the odor of the remaining compound (Ambra oxide) even if the removed compounds are actually odorless compounds per se. That is, an Ambra oxide odor enhancement may be observed in the absence of compounds XI, XII and XIII.

    [0855] Various applications for Ambra oxide include but are not limited to a fine fragrance or a consumer product such as fabric care, toiletries, beauty care and cleaning products, detergent products, and soap products, including essentially all products where the currently available Ambra oxide ingredients are used commercially.

    [0856] Thus, there is further provided herein a use of Ambra oxide obtained by or obtainable by a process described herein as part of a fragrance or a cosmetic or a consumer product. There is also provided herein a product comprising Ambra oxide obtained by or obtainable by a process described herein. The product may, for example, be a fragrance or a cosmetic or a consumer product.

    Fragrance Compositions

    [0857] There is further provided herein the use of the compounds and compositions described herein as or in a fragrance composition.

    [0858] Thus, there is also provided herein a fragrance composition comprising one or more compounds of formula (II) or (X). A fragrance composition may, for example, be any composition comprising one or more compounds of formula (I) or (X) and a base material.

    [0859] As used herein, the base material includes all known fragrance ingredients selected from the extensive range of natural products, and synthetic molecules currently available, such as essential oils, alcohols, aldehydes and ketones, ethers and acetals, esters and lactones, macrocycles and heterocycles, and/or in admixture with one or more ingredients or excipients conventionally used in conjunction with odorants in fragrance compositions, for example, carrier materials, diluents, and other auxiliary agents commonly used in the art.

    [0860] Fragrance ingredients known to the art are readily available commercially from the major fragrance manufacturers. Non-limiting examples of such ingredients include: [0861] essential oils and extracts, e.g. castoreum, costus root oil, oak moss absolute, geranium oil, tree moss absolute, basil oil, fruit oils, such as bergamot oil and mandarine oil, myrtle oil, palmarose oil, patchouli oil, petitgrain oil, jasmine oil, rose oil, sandalwood oil, wormwood oil, lavender oil and/or ylang-ylang oil; [0862] alcohols, e.g. cinnamic alcohol ((E)-3-phenylprop-2-en-1-ol); cis-3-hexenol ((Z)-hex-3-en-1-ol); citronellol (3,7-dimethyloct-6-en-1-ol); dihydro myrcenol (2,6-dimethyloct-7-en-2-0l); Ebanol ((E)-3-methyl-5-(2,2,3-trimethylcyclopent-3-en-1-yl)pent-4-en-2-ol); eugenol (4-allyl-2-methoxyphenol); ethyl linalool ((E)-3,7-dimethylnona-1,6-dien-3-ol); farnesol ((2E,6Z)-3,7,11-trimethyldodeca-2,6,10-trien-1-ol); geraniol ((E)-3,7-dimethylocta-2,6-dien-1-ol); Super Muguet ((E)-6-ethyl-3-methyloct-6-en-1-ol); linalool (3,7-dimethylocta-1,6-dien-3-ol); menthol (2-isopropyl-5-methylcyclohexanol); Nerol (3,7-dimethyl-2,6-octadien-1-ol); phenyl ethyl alcohol (2-phenylethanol); Rhodinol (3,7-dimethyloct-6-en-1-ol); Sandalore (3-methyl-5-(2,2,3-trimethylcyclopent-3-en-1-yl)pentan-2-ol); terpineol (2-(4-methylcyclohex-3-en-1-yl)propan-2-ol); or Timberol (1 (2,2,6-trimethylcyclohexyl)hexan-3-ol); 2,4,7-trimethylocta-2,6-dien-1-ol, and/or [1-methyl-2(5-methylhex-4-en-2-yl)cyclopropyl]-methanol; [0863] aldehydes and ketones, e.g. anisaldehyde (4-methoxybenzaldehyde); alpha amyl cinnamic aldehyde (2-benzylideneheptanal); Georgywood (1-(1,2,8,8-tetramethyl-1,2,3,4,5,6,7,8-octahydronaphthalen-2-yl)ethanone); Hydroxycitronellal (7-hydroxy-3,7-dimethyloctanal); Iso E Super (1-(2,3,8,8-tetramethyl-1,2,3,4,5,6,7,8-octahydronaphthalen-2-yl)ethanone); Isoraldeine ((E)-3-methyl-4-(2,6,6-trimethylcyclohex-2-en-1-yl)but-3-en-2-one); 3-(4-isobutyl-2-methylphenyl)propanal; maltol; methyl cedryl ketone; methylionone; verbenone; and/or vanillin; [0864] ether and acetals, e.g. Ambrox (3a,6,6,9a-tetramethyl-2,4,5,5a,7,8,9,9b-octahydro-1H-benzo[e][1]benzofuran); geranyl methyl ether ((2E)-1-methoxy-3,7-dimethylocta-2,6-diene); rose oxide (4-methyl-2-(2-methylprop-1-en-1-yl)tetrahydro-2H-pyran); and/or Spirambrene (2,2,3,7,7-pentamethylspiro[bicyclo[4.1.0]heptane-2,5-[1,3]dioxane]); [0865] macrocycles, e.g. Ambrettolide ((Z)-oxacycloheptadec-10-en-2-one); ethylene brassylate (1,4-dioxacycloheptadecane-5,17-dione); and/or Exaltolide (16-oxacyclohexadecan-1-one); and [0866] heterocycles, e.g. isobutylquinoline (2-isobutylquinoline).

    [0867] As used herein, carrier material means a material which is practically neutral from an odorant point of view, i.e. a material that does not significantly alter the organoleptic properties of odorants.

    [0868] By diluents is meant any diluent conventionally used in conjunction with odorants, such as diethyl phthalate (DEP), dipropylene glycol (DPG), isopropyl myristate (IPM), triethyl citrate (TEC) and alcohol (e.g. ethanol).

    [0869] The term auxiliary agent refers to ingredients that might be employed in a fragrance composition for reasons not specifically related to the olfactive performance of said composition. For example, an auxiliary agent may be an ingredient that acts as an aid to processing a fragrance ingredient or ingredients, or a composition containing said ingredient(s), or it may improve handling or storage of a fragrance ingredient or composition containing same, such as anti-oxidant adjuvant.

    [0870] Said anti-oxidant may be selected, for example, from Tinogard TT (BASF), Tinogard Q (BASF), Tocopherol (including its isomers, CAS 59-02-9; 364-49-8; 18920-62-2; 121854-78-2), 2,6-bis(1,1-dimethylethyl)-4-methylphenol (BHT, CAS 128-37-0) and related phenols, hydroquinones (CAS 121-31-9).

    [0871] It might also be an ingredient that provides additional benefits such as imparting colour or texture.

    [0872] It might also be an ingredient that imparts light resistance or chemical stability to one or more ingredients contained in a fragrance composition.

    [0873] A detailed description of the nature and type of auxiliary agent commonly used in fragrance compositions containing same cannot be exhaustive, but it has to be mentioned that said ingredients are well known to a person skilled in the art.

    [0874] There is also provided herein a consumer product comprising a compound or a composition or fragrance composition as described herein, including any embodiment thereof. The consumer product may, for example, be a cosmetic product (e.g. an eau de parfum or eau de toilette), a cleaning product, a detergent product, or a soap product.

    [0875] The following numbered paragraphs define further aspects of the present disclosure.

    [0876] Paragraph 1: A protein with the enzymatic activity of a Squalene-hopene-cyclase (SHC) comprising [0877] a) a mutated amino acid sequence relative to the wild type SHC of Alicyclobacillus acidocaldarius (wild type AacSHC) of SEQ ID No. 1, wherein the W at position 169 of SEQ ID No. 1 is replaced by one amino acid selected from the group consisting of G, A and V or a functional equivalent of the mutated amino acid sequence, wherein the functional equivalent of the mutated amino acid sequence has an amino acid sequence identity from 38.0 to 99.9% to the amino acid sequence of the mutated amino acid sequence or [0878] b) a mutated amino acid sequence relative to a wild type SHC (WT-SHC), wherein the W at a position in the amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by an amino acid selected from the group consisting of G, A and V or a functional equivalent of the mutated amino acid sequence, wherein the functional equivalent of the mutated amino acid sequence has an amino acid sequence identity from 38.0 to 99.9% to the amino acid sequence of the mutated amino acid sequence.

    [0879] Paragraph 2: The protein of paragraph 1, wherein the mutated amino acid sequence relative to the wild type AacSHC of SEQ ID No. 1 is the amino acid sequence of SEQ ID Nos 315, 316 or 317 Paragraph 3: The protein of paragraph 1, wherein the WT-SHC is selected from the group consisting of WT-SHC of Acetobacter pasteurianus (ApaSHC1, SEQ ID No. 24), Burkholderia ambifaria (BamSHC1, SEQ ID No. 28, BamSHC2, SEQ ID No. 29), Bradyrhizobium japonicum (BjaSHC or BjpSHC SEQ ID No. 119), Pelobacter carbinolicus or Syntrophotalea carbinolica DSM 2380 (PcaSHC2, SEQ ID No. 30), Rhodopseudomonas palustris (RpaSHC1, SEQ ID No. 31), Streptomyces coelicolor (ScoSHC, SEQ ID No. 32), Syntrophobacter fumaroxidans (SfuSHC1, SEQ ID No. 33), Teredinibacter turnerae (TtuSHC, SEQ ID No. 34), Zymomonas mobilis (ZmoSHC1, SEQ ID No. 13 or 14, ZmoSHC2, SEQ ID No. 15) and Thermosynechococcus elongatus (TeISHC, SEQ ID No. 23).

    [0880] Paragraph 4: The protein of paragraph 1 or 3, wherein the mutated amino acid sequence relative to a WT-SHC of SEQ ID Nos 13, 14, 15, 23-24, 28, 29, 30, 31, 32, 33, 34 is the amino acid sequence of SEQ ID Nos 302, 303, 304.

    [0881] Paragraph 5: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No. 1 is replaced by G (SEQ ID No. 315, 318, 319, 320, 321,322, 333, 334, 335 336, 337, 350, 305) or b) wherein the W at position 172 in the amino acid sequence of the wild type TeISHC (SEQ ID No. 23) corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G (SEQ ID No. 302, 304).

    [0882] Paragraph 6: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the G at position 600 of the wild type AacSHC of SEQ ID No. 1 is replaced by one amino acid selected from the group consisting of A, V, L, I and M (SEQ ID Nos 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 305) or b) wherein the amino acid, in particular G, at a position in the amino acid sequence of the WT-SHC corresponding to G600 in the wild type AacSHC of SEQ ID No. 1 is replaced by an amino acid selected from the group consisting of A, V, L, I and M.

    [0883] Paragraph 7 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the A at position 306 of the wild type AacSHC of SEQ ID No. 1 is replaced by V (SEQ ID Nos 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346,347, 350, 351, 352) or b) wherein the amino acid, in particular P or C, at a position in the amino acid sequence of the WT-SHC corresponding to A306 in the wild type AacSHC of SEQ ID No. 1 is replaced by V.

    [0884] Paragraph 8: the protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No. 1 is replaced by G (SEQ ID No. 315, 318, 319, 320, 321,322, 333, 334, 335, 336,337, 350, 305) or b) wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G and the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No. 1 is replaced by S.

    [0885] Paragraph 9: The protein of one of the preceding paragraphs comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No. 1 is replaced by Y.

    [0886] Paragraph 10: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No. 1 is replaced by S and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No. 1 is replaced by Y.

    [0887] Paragraph 11: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No. 1 is replaced by A (SEQ ID No. 316, 323, 324, 325, 326,327, 338, 339, 340, 341,342, 351) or b), wherein the W at the position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by A and the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No. 1 is replaced by S.

    [0888] Paragraph 12: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by A and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No. 1 is replaced by Y.

    [0889] Paragraph 13: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by A, the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No. 1 is replaced by S and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No. 1 is replaced by Y.

    [0890] Paragraph 14: A nucleic acid sequence, which encodes a protein of one of the preceding claims, in particular as identified in SEQ ID No. 349.

    [0891] Paragraph 15: An expression cassette, comprising the nucleic acid sequence of paragraph 14.

    [0892] Paragraph 16. A vector, comprising the nucleic acid sequence of paragraph 14 or the expression cassette of claim 15.

    [0893] Paragraph 17. A host cell, comprising the vector of paragraph 16 or the expression cassette of paragraph 15 or the nucleic acid sequence of paragraph 14.

    [0894] Paragraph 18: A process for preparing a biocatalyst with the enzymatic activity of a SHC, comprising the following steps: [0895] a) providing the host cell of paragraph 17, comprising a nucleic acid sequence encoding a protein according to any one of paragraphs 1 to 13, [0896] b) cultivating the host cell of step a) in a culture medium under conditions, which allow the expression of the protein and [0897] c) obtaining the biocatalyst, in particular the expressed protein or a host cell comprising the expressed protein.

    [0898] Paragraph 19. A biocatalyst, in particular prepared according to the process of paragraph 18, wherein the biocatalyst is the protein according to any one of paragraph 1 to 13, a host cell comprising the protein according to any one of paragraph 1 to 13, a host cell lysate, freeze dried host cell, host cell extract or host cell fraction comprising the protein according to any one of paragraph 1 to 13.

    [0899] Paragraph 20. A process for preparing a composition comprising ()-Ambrox, comprising the following steps: [0900] x) providing homofarnesol, a reaction medium and the biocatalyst of paragraph 19, [0901] y) mixing the provided homofarnesol with the reaction medium and the biocatalyst of paragraph 19 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to ()-Ambrox and [0902] z) obtaining a composition comprising ()-Ambrox.

    [0903] Paragraph 21. A process for preparing an aroma for human or animal use comprising the following steps: [0904] i) performing a process according to paragraph 20, [0905] j) admixing the composition comprising ()-Ambrox obtained in step i) and at least one further component and [0906] l) obtaining an aroma for human or animal use comprising the composition and at least one further component.

    [0907] Paragraph 22. A biocatalyst comprising up to two or two or more SHC active site mutations and/or up to two or two or more site mutations other than SHC active site mutations wherein the active site mutations are selected from the active site amino acid positions (based on AacSHC) listed in Table 10 comprising active site positions 36, 168, 169, 261, 306, 307, 312, 365, 366, 420, 489, 600, 607, 609, and/or 612, preferably 169, 261, 312, 365, 489, 600, 609 and/or 612 and wherein the mutations other than active site mutations are selected from the site mutations listed in Table 7 and/or Table 8 and/or Table 9 and/or Table 18 disclosed herein, preferably comprising M132R and/or 1432T or functional equivalents, thereof wherein the biocatalyst is a protein, a host cell comprising the protein, a host cell lysate, freeze dried host cell, host cell extract or host cell fraction comprising the protein. By way of example, FIG. 19 of WO2016/170099 shows the location of the non-active site mutations identified in SHC/HAC variants 101A10, 111C8 and 215G2 (comprising M132R, 1432T and A224V) on the SHC Crystal Structure. A CAVER analysis of the AacSHC crystal structure can be performed to identify useful active site mutations and site mutations other than active site mutations useful for the preparation of a product of interest using an SHC variant comprising such beneficial active site mutations and site mutations other than active site mutations as described herein.

    [0908] Paragraph 23. A process for preparing a composition comprising ()-Ambrox or a mixture comprising ()-Ambrox, comprising the following steps: [0909] x) providing homofarnesol, a reaction medium and the biocatalyst of paragraph 22, [0910] y) mixing the provided homofarnesol with the reaction medium and the biocatalyst of paragraph 22 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to ()-Ambrox and [0911] z) obtaining a composition comprising ()-Ambrox.

    [0912] Paragraph 24. A process for preparing a composition comprising ()-Ambrox or a mixture comprising ()-Ambrox, comprising the following steps: [0913] x) providing homofarnesol, a reaction medium and a biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 [0914] y) mixing the provided homofarnesol with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to ()-Ambrox and [0915] z) obtaining a composition comprising ()-Ambrox.

    [0916] Paragraph 25. A process for preparing a composition comprising Amberketal, or a mixture comprising Amberketal comprising the following steps: [0917] x) providing hydroxyfarnesylacetone, a reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 [0918] y) mixing the provided hydroxyfarnesylacetone with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 and reacting the hydroxyfarnesylacetone with the biocatalyst under reaction conditions so as to convert the hydroxyfarnesylacetone to ()-Amberketal and [0919] z) obtaining a composition comprising Amberketal.

    [0920] Paragraph 26. A process for preparing a composition comprising Ambra oxide or a mixture comprising Ambra oxide comprising the following steps: [0921] x) providing (2-E)-Bishomofarnesol (BisEEH), a reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 [0922] y) mixing the provided BisEEH with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 and reacting the BisEEH with the biocatalyst under reaction conditions so as to convert the BisEEH to Ambra oxide and [0923] z) obtaining a composition comprising Ambra oxide.

    [0924] Paragraph 27: A process for preparing ()-Ambrox or a mixture comprising ()-Ambrox, wherein (3E,7E)-homofarnesol (EEH) or a mixture of stereoisomers comprising EEH is enzymatically converted to ()-Ambrox or a mixture comprising ()-Ambrox wherein the enzymatic conversion is carried out using an SHC/HAC enzyme under reaction conditions suitable for the production of ()-Ambrox and wherein the mixture of stereoisomers comprising EEH consists essentially of homofarnesol isomers selected from one or more of the following groups consisting of [(3E,7E) and [(3Z,7E)] and/or [(3E,7E) and (3E,7Z)] and/or [(3Z,7E), (3E,7E) and (3E,7Z)] also designated as [EE:EZ], [EE:ZE] and [EE:EZ:ZE] respectively and wherein the SHC/HAC enzyme polypeptide sequence is selected from the group consisting of a SHC enzyme or SHC enzyme variant selected from Table 2, Table 3, Table 7, Table 8, Table 9, Table 16, or Table 18 and/or a sequence with a least 30%, at least 40% identity, at least 50% identity, or at least 60% identity, or at least 70% identity, or at least 80% identity, or at least 90% identity, or at least 95% identity, or at least 96% identity, or at least 97% identity, or at least 98% identity, or at least 99% identity to an SHC amino acid sequence or SHC variant amino acid sequence as selected from Table 2, Table 3, Table 7, Table 8, Table 9, Table 16, or Table 18.

    [0925] Within the context of this above-mentioned aspect of the present application, SEQ ID No. 1 represents the amino acid sequence of the wild type SHC from Alicyclobacillus acidocaldarius (wild type AacSHC). SEQ ID No. 24 represents the amino acid sequence of WT-SHC of Acetobacter pasteurianus (ApaSHC). SEQ ID No. 28 represents the amino acid sequence of WT-SHC of Burkholderia ambifaria (BamSHC1). SEQ ID No. 29 represents the amino acid sequence of WT-SHC of Burkholderia ambifaria (BamSHC2) SEQ ID No. 16 represents the amino acid sequence of WT-SHC of Bradyrhizobium japonicum (BjaSHC or BjpSHC). SEQ ID No. 30 represents the amino acid sequence of WT-SHC of Pelobacter carbinolicus (PcaSHC) or Syntrophotalea carbinolica DSM 2380. SEQ ID No. 31 represents the amino acid sequence of WT-SHC of Rhodopseudomonas palustris (RpaSHC). SEQ ID No. 32 represents the amino acid sequence of WT-SHC of Streptomyces coelicolor(ScoSHC). SEQ ID No. 33 represents the amino acid sequence of WT-SHC of Syntrophobacter fumaroxidans (SfuSHC). SEQ ID No. 34 represents the amino acid sequence of WT-SHC of Teredinibacter turnerae (TtuSHC). SEQ ID No. 13 represents the amino acid sequence of WT-SHC of Zymomonas mobilis (ZmoSHC1). SEQ ID No. 15 represents the amino acid sequence of WT-SHC of Zymomonas mobilis (ZmoSHC2). SEQ ID No. 23 represents the amino acid sequence of WT-SHC of Thermosynechococcus elongatus (TeISHC, SEQ ID No. 13). SEQ ID No. 315 represents the mutated amino acid sequence of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G). SEQ ID No. 316 represents the mutated amino acid sequence of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A). SEQ ID No. 317 represents the mutated amino acid sequence of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V). SEQ ID No. 318 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G) and G600 is exchanged by A (G600A). SEQ ID No. 319 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G) and G600 is exchanged by V (G600V). SEQ ID No. 320 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G) and G600 is exchanged by L (G600L). SEQ ID No. 321 represents the mutated amino acid sequence of a functional equivalent of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G) and G600 is exchanged by I (G6001). SEQ ID No. 322 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G) and G600 is exchanged by M (G600M). SEQ ID No. 323 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A) and G600 is exchanged by A (G600A). SEQ ID No. 324 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A) and G600 is exchanged by V (G600V). SEQ ID No. 325 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A) and G600 is exchanged by L (G600L). SEQ ID No. 326 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A) and G600 is exchanged by I (G6001). SEQ ID No. 327 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A) and G600 is exchanged by M (G600M). SEQ ID No. 328 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V) and G600 is exchanged by A (G600A). SEQ ID No. 329 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V) and G600 is exchanged by V (G600V). SEQ ID No. 330 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V) and G600 is exchanged by L (G600L). SEQ ID No. 331 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V) and G600 is exchanged by I (G6001). SEQ ID No. 332 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V) and G600 is exchanged by M (G600M). SEQ ID No. 333 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G), G600 is exchanged by A (G600A) and A306 is exchanged by V (A306V). SEQ ID No. 334 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G), G600 is exchanged by V (G600V) and A306 is exchanged by V (A306V). SEQ ID No. 335 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G), G600 is exchanged by L (G600L) and A306 is exchanged by V (A306V). SEQ ID No. 336 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G), G600 is exchanged by I (G6001) and A306 is exchanged by V (A306V). SEQ ID No. 337 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G), G600 is exchanged by M (G600M) and A306 is exchanged by V (A306V). SEQ ID No. 338 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A), G600 is exchanged by A (G600A) and A306 is exchanged by V (A306V). SEQ ID No. 339 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A), G600 is exchanged by V (G600V) and A306 is exchanged by V (A306V). SEQ ID No. 340 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A), G600 is exchanged by L (G600L) and A306 is exchanged by V (A306V). SEQ ID No. 341 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A), G600 is exchanged by I (G6001) and A306 is exchanged by V (A306V). SEQ ID No. 342 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A), G600 is exchanged by M (G600M) and A306 is exchanged by V (A306V). SEQ ID No. 343 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V), G600 is exchanged by A (G600A) and A306 is exchanged by V (A306V). SEQ ID No. 344 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V), G600 is exchanged by V (G600V) and A306 is exchanged by V (A306V). SEQ ID No. 345 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V), G600 is exchanged by L (G600L) and A306 is exchanged by V (A306V). SEQ ID No. 346 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V), G600 is exchanged by I (G6001) and A306 is exchanged by V (A306V). SEQ ID No. 347 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V), G600 is exchanged by M (G600M) and A306 is exchanged by V (A306V). SEQ ID No. 348 represents the mutated amino acid sequence of the benchmark SHC from wild type AacSHC (SEQ ID No. 1), wherein M132 is exchanged by R (M132R), A224 is exchanged by V (A224V) and 1432 is exchanged by T (1432T). SEQ ID No. 349 represents the nucleotide sequence of the wild type SHC from Alicyclobacillus acidocaldarius (wild type AacSHC, SEQ ID No. 1). SEQ ID No. 350 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G) and A306 is exchanged by V (A306V). SEQ ID No. 351 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A) and A306 is exchanged by V (A306V).

    [0926] SEQ ID No. 352 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V) and A306 is exchanged by V (A306V). SEQ ID No. 302 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type TeISHC (SEQ ID No. 23), wherein W172 is exchanged by G (W172G), P311 is exchanged by A (P311A), F425 is exchanged by Y (F425Y) and G609 is exchanged by A (G609A). SEQ ID No. 303 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type ZmoSHC1 (SEQ ID No. 13), wherein Q221 is exchanged by S (Q221S), W222 is exchanged by G (W222G), A368 is exchanged by V (A368V), F486 is exchanged by Y (F486Y) and G667 is exchanged by A (G667A). SEQ ID No. 304 represents the mutated amino acid sequence of a mutant SHC from wild type TeISHC (SEQ ID No. 23), wherein W172 is exchanged by G (W172G). SEQ ID No. 305 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G), G600 is exchanged by M (G600M), M132 is exchanged by R (M132R), A224 is exchanged by V (A224V) and 1432 is exchanged by T (1432T).

    [0927] FIG. 19 of WO2016/170099 and FIG. 1 of Eichhorn et al Adv.Synth.Catal (2018) 360:2339-2351 show the location of the site mutations other than active site mutations identified in SHC/HAC variants 101A10, 111C8 and 215G2 (comprising M132R, 1432T and A224V) on the SHC Crystal Structure (in colour): red for variant 215G2; purple (wine red) for variant 101A10 and green for variant 111C8. For the amino acids identified at as being responsible for the increased activity, the side-chains are highlighted in yellow in the co-crystallized substrate analog. Other mutations for identified variants with no improved activity are marked in blue. It is noted that blue mutations are spread about half-half (i.e. 50:50) over the 2 domains of the enzyme, whereas the beneficial AacSHC mutations which were identified are located mostly (apart from one) in domain 2. The only exception is the mutation F601Y which is in the vicinity of the active site. FIG. 20 WO2016/170099 and FIG. 1 of Eichhorn eta/Adv.Synth.Catal (2018) 360:2339-2351 show the following mutations (in black and white): mutations having no beneficial effect on SHC/HAC activity are shown in black, they are spread over the 2 domains of the SHC enzyme. In grey are shown the mutations identified in SHC variants (101A10, 111C8 and 215G2) showing improved SHC/HAC activity, they are located with only one exception in domain 2 of the SHC enzyme. The side chain of the mutations contributing to the improved activity of the variants are highlighted, This improvement disclosed herein can be attributed to an increase in total turnover number (total number of reactions that one enzyme molecule can catalyse) when particular mutations are introduced in WT or SHC variants. This increased total turnover number may be the result of an increased catalytic potential or an increased stability of the resulting SHC enzyme variant, or a combination of the two. An increased stability may be the result of the optimal reaction conditions for the SHC variant with, for example, significantly lower temperature and SDS concentration.

    [0928] Throughout this specification and the claims which follow, unless the context requires otherwise, the word comprise, and variations such as comprises and comprising, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. The term comprising also means including as well as consisting e.g. a composition comprising X may consist exclusively of X or may include something additional e.g. X+Y. It must be noted also that, as used in this specification and the appended claims, the singular forms a, an and the include plural referents unless the content clearly dictates otherwise. By way of example, a reference to a gene or an enzyme is a reference to one or more genes or one or more enzymes.

    [0929] In this document and in its claims, the verb to comprise and its conjugations is used in its non-limiting sense to mean that items following the word are included, but items not specifically mentioned are not excluded. In addition, the verb to consist may be replaced by to consist essentially of meaning that a composition as described herein may comprise additional component(s) than the ones specifically identified, said additional component(s) not altering the unique characteristics of the invention. In addition, the verb to consist may be replaced by to consist essentially of meaning that a method or use as described herein may comprise additional step(s) than the ones specifically identified, said additional step(s) not altering the unique characteristic of the invention. In addition, the verb to consist may be replaced by to consist essentially of meaning that a nucleotide or amino acid sequence as described herein may comprise additional nucleotides or amino acids than the ones specifically identified, said additional nucleotides or amino acids not altering the unique characteristics of the invention.

    [0930] As used herein, with at least a particular value means that particular value or more. For example, at least 2 is understood to be the same as 2 or more i.e., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, . . . , etc.

    [0931] The word about or approximately when used in association with a numerical value (e.g. about 10) preferably means that the value may be the given value (of 10) more or less 1% of the value.

    [0932] As used herein, the term and/or is understood to mean that all members of a group connected by the term and/or are represented both cumulatively with respect to each other in any combination, and alternatively with respect to each other. Exemplarily, for the expression A, B and/or C, the following disclosure is to be understood thereunder: i) (A or B or C), or ii) (A and B), or iii) (A and C), or iv) (B and C), or v) (A and B and C), or vi) (A and B or C), or vii) (A or B and C), or viii) (A and C or B).

    [0933] As used herein, the term substantially free of is understood to mean that a compound or composition is largely free of other components but is not guaranteed to be 100% pure as trace amounts of other not deliberately added components may be present. The term allows for the presence of other components provided that they do not affect the basic characteristics of a claimed compound or composition.

    [0934] Various embodiments are described herein. Each embodiment as identified herein may be combined together unless otherwise indicated. It is to be understood that this disclosure is not limited to the particular methodology, protocols and reagents described herein as these may vary.

    [0935] It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present disclosure which will be limited only by the appended claims. Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by the person skilled in the art. In accordance with the present disclosure there may be conventional molecular biology, microbiology, and recombinant DNA techniques employed which are within the skill of the art.

    [0936] This disclosure is not limited in its application to the details of construction and the arrangement of components set forth in the following description or illustrated in the drawings. The disclosure is capable of other embodiments and of being practiced or of being carried out in various ways.

    [0937] Also, the phraseology and terminology used herein is for the purpose of description and should not be regarded as limiting. Preferably, the terms used herein are defined as described in A multilingual glossary of biotechnological terms: (IUPAC Recommendations), Leuenberger, H. G. W, Nagel, B. and Kolbl, H. eds. (1995), Helvetica Chimica Acta, CH-4010 Basel, Switzerland).

    [0938] Several documents are cited throughout the text of this specification. Each of the documents cited herein (including all patents, patent applications, scientific publications, manufacturer's specifications, instructions, GenBank Accession Number sequence submissions etc.), whether supra or infra, is hereby incorporated by reference in its entirety.

    [0939] Stocks of materials for use in bioconversion reactions (125 g/l substrate or higher) were prepared either in g/l (for example a biocatalyst suspension) or w/w % (for example SDS) concentrations. Bioconversion reactions were set up by adding by weight the required amounts of individual components (for example stocks of substrate, biocatalyst suspension, SDS solution, reaction buffer) as described in, for example Example 4. For this reason, the actual volume of the reaction mixture is expressed in mass units and not in volume units (see for example Example 4). Because the substrate used is an oil (density <1), a total reaction mass of e.g. 150 g (as for example in Example 4) does not translate into a reaction volume of 150 ml. Nonetheless the concentrations of the individual components in the bioconversion reaction mixtures are indicated in mass per volume (for example g/l or (w/v) %) and thus do not take into account that a total reaction mass of e.g. 150 g (as for example in. Example 4) does not correspond exactly to a reaction volume of 150 ml (as for example in Example 4).

    [0940] For the avoidance of doubt, all reference to EEH in the Examples, the Figures and the legends to the Figures is a reference to the EE isomer of homofarnesol. The EEH used is taken from a homofarnesol stock comprising an EE:EZ isomer mixture in a weight ratio of 80:20.

    [0941] The examples described herein are illustrative of the present disclosure and are not intended to be limitations thereon. Different embodiments of the present disclosure have been described according to the present disclosure. Many modifications and variations may be made to the techniques described and illustrated herein without departing from the spirit and scope of the disclosure. Accordingly, it should be understood that the examples are illustrative only and are not limiting upon the scope of the disclosure.

    [0942] The following numbered paragraphs define further aspects of the present disclosure.

    [0943] Paragraph 28: A process for preparing ()-Ambrox or a mixture comprising ()-Ambrox, the process comprising enzymatically converting (3E,7E)-homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to ()-Ambrox or a mixture comprising ()-Ambrox using a SHC/HAC enzyme variant, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0%, Identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309, or 310 and wherein the SHC/HAC enzyme variant amino acid sequence has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, or 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme corresponding to W169, A306 and/or G600 of SEQ ID NO: 1, 2, or 3 wherein the W at position 169 or corresponding to position 169 of SEQ ID NO: 1, 2 or 3 is replaced by G; wherein the A at position 306 or corresponding to position 306 of SEQ ID NO: 1, 2 or 3 is replaced by V; and/or wherein the G at position 600 or corresponding to 600 of SEQ ID NO: 1, 2 or 3 is replaced by M.

    [0944] Sequence identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% or 100% identity or similarity to the polypeptide identified.

    [0945] Paragraph 29: A process for preparing Ambra oxide or a mixture comprising Ambra oxide, the process comprising enzymatically converting (2,E)-Bishomofarnesol (BisEEH) or a mixture of isomers of bishomofarnesol comprising BisEEH to Ambra oxide or a mixture comprising Ambra oxide using a SHC/HAC enzyme variant, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0% identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290, 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 and wherein the SHC/HAC enzyme variant amino acid sequence has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290. 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, or 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme corresponding to W169, A306 and/or G600 of SEQ ID NO:1, 2, or 3 wherein the W at position 169 or corresponding to position 169 of SEQ ID NO: 1, 2 or 3 is replaced by G; wherein the A at position 306 or corresponding to position 306 of SEQ ID NO: 1, 2 or 3 is replaced by V; and/or wherein the G at position 600 or corresponding to position 600 of SEQ ID NO: 1, 2 or 3 is replaced by M.

    [0946] Sequence identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% or 100% identity or similarity to the polypeptide identified.

    [0947] Paragraph 30:A process according to paragraph 28 or 29, wherein: [0948] the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, A or V or a functional equivalent thereof, preferably wherein the W at position 169 is replaced by G, and/or [0949] the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V or a functional equivalent thereof and/or [0950] the G at position 600 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by A, V, L, I or M or a functional equivalent thereof.

    [0951] In an embodiment, the process according to paragraph 30, is such that: [0952] the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G or a functional equivalent thereof, and/or [0953] the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V or a functional equivalent thereof and/or [0954] the G at position 600 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by A, V, L, I or M or a functional equivalent thereof.

    [0955] In an embodiment, the process according to paragraph 30 is such that: [0956] the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, A or V or a functional equivalent thereof, preferably wherein the W at position 169 is replaced by G, and/or [0957] the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V or a functional equivalent thereof and/or [0958] the G at position 600 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V, L, I or M or a functional equivalent thereof.

    [0959] In an embodiment, the process according to paragraph 30 is such that: [0960] the W at position 169 of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G or a functional equivalent thereof and/or [0961] the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V or a functional equivalent thereof and/or [0962] the G at position 600 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V, L, I or M or a functional equivalent thereof.

    [0963] Paragraph 31:A process according to any one of the preceding paragraphs, wherein the amino acid at position 168 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290. 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 is S or the amino acid at a position in an amino acid sequence of a wild type SHC corresponding to 168 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290. 291, 292, 293, 294, 295, 296, 307, 308, 309 or 310 is S.

    [0964] Paragraph 32: A process according to any one of the preceding paragraphs, wherein [0965] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 1, 4, 5, 6 or 350 and has at least one of the following mutations: W169G, A306V and G600M or [0966] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 7, 8, 9 or 386 and has the following mutations: M132R, A224V, 1432T, A557T, R613S, and has at least one of the following mutations: W169G, A306V and G600Mor [0967] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 10, 11, 12 or 385 and has the following mutations: M132R, A224V, 1432T and has at least one of the following mutations: W169G, A306V and G600M.

    [0968] Sequence identity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to the polypeptide identified.

    [0969] Paragraph 33: A process according to any one of the preceding paragraphs, wherein [0970] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 23, 304, 359 or 360 and has at least one of the following mutations: W172G, A311V and G609M (Tel SHC/HAC variant) or [0971] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 32, 311, 357, or 358 and has the following mutations: W196G, A335V and G629M (Sco SHC/HAC variant) or [0972] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO:13, 312, 353 or 354 and has at least one of the following mutations: W222G, A368V and G667M (Zmo SHC1 variant) or [0973] the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0% identity to SEQ ID NO: 15, 313, 355 or 356 and has at least one of the following mutations: W177G, A321V and G619M (Zmo SHC2 variant).

    [0974] Sequence identity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to the polypeptide identified.

    [0975] Paragraph 34: A process according to any one of the preceding paragraphs, wherein the SHC/AHC enzyme variant has an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10, 11, 12, 305, 306, 304, 302, 311, 312, 313, 353, 354, 355, 356, 357, 358, 359, 360, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 350, 351 or 352.

    [0976] Paragraph 35: A process according to any one of the preceding paragraphs, wherein, the SHC/HAC enzyme variant disclosed herein exhibits: [0977] an increased substrate specificity for EEH (or for BisEEH) when homofarnesol or bis-homofarnesol substrates are used, [0978] an increased product selectivity for ()-Ambrox (or Ambra oxide) when homofarnesol or bis-homofarnesol substrates are used, [0979] an increased specificity for a particular isomer of substrates when substrates other than homofarnesol or bis-homofarnesol are used (eg ethyl-homofarnesol, hydroxyfarnesylacetone and the likesee, for example WO2021/110858 and WO2021/209482 respectively) [0980] an increased productivity and/or [0981] an increased degree of conversion of EEH (or BisEEH) as well as an increased conversion rate of EEH (or BisEEH) over the first 3 to 6 hours (or over the first 4, 5, or 6 hours) of the reaction, compared to the reference SHC enzyme (e.g. wild-type SHC such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290. 291, 292, 293, 294, 295, 296, 307, 308, 309, 310 or 215G2 AacSHC or SHC #65 or a parent SHC enzyme the variant derives from such as those represented by SEQ ID NO:2, 3, 47-48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383.

    [0982] Paragraph 36: A SHC/HAC enzyme variant as defined in any one of the preceding paragraphs, preferably wherein the variant comprises: a G at position 169 or corresponding to position 169 of SEQ ID NO: 1, 2 or 3; [0983] a G at position 169 or corresponding to position 169 of SEQ ID NO: 1, 2 or 3 and a V at position 306 or corresponding to position 306 of SEQ ID NO: 1, 2 or 3; or [0984] a G at position 169 or corresponding to position 169 of SEQ ID NO: 1, 2 or 3 and an M at position 600 or corresponding to position 306 of SEQ ID NO: 1, 2 or 3; or [0985] a G at position 169 or corresponding to position 169 of SEQ ID NO: 1, 2 or 3 and a V at position 306 or corresponding to position 306 of SEQ ID NO: 1, 2 or 3 and an M at position 600 or corresponding to position 600 of SEQ ID NO: 1, 2 or 3, [0986] And/or wherein the G at position 600 or corresponding to 600 of SEQ ID NO: 1, 2 or 3 is replaced by M.

    [0987] Paragraph 37: A process according to any one of the preceding paragraphs except paragraph 36, wherein the enzymatic conversion takes place at a temperature in the range of about 30 C. to about 50 C., for example from about 40 to about 50 C., and/or at a pH in the range of about 5 to about 6.

    [0988] Paragraph 38: A process according to any one of the preceding paragraphs except paragraph 36, wherein the process comprises culturing a recombinant host cell that produces the SHC/HAC enzyme variant.

    [0989] Paragraph 39: A process according to paragraph 38, wherein the recombinant host cells comprise a nucleic acid sequence selected from SEQ ID NO: 38, 39, 40, 41, 42, 43, 44, 45 and/or 46.

    [0990] Paragraph 40:A process according to any one of the preceding paragraphs except paragraph 36, wherein the mixture of isomers of homofarnesol comprising EEH is an EE:EZ isomer mixture, preferably wherein the EE:EZ isomer mixture is in a weight ratio of 80:20.

    [0991] Paragraph 41: A process according to any one of the preceding paragraphs except paragraph 36, wherein the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture in a weight ratio of 80:20 is about 2:1, 1:1 or about 0.5:1 or about 0.1:1.

    [0992] Paragraph 42: ()-Ambrox obtained by or obtainable by the process of any preceding paragraphs except paragraph 36, in a solid form in an amorphous or crystalline form.

    [0993] Paragraph 43: Use of ()-Ambrox of claim 15 as part of a fragrance or a cosmetic or a consumer product such as fabric care, toiletry, beauty care, a cleaning product, a detergent product, and/or a soap product.

    [0994] Paragraph 44: A fragrance or a cosmetic or a consumer product comprising ()-Ambrox of paragraph 42.

    [0995] Paragraph 45: A nucleic acid sequence encoding the SHC/HAC enzyme variant of paragraph 36.

    [0996] Paragraph 46: A construct comprising the nucleic acid sequence of paragraph 45.

    [0997] Paragraph 47: A recombinant host cell comprising the nucleic acid sequence of paragraph 45 or the construct of paragraph 46.

    [0998] Paragraph 48: A process for preparing ()-Ambrox or a mixture comprising ()-Ambrox according to any one of paragraphs 28, 29 or 31, the process comprising enzymatically converting (3E,7E)-homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to ()-Ambrox or a mixture comprising ()-Ambrox using a SHC/HAC enzyme variant, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0%, identity or similarity to SEQ ID NO: 1-12, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47-54, 55-296, 301-313, 315-353, 354-383 wherein the W at position 169 or corresponding to position 169 of SEQ ID NO: 1, is replaced by G; wherein the A at position 306 or corresponding to position 306 of SEQ ID NO: 1, 2 or 3 is replaced by V; and/or wherein the G at position 600 or corresponding to 600 of SEQ ID NO: 1, 2 or 3 is replaced by M.

    [0999] Sequence identity or similarity may be at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.

    [1000] The process according to any one of the preceding paragraphs, wherein the process is carried out on an industrial scale, preferably where the bioconversion volume is at least about 100L, more preferably in the range of about 1000L to about 3000L, even more preferably about 10,000L, even more preferably about 100,000L, or even about 250,000L.

    [1001] The following numbered paragraphs define further aspects of the present disclosure.

    [1002] Paragraph 49: A protein with the enzymatic activity of a Squalene-hopene-cyclase (SHC) comprising [1003] a) a mutated amino acid sequence relative to the wild type SHC of Alicyclobacillus acidocaldarius (wild type AacSHC) of SEQ ID No. 1, wherein the W at position 169 of SEQ ID No. 1 is replaced by amino acid G, or a functional equivalent of the mutated amino acid sequence, wherein the functional equivalent of the mutated amino acid sequence has an amino acid sequence identity from 38.0 to 99.9% to the amino acid sequence of the mutated amino acid sequence or [1004] b) a mutated amino acid sequence relative to a wild type SHC (WT-SHC), wherein the W at a position in the amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by amino acid G, or a functional equivalent of the mutated amino acid sequence, wherein the functional equivalent of the mutated amino acid sequence has an amino acid sequence identity from 38.0 to 99.9% to the amino acid sequence of the mutated amino acid sequence.

    [1005] Sequence identity may be of at least 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, 99.9% or 100% identity to the polypeptide identified.

    [1006] Paragraph 50: The protein of paragraph 49, wherein the mutated amino acid sequence relative to the wild type AacSHC of SEQ ID No. 1 is the amino acid sequence of SEQ ID Nos 315.

    [1007] Paragraph 51: The protein of paragraph 49, wherein the WT-SHC is selected from the group consisting of WT-SHC of Acetobacter pasteurianus (ApaSHC1, SEQ ID No. 24), Burkholderia ambifaria (BamSHC1, SEQ ID No. 28, BamSHC2, SEQ ID No. 29), Bradyrhizobium japonicum (BjaSHC or BjpSHC SEQ ID No. 119), Pelobacter carbinolicus or Syntrophotalea carbinolica DSM 2380 (PcaSHC2, SEQ ID No. 30), Rhodopseudomonas palustris (RpaSHC1, SEQ ID No. 31), Streptomyces coelicolor (ScoSHC, SEQ ID No. 32), Syntrophobacter fumaroxidans (SfuSHC1, SEQ ID No. 33), Teredinibacter turnerae (TtuSHC, SEQ ID No. 34), Zymomonas mobilis (ZmoSHC1, SEQ ID No. 13 or 14, ZmoSHC2, SEQ ID No. 15) and Thermosynechococcus elongatus (TeISHC, SEQ ID No. 23).

    [1008] Paragraph 52: The protein of paragraph 49 or 51, wherein the mutated amino acid sequence relative to a WT-SHC of SEQ ID Nos 13, 14, 15, 23-24, 28, 29, 30, 31, 32, 33, 34 is the amino acid sequence of SEQ ID Nos 302, 303, 304.

    [1009] Paragraph 53: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No. 1 is replaced by G (SEQ ID No. 315, 318, 319, 320, 321,322, 333, 334, 335 336, 337, 350, 305) or b) wherein the W at position 172 in the amino acid sequence of the wild type TeISHC (SEQ ID No. 23) corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G (SEQ ID No. 302, 304).

    [1010] Paragraph 54: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the G at position 600 of the wild type AacSHC of SEQ ID No. 1 is replaced by amino acid selected from the group consisting of A, V, L, I and M (SEQ ID Nos 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 305) or b) wherein the amino acid, in particular G, at a position in the amino acid sequence of the WT-SHC corresponding to G600 in the wild type AacSHC of SEQ ID No. 1 is replaced by amino acid selected from the group consisting of A, V, L, I and M.

    [1011] Paragraph 55 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the A at position 306 of the wild type AacSHC of SEQ ID No. 1 is replaced by V (SEQ ID Nos 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346,347, 350, 351, 352) or b) wherein the amino acid, in particular P or C, at a position in the amino acid sequence of the WT-SHC corresponding to A306 in the wild type AacSHC of SEQ ID No. 1 is replaced by V.

    [1012] Paragraph 56: the protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No. 1 is replaced by G (SEQ ID No. 315, 318, 319, 320, 321,322, 333, 334, 335, 336,337, 350, 305) or b) wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G and the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No. 1 is replaced by S.

    [1013] Paragraph 57: The protein of one of the preceding paragraphs comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No. 1 is replaced by Y.

    [1014] Paragraph 58: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No. 1 is replaced by S and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No. 1 is replaced by Y.

    [1015] Paragraph 59: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No. 1 is replaced by G (SEQ ID No. 315, 318, 319, 320, 321,322, 333, 334, 335 336, 337, 350, 305) (or b), wherein the W at the position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G and the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No. 1 is replaced by S.

    [1016] Paragraph 60: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G (SEQ ID No. 315, 318, 319, 320, 321,322, 333, 334, 335 336, 337, 350, 305) and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No. 1 is replaced by Y.

    [1017] Paragraph 61: The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G (SEQ ID No. 315, 318, 319, 320, 321,322, 333, 334, 335 336, 337, 350, 305) amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No. 1 is replaced by S and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No. 1 is replaced by Y.

    [1018] Paragraph 62: A nucleic acid sequence, which encodes a protein of one of the preceding paragraphs s, in particular as identified in SEQ ID No. 349.

    [1019] Paragraph 63: An expression cassette, comprising the nucleic acid sequence of paragraph 62.

    [1020] Paragraph 64. A vector, comprising the nucleic acid sequence of paragraph 62 or the expression cassette of claim 63.

    [1021] Paragraph 65. A host cell, comprising the vector of paragraph 64 or the expression cassette of paragraph 63 or the nucleic acid sequence of paragraph 62.

    [1022] Paragraph 66: A process for preparing a biocatalyst with the enzymatic activity of a SHC, comprising the following steps: [1023] a) providing the host cell of paragraph 65, comprising a nucleic acid sequence encoding a protein according to any one of paragraphs 49 to 61, [1024] b) cultivating the host cell of step a) in a culture medium under conditions, which allow the expression of the protein and [1025] c) obtaining the biocatalyst, in particular the expressed protein or a host cell comprising the expressed protein.

    [1026] Paragraph 67. A biocatalyst, in particular prepared according to the process of paragraph 66, wherein the biocatalyst is the protein according to any one of paragraph 49 to 61, a host cell comprising the protein according to any one of paragraph 49 to 61, a host cell lysate, freeze dried host cell, host cell extract or host cell fraction comprising the protein according to any one of paragraph 49 to 61.

    [1027] Paragraph 68. A process for preparing a composition comprising ()-Ambrox, comprising the following steps: [1028] x) providing homofarnesol, a reaction medium and the biocatalyst of paragraph 67, [1029] y) mixing the provided homofarnesol with the reaction medium and the biocatalyst of paragraph 19 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to ()-Ambrox and [1030] z) obtaining a composition comprising ()-Ambrox.

    [1031] Paragraph 69. A process for preparing an aroma for human or animal use comprising the following steps: [1032] i) performing a process according to paragraph 68, [1033] j) admixing the composition comprising ()-Ambrox obtained in step i) and at least one further component and [1034] l) obtaining an aroma for human or animal use comprising the composition and at least one further component.

    [1035] Paragraph 70. A biocatalyst comprising up to two or two or more SHC active site mutations and/or up to two or two or more site mutations other than SHC active site mutations wherein the active site mutations are selected from the active site amino acid positions (based on AacSHC) listed in Table 10 comprising active site positions 36, 168, 169, 261, 306, 307, 312, 365, 366, 420, 489, 600, 607, 609, and/or 612, preferably 169, 261, 312, 365, 489, 600, 609 and/or 612 and wherein the mutations other than active site mutations are selected from the site mutations listed in Table 7 and/or Table 8 and/or Table 9 and/or Table 18 disclosed herein, preferably comprising M132R and/or 1432T or functional equivalents, thereof wherein the biocatalyst is a protein, a host cell comprising the protein, a host cell lysate, freeze dried host cell, host cell extract or host cell fraction comprising the protein. By way of example, FIG. 19 of WO2016/170099 shows the location of the non-active site mutations identified in SHC/HAC variants 101A10, 111C8 and 215G2 (comprising M132R, 1432T and A224V) on the SHC Crystal Structure. A CAVER analysis of the AacSHC crystal structure can be performed to identify useful active site mutations and site mutations other than active site mutations useful for the preparation of a product of interest using an SHC variant comprising such beneficial active site mutations and site mutations other than active site mutations as described herein.

    [1036] Paragraph 71. A process for preparing a composition comprising ()-Ambrox or a mixture comprising ()-Ambrox, comprising the following steps: [1037] x) providing homofarnesol, a reaction medium and the biocatalyst of paragraph 70, [1038] y) mixing the provided homofarnesol with the reaction medium and the biocatalyst of paragraph 22 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to ()-Ambrox and [1039] z) obtaining a composition comprising ()-Ambrox.

    [1040] Paragraph 72. A process for preparing a composition comprising ()-Ambrox or a mixture comprising ()-Ambrox, comprising the following steps: [1041] x) providing homofarnesol, a reaction medium and a biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 [1042] y) mixing the provided homofarnesol with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to ()-Ambrox and [1043] z) obtaining a composition comprising ()-Ambrox.

    [1044] Paragraph 73. A process for preparing a composition comprising Amberketal, or a mixture comprising Amberketal comprising the following steps: [1045] x) providing hydroxyfarnesylacetone, a reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 [1046] y) mixing the provided hydroxyfarnesylacetone with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 and reacting the hydroxyfarnesylacetone with the biocatalyst under reaction conditions so as to convert the hydroxyfarnesylacetone to ()-Amberketal and [1047] z) obtaining a composition comprising Amberketal.

    [1048] Paragraph 74. A process for preparing a composition comprising Ambra oxide or a mixture comprising Ambra oxide comprising the following steps: [1049] x) providing (2-E)-Bishomofarnesol (BisEEH), a reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 [1050] y) mixing the provided BisEEH with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 and reacting the BisEEH with the biocatalyst under reaction conditions so as to convert the BisEEH to Ambra oxide and [1051] z) obtaining a composition comprising Ambra oxide.

    [1052] Paragraph 75: A process for preparing ()-Ambrox or a mixture comprising ()-Ambrox, wherein (3E,7E)-homofarnesol (EEH) or a mixture of stereoisomers comprising EEH is enzymatically converted to ()-Ambrox or a mixture comprising ()-Ambrox wherein the enzymatic conversion is carried out using an SHC/HAC enzyme under reaction conditions suitable for the production of ()-Ambrox and wherein the mixture of stereoisomers comprising EEH consists essentially of homofarnesol isomers selected from one or more of the following groups consisting of [(3E,7E) and [(3Z,7E)] and/or [(3E,7E) and (3E,7Z)] and/or [(3Z,7E), (3E,7E) and (3E,7Z)] also designated as [EE:EZ], [EE:ZE] and [EE:EZ:ZE] respectively and wherein the SHC/HAC enzyme polypeptide sequence is selected from the group consisting of a SHC enzyme or SHC enzyme variant selected from Table 2, Table 3, Table 7, Table 8, Table 9, Table 16, or Table 18 and/or a sequence with a least 30%, at least 40% identity, at least 50% identity, or at least 60% identity, or at least 70% identity, or at least 80% identity, or at least 90% identity, or at least 95% identity, or at least 96% identity, or at least 97% identity, or at least 98% identity, or at least 99% identity to an SHC amino acid sequence or SHC variant amino acid sequence as selected from Table 2, Table 3, Table 7, Table 8, Table 9, Table 16, or Table 18.

    EXAMPLES

    Example 1

    Biocatalyst Production

    [1053] For squalene hopene cyclase enzyme production in Escherichia coli the gene coding for the desired wild-type or variant SHC enzyme was inserted into plasmid pET-28a(+) (commercially available (for example from Merck Millipore) and as disclosed in SEQ ID NO:179 of FIG. 21 of WO 2016/170099), where it is under the control of an IPTG inducible T7 promotor. The plasmid was transformed into E. coli strain BL21(DE3) (commercially available) using a standard heat-shock transformation procedure.

    Cultivation Medium

    [1054] The minimal medium used for biocatalyst production contained: [1055] 10% 10 citric acid/phosphate buffer (133 g/l KH.sub.2PO.sub.4; 40 g/l (NH.sub.4).sub.2HPO.sub.4, 17 g/l citric acid. H.sub.2O in deionized water, with pH adjusted to 6.8 using 32% NaOH), [1056] 2.43% MgSO.sub.4 solution (50% w/v MgSO.sub.4.Math.7H.sub.2O in deionized water), [1057] 0.01% trace elements solution (50 g/l Na.sub.2EDTA.Math.2H.sub.2O, 20 g/l FeSO.sub.4.Math.7H.sub.2O, 3 g/l H.sub.3BO.sub.3, 0.9 g/l MnSO.sub.4.Math.2H.sub.2O, 1.1 g/l CoCl.sub.2, 80 g/l CuCl.sub.2, 240 g/l NiSO.sub.4.Math.7H.sub.2O, 100 g/l KI, 1.4 g/l (NH.sub.4).sub.6Mo.sub.7O.sub.24.Math.4H.sub.2O, 1 g/l ZnSO.sub.4.Math.7H.sub.2O in deionized water), [1058] 0.01% Thiamin solution (2.25 g/l Thiamin.Math.HCl in deionized water), [1059] 2% glucose solution (20% w/v glucose in deionized water).

    [1060] The citric acid/phosphate buffer was first sterilized by autoclaving, the other ingredients added afterwards from sterile solutions sterilized either by autoclaving or filter-sterilization (0.2 m).

    Fermentation

    [1061] Fermentations were run in 750 ml InforsHT reactors. To the fermentation vessel was added 168 ml deionized water. The reaction vessel was equipped with all required probes (pO.sub.2, pH, sampling, antifoam), C+N feed and sodium hydroxide bottles and autoclaved. After autoclaving was added: [1062] 20 ml 10 phosphate/citric acid buffer [1063] 14 ml 50% glucose [1064] 0.53 ml MgSO.sub.4 solution [1065] 2 ml (NH.sub.4).sub.2SO.sub.4 solution (50% (w/v) (NH.sub.4).sub.2SO.sub.4 in deionized water) [1066] 0.020 ml trace elements solution [1067] 0.400 ml thiamine solution [1068] 0.200 ml kanamycin solution (50 mg/ml)

    [1069] The running parameters were as follows: pH=6.95, pO.sub.2=40%, T=30 C., 300 rpm. Cascade: rpm 300, min 300, max 1000, flow (1/min) 0.1, min 0, max 0.6. Antifoam control: 1:9.

    [1070] A seed culture was grown in LB medium (+Kanamycin) at 37 C., 220 rpm for 8 h. The fermenter was inoculated to an OD.sub.650 nm of 0.4-0.5 from this seed culture. The fermentation was run first in batch mode for 11.5 h, where after was started the C+N feed with a feed solution (sterilized glucose solution (143 ml H.sub.2O+35 g glucose) to which had been added after sterilization: 17.5 ml (NH.sub.4).sub.2SO.sub.4 solution, 1.8 ml MgSO.sub.4 solution, 0.018 ml trace elements solution, 0.360 ml Thiamine solution, 0.180 ml kanamycin solution. The feed was run at a constant flow rate of approx. 4.2 ml/h. Glucose and NH.sub.4.sup.+ measurements were done externally to evaluate availability of the C- and N-sources in the culture. Usually glucose levels stay very low.

    [1071] Cultures were grown for a total of approx. 25 hours, where they reached typically and OD.sub.650 nm of 40-45. SHC production was then induced by the addition of IPTG to a concentration of 1 mM to the fermenter, and lasted for approx. 16 h at 30 C. and pO.sub.2=20%. At the end of induction, the cells were collected by centrifugation, washed with citric acid/sodium phosphate buffer pH 5.6 and stored as pellets at 4 C. or 20 C. until further use.

    Example 2

    Setting Optimized Reaction Conditions for SHC Variants

    [1072] The reaction conditions for the SHC variants were individually optimized with regard to temperature, pH and SDS concentration. Biocatalysts were prepared by fermentation as described in Example 1 and used is whole cell reactions. The Homofarnesol feedstock used was of EEH:EZH ratio 80:20.

    [1073] Reactions of 2-4 ml volume containing 4, 8 or 16 g/l E,E-Homofarnesol and cells loaded at an OD.sub.650 nm of 10 were run in 0.1 M citric acid/sodium phosphate, or 0.1 M acetic acid/sodium acetate, or 0.1 M succinic acid/NaOH buffer pH 5.2-7.0, in presence of SDS at concentrations ranging from 0.005 to 0.095% at temperatures ranging from 25 to 55 C., at pH ranging from 5.2 to 6.6, and under constant agitation (Heidolph synthesis 1 Liquid 16 or 24 (800 rpm), or Radleys Carousel 12 Plus/Monoblock 16 (200 rpm)).

    [1074] We discovered that AacSHC variants having several mutations exhibit an improved substrate specificity for EEH and/or a product selectivity for ()-Ambrox which result in an improved EEH conversion rate. These mutations are: [1075] Mutation W169G is introduced in P1 variants [1076] Mutations W169G and G600M are introduced in P2 variants [1077] Mutations W169G, A306V and G600M are introduced in P3 variants [1078] (these positions correspond to positions in SEQ ID NO:1)

    [1079] The mutations of the P1, P2 or P3 variants had been introduced in: [1080] The wild type Aac SHC being represented by SEQ ID NO:1 leading to: [1081] AaC SHC P1 variant represented by SEQ ID NO: 4, [1082] AaC SHC P2 variant represented by SEQ ID NO: 5, [1083] AaC SHC P3 variant represented by SEQ ID NO: 6, [1084] The SHC #65 variant being represented by SEQ ID NO:2 leading to: [1085] SHC #65 P1 variant represented by SEQ ID NO: 7, [1086] SHC #65 P2 variant represented by SEQ ID NO: 8, [1087] SHC #65 P3 variant represented by SEQ ID NO: 9, [1088] The 215G2 SHC variant being represented by SEQ ID NO:3 leading to: [1089] 215G2 SHC P1 variant represented by SEQ ID NO: 10, [1090] 215G2 SHC P2 variant represented by SEQ ID NO: 11, [1091] 215G2 SHC P3 variant represented by SEQ ID NO: 12,

    [1092] Introducing mutations of the P1, P2, and P3 variants had a significant influence on enzymatic activity depending on the SHC variant considered. It can be assumed that the same effect may be expected for the other SHC variants as listed in Table 7 and/or Table 8. Reaction conditions defined as optimized were confirmed/adjusted (pH) in 0.1 M succinic acid/NaOH buffer, the buffer used in EEH bioconversion at high substrate concentration.

    [1093] The results (Table 15) indicated the importance of setting properly reaction conditions to individual optima for a careful evaluation of the relative performance in E,E-Homofarnesol conversion of the SHC variants.

    TABLE-US-00015 TABLE 15 Optimized reaction conditions for SHC variants. Useful ranges and optimal values. Temperature [SDS] SHC enzyme ( C.) pH .sup.1 (w/v %) .sup.2 AacSHC .sup.3 55 6.0 0.035 AacSHC P1 40-45/45 6.0-6.4/6.2 0.005-0.050/0.035 AacSHC P2 40-50/45 5.6-5.8/5.6 0.020-0.050/0.035 AacSHC P3 45-50/50 5.8-6.6/6.4 0.005-0.030/0.020 215G2SHC .sup.3 35 5.4 0.060 215G2SHC P1 35-40/35 6.2-6.6/6.4 0.020 215G2SHC P2 30-35/35 5.8-6.0/6.0 0.020 215G2SHC P3 35-40/40 6.0-6.6/6.4 0.035 SHC#65 .sup.4 45 5.6 0.050 SHC#65 P2 40-45/40 5.4-6.4/5.6 0.030-0.040/0.030 SHC#65 P3 45-50/45 5.4-6.2/5.8 0.010-0.030/0.025 .sup.1 as determined in citric acid/sodium phosphate buffer, .sup.2 in reactions containing cells at an OD.sub.650 nm of 10, .sup.3 as published in WO2016/170099, .sup.4 as published in WO2021/110848.

    Example 3

    Relative Performance of SHC Variants in E,E-Homofarnesol Cyclization Reactions

    [1094] The influence of the mutations of P1, P2 and P3 variants on E,E-Homofarnesol conversion was investigated when introduced in wild type AacSHC and 215G2SHC background. Reactions were run in 4 ml volume with constant agitation (Heidolph Synthesis 1 Liquid 16, 800 rpm) applying individually optimized reaction conditions (T, pH, SDS). The Homofarnesol feedstock used was of EEH:EZH ratio 80:20.

    [1095] With P1, P2 and P3 variants of AacSHC was EEH conversion dramatically increased over that of the parent wild type enzyme (see FIG. 1). P1, P2, and P3 variants of 215G2SHC showed a significantly increased EEH conversion over 215G2SHC (see FIG. 1).

    Example 4

    [1096] Substrate specificity and product selectivity of P1, P2, and P3 SHC variants (homofarnesol) The influence of P1, P2 and P3 variants on substrate specificity and product selectivity was investigated when introduced in wild type AacSHC, 215G2SHC, and SHC #65. Reactions (4 ml volume), contained 8 g/l EEH and cells to an OD.sub.650 nm of 10, and were run with constant agitation (Heidolph Synthesis 1 Liquid 16, 800 rpm) applying individually optimized reaction conditions (T, pH, SDS). The Homofarnesol feedstock used was a mixture of isomers with an EEH:EZH ratio of 80:20.

    [1097] FIG. 2 shows the reaction products produced when Homofarnesol consisting of a mixture of EE and EZ isomers is cyclized with SHC as published in Eichhorn et al. Adv. Synth. Catal. (2018), 360, 2339-2351 and in WO2016/170099.

    [1098] The analysis of the reaction products distribution in Homofarnesol cyclization reaction catalysed by wild type AacSHC, 215G2SHC and SHC #65, and in the P1, P2 and P3 variants of these enzymes showed an increased substrate specificity and product selectivity of the P1, P2, and P3 variants.

    [1099] The parent enzymes converted both EEH and EZH to the products shown in FIG. 2.

    [1100] The following conclusions could be drawn from FIG. 3: With the P1 variant of AacSHC was observed as strong reduction in compounds 1l, Ill, and IV in the reaction product, which indicated an increased specificity for E,E-Homofarnesol, E,Z-Homofarnesol being less efficiently cyclized. The product selectivity for ()-Ambrox was increased as the main product of E,E-Homofarnesol cyclization was ()-Ambrox, the reaction product containing no or almost no compound IV. With P2 and P3 variants of AacSHC the substrate specificity was slightly lower as more compound Ill was produced from E,Z-Homofarnesol cyclization, the product specificity for ()-Ambrox remaining high, no or almost no compound IV being present in the reaction product. Overall, variant P1 showed highest substrate specificity, variants P2 and P3 showing increase E,Z-Homofarnesol conversion compared to variant P1.

    [1101] The P1, P2, and P3 variants of 215G2SHC showed also a significantly increased substrate selectivity towards E,E-Homofarnesol and product selectivity towards ()-Ambrox. As observed with the P1, P2, and P3 variants of AacSHC, 215G2 P2 and P3 showed lower substrate specificity compared to variant 215G2 SHC P1.

    [1102] Introducing the mutations for P1, P2, and P3 variants in SHC #65 strongly increased substrate specificity towards E,E-Homofarnesol and product selectivity towards ()-Ambrox, this selectivity remaining almost same within the three SHC #65 variants.

    Example 5

    Performance of P1, P2, and P3 AacSHC Variants in 125 g/l E,E-Homofarnesol Bioconversion

    [1103] Biocatalysts produced by fermentation of the E. coli strains transformed with the plasmid carrying the gene coding for the selected SHC enzyme were used in 125 g/l E,E-Homofarnesol bioconversions. The Homofarnesol stock used was of EEH:EZH ratio 80:20. The cell concentration of the cell suspensions used was determined by centrifuge an approx. 1 g aliquot of the cell suspension in a tabletop centrifuge (13'000 rpm), carefully discarding the supernatant, and weighing the mass of the cell pellet (triplicate). 25 ml reactions were run in Radleys Carousel Plus/Monoblock 16. They contained 125 g/l E,E-Homofarnesol, 250 g/l cells, and were run in 0.1 M succinic acid or citric acid/sodium phosphate buffer. Temperature, pH, and SDS concentration (SDS:cells ratio) were set according to the conditions defined individually as optimal for each variant. The pH of the reaction was regularly measured at an externally calibrated pH electrode and adjusted manually with appropriately diluted phosphoric acid as required.

    [1104] FIG. 4 demonstrate that the EEH conversion rate of the variants was markedly increased (from 50% to 90% depending on the variant) with compared to that of the parent wild type AacSHC enzyme (15%).

    Example 6

    Performance of 215G2 P2 and SHC #65 P2 Variants in 125 g/l E,E-Homofarnesol Bioconversion

    [1105] Biocatalysts produced by fermentation of the E. coli strains transformed with the plasmid carrying the gene coding for the selected SHC enzyme were used in 125 g/l E,E-Homofarnesol bioconversions. The Homofarnesol stock used was of EEH:EZH ratio 80:20. The cell concentration of the cell suspensions used was determined by centrifuge an approx. 1 g aliquot of the cell suspension in a tabletop centrifuge (13'000 rpm), carefully discarding the supernatant, and weighing the mass of the cell pellet (triplicate).

    [1106] 25 ml reactions were run in Radleys Carousel Plus/Monoblock 16. They contained 125 g/l E,E-Homofarnesol, 250 g/l cells, and were run in 0.1 M succinic acid or citric acid/sodium phosphate buffer under conditions defined as optimal regarding temperature, pH, and SDS concentration (SDS:cells ratio). The pH of the reaction was measured at an externally calibrated pH electrode and adjusted manually with appropriately diluted phosphoric acid as required.

    [1107] The introduction of P2 variant mutations into 215G2SHC dramatically improved EEH conversion: <90% conversion was obtained in 24 h instead of approx. 48 h with the parent 215G2SHC enzyme. Variants 215G2 P2 and SHC P2 performed as well as the SHC variant SHC #65 (see FIG. 5).

    Example 7

    Substrate Specificity and Product Selectivity of P1, P2, and P3 SHC Variants (Homofarnesol)

    [1108] Biocatalysts produced by fermentation of the E. coli strains transformed with the plasmid carrying the gene coding for the selected SHC enzyme were used in 125 g/l E,E-Homofarnesol bioconversions. The Homofarnesol stock used was of EEH:EZH ratio 80:20. 25 ml reactions were run in Radleys Carousel Plus/Monoblock 16. The cell concentration of the cell suspensions used was determined by centrifuge an approx. 1 g aliquot of the cell suspension in a tabletop centrifuge (13'000 rpm), carefully discarding the supernatant, and weighing the mass of the cell pellet (triplicate).

    [1109] The reactions contained 125 g/l E,E-Homofarnesol, 250 g/l cells, and were run under conditions defined as optimal regarding temperature, pH, and SDS concentration (SDS:Cells ratio) in 0.1 M succinic acid or citric acid/sodium phosphate buffer. The pH of the reaction was measured at an externally calibrated pH electrode and adjusted manually with appropriately diluted phosphoric acid as required.

    [1110] FIG. 6 shows the composition of the reaction product, E,E-Homofarnesol and E,Z-Homofarnesol conversion with each of the variants tested. Introducing the mutations for P1, P2, and P3 variants into 215G2SHC and SHC #65 strongly reduced the conversion of E,Z-Homofarnesol increasing hereby the substrate selectivity of the variant enzymes towards E,E-Homofarnesol. The mutations also strongly increased the product specificity of the enzyme variants: no or almost no compound IV was produced from E,E-Homofarnesol, and compound Ill being the only or almost only product of E,Z-Homofarnesol cyclization.

    Example 8

    Bioconversion at Increased E,E-Homofarnesol Concentration

    [1111] The Homofarnesol stock used was of EEH:EZH ratio 80:20. The cell concentration of the cell suspensions used was determined by centrifuge an approx. 1 g aliquot of the cell suspension in a tabletop centrifuge (13'000 rpm), carefully discarding the supernatant, and weighing the mass of the cell pellet (triplicate). 20 ml reactions were run in Radleys Carousel Plus/Monoblock 16 (constant agitation). They contained 250 g/l E,E-Homofarnesol, 250 g/l cells that had produced SHC variants SHC #65 or SHC #65 P2, and were run in 0.1 M succinic acid or citric acid/sodium phosphate buffer under conditions defined as optimal regarding temperature, pH, and SDS concentration (SDS:cells ratio). The pH of the reactions was measured at an externally calibrated pH electrode and adjusted manually with appropriately diluted phosphoric acid as required.

    [1112] Although approximately the same level of E,E-Homofarnesol conversion was achieved with both SHC #65 and SHC #65 P2 variants, the increased substrate selectivity of SHC #65 towards E,E-Homofarnesol allowed for a faster conversion compared to SHC #65.

    Example 9

    Reducing Cells:Substrate Ratio with SHC #65 and SHC #65 P2 SHC Variants

    [1113] The Homofarnesol stock used was of EEH:EZH ratio 80:20. The cell concentration of the cell suspensions used was determined by centrifuge an approx. 1 g aliquot of the cell suspension in a tabletop centrifuge (13'000 rpm), carefully discarding the supernatant, and weighing the mass of the cell pellet (triplicate).

    [1114] Reactions with SHC variant SHC #65 were run in 300 ml volume in a DASBox Fermenter (constant agitation), reactions with SHC #65 P2 SHC variant were run in 20 ml reactions in Radleys Carousel Plus/Monoblock 16 flasks (constant agitation). They contained either 250 g/l E,E-Homofarnesol and 150, 125, or 100 g/l cells that had produced SHC variants SHC #65 P2, or 300 g/l E,E-Homofarnesol and 300, 270 or 220 g/l cells that had produced SHC #65. The reactions were run in 0.1 M succinic acid (SHC #65) or citric acid/sodium phosphate (SHC #65 P2) buffer under conditions defined as optimal regarding temperature, pH, and SDS concentration (SDS:cells ratio). The pH of the reaction was measured at an externally calibrated pH electrode and adjusted manually with appropriately diluted phosphoric acid as required.

    [1115] The results (see FIG. 8) indicated that it was possible to convert approx. 1.4 g E,E-Homofarnesol per gram of cells producing SHC variant SHC #65. When using cells producing SHC #65 P2 SHC variant, this value was increased to approx. at least 2.2 g E,E-Homofarnesol per gram of cells. This can be attributed to the increased substrate selectivity of SHC #65 P2 towards E,E-Homofarnesol.

    [1116] In a second set of investigations, bioconversions were run as described above with 250 g/l EEH, and with cells that had produced SHC #65 P2 variant; the [cells]:[EEH] ratio was lowered further down to values of 0.3, 0.2, and 0.1. The reaction time was extended to approx. 200 h to possibly allow for reaching a plateau in E,E-Homofarnesol conversion. Approx. 98% EEH conversion was obtained with a [cells]:[EEH] ratio of 0.3, approx. 84% EEH conversion with a [cells]:[EEH] ratio of 0.2, and approx. 59% with a [cells]:[EEH] of 0.1. The plateau reached in the reaction with a [cells]:[EEH] ratio of 0.1 indicated the possibility of converting approx. 5.9 g of E,E-Homofarnesol per gram of cells under the reaction conditions applied. This represents 2.7-fold improvement over SHC #65.

    Example 10

    [1117] GC-FID analysis Samples were extracted with an appropriate volume of tert-butylmethyl ether (MBTE/tBME) for quantification of their content in substrate and reaction products. The solvent fraction was separated from the water phase by centrifugation prior to analysis with gas chromatography. 1 l of the solvent phase was injected (split ratio 10) onto a 30 m0.32 mm0.25 m Zebron ZB-5 column. The column was developed at constant flow (4 ml/min H.sub.2) with the temperature gradient: 100 C., 15 C./min to 200 C., 120 C./min to 240 C., 4 min at 240 C. Inlet temperature: 250 C., detector temperature: 250 C. This resulted in separation of EEH and EZH, and of the peaks corresponding to ()-Ambrox and the 3 other reaction products resulting from E,E- and E,Z-Homofarnesol cyclization.

    [1118] E,E-Homofarnesol and E,Z-Homofarnesol conversion were calculated from the areas of the peaks corresponding to the EEH or EZH cyclization products and EEH or EZH substrate peaks area with the following formulae:

    [00001] EEH conversion ( % ) = 100 ( Area EEH products / ( Area EEH products + Area EEH ) ) EZH conversion ( % ) = 100 ( Area EZH products / ( Area EZH products + Area EZH ) )

    Example 11

    Squalene Hopene Cyclase Amino Acid Sequence Alignment

    [1119] Source microorganisms and amino acid sequence accession numbers for squalene hopene cyclase enzymes are listed in Table 16.

    TABLE-US-00016 TABLE 16 Squalene hopene cyclase enzymes. Source microorganisms and amino acid sequence accessionnumbers. Accession number is Genbank when not otherwise mentioned. Abbrevia- Accessionnum- SEQ tion Source microorganism ber ID NO AacSHC Alicyclobacillus acidocaldarius ACV59449.1 1 ApaSHC1 Acetobacter pasteurianus ASC07046.1 24 BamSHC1 Burkholderia ambifaria AJY25620.1 28 BamSHC2 Burkholderia ambifaria ABI91648.1 29 BjaSHC Bradyrhizobium japonicum ABQ33590.1 16 (or BjpSHC) BmeSHC Bacillus megaterium ADF38987.1 25 GmoSHC Gluconobacter morbifer EHH69691.1 22 PcaSHC2 Pelobacter carbinolicus or ABA87615.1 30 Syntrophotalea carbinolica DSM 2380 PmeSHC Pseudomonas mendocina A0A0X1SYK9.sup.1 296 RpaSHC1 Rhodopseudomonas palustris ABJ08391.1 31 ScoSHC Streptomyces coelicolor CAB39697.1 32 SfuSHC1 Syntrophobacter fumaroxidans ABK17672.1 33 TelSHC Thermosynechococcus elongatus BAC09861.1 23 TtuSHC Teredinibacter turnerae ACR13362.1 34 ZmoSHC1 Zymomonas mobilis AVZ42714.1 13 ZmoSHC2 Zymomonas mobilis AHJ71916.1 15 .sup.1UniProtKB

    [1120] FIG. 9 shows an amino acid sequence alignment of the squalene hopene cyclase enzymes listed in Table 3 prepared with CLUSTAL O (1.2.4). The amino acids at positions 169, 306, and 600 of the Alicyclobacillus acidocaldarius (AacSHC) sequence are highlighted in white on a black background. W at position 169 is almost strictly conserved as is G at position 600 throughout the amino acid sequences aligned: 15 out of 16 sequences, one single conservative substitution.

    [1121] Amino acids at position 306 are less conserved (9 out of 16 sequences).

    Example 12

    Substrate Specificity and Product Selectivity of P2 SHC Variants (Bis-Homofarnesol)

    [1122] The influence of P2 mutations on substrate specificity and product selectivity was investigated when introduced in SHC #65 for the cyclization of Bis-homofarnesol for Ambra oxide production. The EE:EZ ratio of the Bis-homofarnesol feedstock used was 66:34.

    [1123] Reactions (3 ml volume), contained 4 g/l E,E-Bis-homofarnesol and cells to an OD.sub.650 nm of 10. The reactions were run with constant agitation (Heidolph Synthesis 1 Liquid 24, 800 rpm). The reaction with SHC #65 was run at pH 5.6 and 45 C. in presence of 0.07% SDS. The reaction with SHC #65 P2 was run at pH 6.2 and 35 C. in presence of 0.03% SDS.

    [1124] The reactions were sampled over time, extracted with MTBE and their content in E,E-Bis-homofarnesol, E,Z-Bis-homofarnesol, compounds X, XI, XII, and XIII (reaction products as shown in Table 12) analysed by GC-FID. Conversion was calculated as indicated in Example 10 for Homofarnesol.

    [1125] The new variants comprising P2 mutations in the SHC #65 background exhibit increased conversion of E,E-Bis-homofarnesol (see FIG. 10).

    [1126] A higher specificity for the E,E isomer of Bis-homofarnesol and a higher product specificity towards Ambra oxide of the SHC #65 P2 variant was observed compared to SH #65. E,E-Bis-homofarnesol was preferentially converted over E,Z-Bis-homofarnesol with SHC #65 P2. The proportion of Ambra oxide (X) in the reaction products arising from E,E-Bis-homofarnesol cyclization (X+XII) was increased: approx. 95:5 X:XII with SHC #65 P2 compared to approx. 90:10 with SHC #65 (Table 17).

    [1127] Product specificity regarding E,Z-Bis-homofarnesol cyclization was increased as well as no or almost no compound XIII resulted from E,Z-Bis-homofarnesol cyclization, but only compound XI was detected (Table 17).

    [1128] Overall the observations regarding substrate specificity and product selectivity were in line with the ones described with Homofarnesol in other examples. It was concluded that the effect of P2 mutations can be transferred to substrates other than E,E-homofarnesol, E,E-Bis-homofarnesol being one example. It can be assumed that the benefits obtained here can be transferred to other substrates (eg for the cyclisation of hydroxyfarnesylacetone for the production of Amberketal as set out in WO2021/209482).

    TABLE-US-00017 TABLE 17 Bis-homofarnesol cyclization with SHC enzyme variants. Bis- homofarnesol was cyclized with SHC#65 and SHC#65 P2. The composition of the reaction product (mixture of compounds X, XI, XII, XIII) is indicated for each compound as percent of total reaction product, and as a sum of the product pairs resulting form E,E-Bis-homofarnesol (X + XII) and E,Z-Bis-homofarnesol (XI + XIII). Bis- Reaction products homofarnesol (% of total reaction product) SHC conversion X + XI + enzyme (%) .sup.1 X XI XII XIII XII XIII SHC#65 85.1 70.5 17.0 8.2 4.3 78.7 21.3 SHC#65 P2 86.5 80.9 14.7 4.4 0.0 85.3 14.7 .sup.1 Total conversion of both EE and EZ isomers after 24 h of reaction.

    Example 13

    Influence of P1 Mutation on Homofarnesol Conversion and Product Selectivity in Wt SHC Enzymes.

    [1129] The influence of P1 mutation on Homofarnesol conversion and product selectivity for ()-Ambrox was investigated when introduced in AacSHC (SEQ ID NO:1), ZmoSHC1 (SEQ ID NO:13 ZmoSHC2 (SEQ ID NO:15), TeISHC (SEQ ID NO:23), and ScoSHC (SEQ ID NO:32). [1130] AaC SHC P1 variant (W169G mutation) represented by SEQ ID NO: 4, [1131] ZmoSHC1 P1 variant (W222G mutation) represented by SEQ ID NO:312 [1132] ZmoSCH2 P1 variant (W177G mutation) represented by SEQ ID NO:313 [1133] TeISHC P1 variant (W172G mutation) represented by SEQ ID NO: 304 [1134] ScoSHC P1 variant (W196G mutation) represented by SEQ ID NO:311

    [1135] Reactions (0.5 ml volume) contained 2.36 g/l Homofarnesol, cells that had produced the SHC enzyme to an OD.sub.650 nm of 6 and were run in deionized water at 30 C. (constant agitation). They were solvent extracted after 24 h and their content in reaction products (as shown in Table 13 and E,E- and E,Z-Homofarnesol isomers analysed by GC-FID analysis.

    [1136] The results indicated an increase in total homofarnesol conversion when the P1 mutation was inserted into the wild type SHC enzymes tested (FIG. 11).

    [1137] With the reaction conditions applied was the selectivity of the wild type SHC enzymes towards E,E-homofarnesol already quite high. It was nevertheless possible to conclude on an increased selectivity of the corresponding P1 variants towards E,E-Homofarnesol, this increase in selectivity being more pronounced with TeISHC P1, and significant with regard to ScoSHC P1 in comparison to the corresponding wild-type enzyme (FIG. 11).

    Example 14

    [1138] The table below is identical with Table 10 earlier depicted. This table shows a set of conserved amino acids at the active site for five wild type SHC enzymes

    TABLE-US-00018 TABLE 10 Set of conserved amino acids at the active site of 5 wt SHC enzymes. Conserved positions can be seen for amino acid positions 169, 261, 312, 365, 489, 600, 609 and 612 for five different WT SHC enzymes. Differences in hydrogen binding pocket can be seen for Q, Y and C in ZmoSHC1, ZmoSHC2 and ScoSHC for the amino acid position 168. active site amino acid Sequence identity to AacSHC (%) position based 0 45.8 38.3 44.2 51.0 on AacSHC AacSHC ZmoSHC1 ZmoSHC2 TelSHC ScoSHC 36 L V L L L 168 S Q Y S C 169 W W W W W 261 I I I I I 306 A A P P A 307 S T C C C 312 W W W W W 365 F F F F F 366 Q E Q E E 420 Y F F F F 489 W W W W W 600 G G G G G 607 L L L L I 609 Y Y Y Y Y 612 Y Y Y Y Y conserved (bold font) difference in hydrogen-binding pocket (italic font)

    Example 15

    Substrate Specificity and Product Selectivity of Additional SHC Variants (Eg SEQ ID NO: 306, or a Combination of the Mutations in SEQ ID NO: 5 and SEQ ID NO: 369)

    [1139] The mutations of the P1, P2 or P3 variants are introduced in: [1140] The wild type Aac SHC being represented by SEQ ID NO:1 leading to: [1141] AaC SHC P4 variant represented by SEQ ID NO: 5 and SEQ ID NO: 369 [1142] AaC SHC P4 variant represented by SEQ ID NO:306

    [1143] The introduction of the P4 variants show a significant influence on enzymatic activity. Reaction conditions defined as optimized are confirmed/adjusted (pH) in 0.1 M succinic acid/NaOH buffer, the buffer used in EEH bioconversion either at low or high substrate concentration. Overall the observations regarding substrate specificity and product selectivity are in line with the results described in other examples.

    Example 16

    Reducing Cells:Substrate Ratio with SHC #65 P2 SHC at Increased EEH Concentration

    [1144] The EE:EZ ratio of the Homofarnesol stock used was 80:20. The cell concentration of the cell suspension used was determined as outlined in Example 9.

    [1145] Reactions were run in a total volume of 25 g (25 ml reactions) in Radleys Monoblock Flask (200 rpm, constant agitation) using cells that had produced SHC variant SHC #65 P2. They contained 400 g/l E,E-Homofarnesol and the appropriate amount of cells for a [cells]:[EEH] ratio of 0.6, 0.5, 0.4, or 0.3. The reactions were run at pH 5.8 and 35 C. in 0.1 M succinic acid buffer with SDS provided at a constant [SDS]:[cells] ratio of 0.025. The pH of the reactions was measured at an externally calibrated electrode and adjusted manually as required with appropriately diluted phosphoric acid.

    [1146] With an EEH concentration of 400 g/l, full EEH conversion was achieved with a [cells]:[EEH]0.5 in 72 hours. With a [cells]:[EEH] ratio of 0.4, 95% EEH conversion was obtained in the same time. It was deduced from the reaction run at a [cells]:[EEH] ratio of 0.3 (approx. 70% EEH conversion after 3 days) that at least 2.3 g of EEH could be converted per gram of cells under the conditions tested.

    Example 17

    Increased Volumetric Productivity

    [1147] The EE:EZ ratio of the Homofarnesol stock used was 80:20. The cell concentration of the cell suspension used was determined as outlined in Example 9.

    [1148] Reactions were run in a total volume of 25 g (25 ml reactions) in Radleys Monoblock Flask (200 rpm, constant agitation) using cells that had produced SHC variant SHC #65 P2. They contained either 450 g/l E,E-Homofarnesol and 180 g/l cells ([cells]:[EEH] ratio of 0.4), or 250 g/l g/l E,E-Homofarnesol and 250 g/l cells ([cells]:[EEH] ratio of 1.0). The reactions were run in 0.1 M succinic acid buffer at pH 5.8 and 35 C., and at a constant [SDS]:[cells] ratio of 0.030. The pH of the reactions was measured at an externally calibrated pH electrode and adjusted as required manually with appropriately diluted phosphoric acid.

    [1149] With 450 g/l EEH and a [cells]:[EEH] ratio of 0.4, full EEH conversion was obtained in 72 h. Full conversion was obtained in 24 h with 250 g/l EEH at [cells]:[EEH] ratio of 1.0. This indicated the possibility for full conversion of up to 450 g/l EEH in 3 days using an appropriate amount of cells, and that this was possible with a [cells]:[EEH] ratio at least as low as 0.4 under the conditions tested.

    Example 18

    Preparative Scale Reaction: Bioconversion at Increased EEH Concentration

    [1150] The EE:EZ ratio of the Homofarnesol stock used was 80:20. The cell concentration of the cell suspension used was determined as outlined in Example 9.

    [1151] Reactions were run in a total volume of 1.1 kg (1.1 litre reaction) in a 1.5 litre sulfonation flask (230 rpm, constant agitation) placed in a water bath. The reaction contained 400 g/l E,E-Homofarnesol and 200 g/l cells that had produced SHC variant SHC #65 P2 ([cells]:[EEH] ratio of 0.5). The reaction was run at 35 C. and pH 5.8 in 0.1 M succinic acid buffer in presence of 5 g/l SDS ([SDS]:[cells] ratio of 0.025). The pH of the reaction was measured at an externally calibrated pH electrode and adjusted as required manually with appropriately diluted phosphoric acid.

    [1152] EEH conversion was >97.1% after 72 hours as judged from GC-FID analysis results. The reaction broth was treated as described e.g. in WO 2017182542 or WO2022023464 prior to filtration over a 500 mesh filter. The filter cake was washed with deionized water and dried under vacuum (approx. 80 mbar, 60 C.). 428.6 g crude ()-ambrox were recovered (white-brownish, slightly sticky crystalline material). GC-FID analysis of the crude material indicated that it consisted of 90.7% ()-ambrox, 0.0% compound II, 0.0% compound Ill, 1.2% compound IV, 2.6% E,E-Homofarnesol, and 5.5% E,Z-Homofarnesol. According to this data ()-ambrox accounted for 98.7% of the reaction products mixture (()-ambrox and compounds 1l, Ill, and IV). Overall ()-ambrox recovery yield was 91.0%: 388.7 g recovered form 427.2 g expected (EEH conversion as determined by GC-FID).

    TABLE-US-00019 Additionalsequences >ZmoSHC1P2:SEQIDNO:353 MGIDRMNSLSRLLMKKIFGAEKTSYKPASDTIIGTDTLKRPNRRPEPTAKVDKTIFKTMGNSLNNTLVSA CDWLIGQQKPDGHWVGAVESNASMEAEWCLALWFLGLEDHPLRPRLGNALLEMQREDGSWGVYFGAGNGD INATVEAYAALRSLGYSADNPVLKKAAAWIAEKGGLKNIRVFTRYWLALIGEWPWEKTPNLPPEIIWFPD NFVFSIYNFAQGARATMVPIAILSARRPSRPLRPQDRLDELFPEGRARFDYELPKKEGIDLWSQFFRTTD RGLHWVQSNLLKRNSLREAAIRHVLEWIIRHQDADGGWGGIQPPWVYGLMALHGEGYQLYHPVMAKALSA LDDPGWRHDRGESSWIQATNSPVWDTMLALMALKDAKAEDRFTPEMDKAADWLLARQVKVKGDWSIKLPD VEPGGWAFEYANDRYPDTDDTAVALIALSSYRDKEEWQKKGVEDAITRGVNWLIAMQSECGGWGAFDKDN NRSILSKIPFCDFGESIDPPSVDVTAHVLEAFGTLGLSRDMPVIQKAIDYVRSEQEAEGAWFGRWGVNYI YGTGAVLPALAAIGEDMTQPYITKACDWLVAHQQEDGGWGESCSSYMEIDSIGKGPTTPSQTAWALMGLI AANRPEDYEAIAKGCHYLIDRQEQDGSWKEEEFTGTMFPGYGVGQTIKLDDPALSKRLLQGAELSRAFML RYDFYRQFFPIMALSRAERLIDLNN >ZmoSHC1P3:SEQIDO:354 MGIDRMNSLSRLLMKKIFGAEKTSYKPASDTIIGTDTLKRPNRRPEPTAKVDKTIFKTMGNSLNNTLVSA CDWLIGQQKPDGHWVGAVESNASMEAEWCLALWFLGLEDHPLRPRLGNALLEMQREDGSWGVYFGAGNGD INATVEAYAALRSLGYSADNPVLKKAAAWIAEKGGLKNIRVFTRYWLALIGEWPWEKTPNLPPEIIWEPD NFVFSIYNFAQGARATMVPIAILSARRPSRPLRPQDRLDELFPEGRARFDYELPKKEGIDLWSQFFRTTD RGLHWVQSNLLKRNSLREAAIRHVLEWIIRHQDADGGWGGIQPPWVYGLMALHGEGYQLYHPVMAKALSA LDDPGWRHDRGESSWIQVTNSPVWDTMLALMALKDAKAEDRETPEMDKAADWLLARQVKVKGDWSIKLPD VEPGGWAFEYANDRYPDTDDTAVALIALSSYRDKEEWQKKGVEDAITRGVNWLIAMQSECGGWGAFDKDN NRSILSKIPFCDFGESIDPPSVDVTAHVLEAFGTLGLSRDMPVIQKAIDYVRSEQEAEGAWFGRWGVNYI YGTGAVLPALAAIGEDMTQPYITKACDWLVAHQQEDGGWGESCSSYMEIDSIGKGPTTPSQTAWALMGLI AANRPEDYEAIAKGCHYLIDRQEQDGSWKEEEFTGTMFPGYGVGQTIKLDDPALSKRLLQGAELSRAFML RYDFYRQFFPIMALSRAERLIDLNN >ZmoSHC2P2:SEQIDNO:355 MTVSTSSAFHHSPLSDDVEPIIQKATRALLEKQQQDGHWVFELEADATIPAEYILLKHYLGEPEDLEIEA KIGRYLRRIQGEHGGWSLFYGGDLDLSATVKAYFALKMIGDSPDAPHMLRARNEILARGGAMRANVFTRI QLALFGAMSWEHVPQMPVELMLMPEWFPVHINKMAYGARTVLVPLLVLQALKPVARNRRGILVDELFVPD VLPTLQESGDPIWRRFFSALDKVLHKVEPYWPKNMRAKAIHSCVHFVTERLNGEDGLGAIYPAIANSVMM YDALGYPENHPERAIARRAVEKLMVLDGTEDQGDKEVYCQPCLSPIWDTALVAHAMLEVGGDEAEKSAIS ALSWLKPQQILDVKGDWAWRRPDLRPGGWAFQYRNDYYPDVDDTAVVTMAMDRAAKLSDLHDDFEESKAR AMEWTIGMQSDNGGWGAFDANNSYTYLNNIPFADHGALLDPPTVDVSARCVSMMAQAGISITDPKMKAAV DYLLKEQEEDGSWFGRWGVNYIYGTWSALCALNVAALPHDHLAVQKAVAWLKTIQNEDGGWGENCDSYAL DYSGYEPMDSTASQTAWALLGLMAVGEANSEAVTKGINWLAQNQDEEGLWKEDYYSGGMFPRVFYLRYHG YSKYFPLWALARYRNLKKANQPIVHYGM >ZmoSHC2P3:SEQIDNO:356 MTVSTSSAFHHSPLSDDVEPIIQKATRALLEKQQQDGHWVFELEADATIPAEYILLKHYLGEPEDLEIEA KIGRYLRRIQGEHGGWSLFYGGDLDLSATVKAYFALKMIGDSPDAPHMLRARNEILARGGAMRANVFTRI QLALFGAMSWEHVPQMPVELMLMPEWFPVHINKMAYGARTVLVPLLVLQALKPVARNRRGILVDELFVPD VLPTLQESGDPIWRRFFSALDKVLHKVEPYWPKNMRAKAIHSCVHFVTERLNGEDGLGAIYPAIANSVMM YDALGYPENHPERAIARRAVEKLMVLDGTEDQGDKEVYCQVCLSPIWDTALVAHAMLEVGGDEAEKSAIS ALSWLKPQQILDVKGDWAWRRPDLRPGGWAFQYRNDYYPDVDDTAVVTMAMDRAAKLSDLHDDFEESKAR AMEWTIGMQSDNGGWGAFDANNSYTYLNNIPFADHGALLDPPTVDVSARCVSMMAQAGISITDPKMKAAV DYLLKEQEEDGSWFGRWGVNYIYGTWSALCALNVAALPHDHLAVQKAVAWLKTIQNEDGGWGENCDSYAL DYSGYEPMDSTASQTAWALLGLMAVGEANSEAVTKGINWLAQNQDEEGLWKEDYYSGGMFPRVFYLRYHG YSKYFPLWALARYRNLKKANQPIVHYGM >TelSHCP2:SEQIDNO:359 MPTSLATAIDPKQLQQAIRASQDELFSQQYAEGYWWAELESNVTMTAEVILLHKIWGTEQRLPLAKAEQY LRNHQRDHGGWELFYGDGGDLSTSVEAYMGLRLLGVPETDPALVKARQFILARGGISKTRIFTKLHLALI GCYDWRGIPSLPPWIMLLPEGSPETIYEMSSGARSSTVPLLIVMDRKPVYGMDPPITLDELYSEGRANVV WELPRQGDWRDVFIGLDRVFKLFETLNIHPLREQGLKAAEEWVLERQEASGDWGGIIPAMLNSLLALRAL DYAVDDPIVQRGMAAVDRFAIETETEYRVQPCVSPVWDTALVMRAMVDSGVAPDHPALVKAGEWLLSKQI LDYGDWHIKNKKGRPGGWAFEFENRFYPDVDDTAVVVMALHAVTLPNENLKRRAIERAVAWIASMQCRPG GWAAFDVDNDQDWLNGIPYGDLKAMIDPNTADVTARVLEMVGRCQLAFDRVALDRALAYLRNEQEPEGCW FGRWGVNYLYGTSGVLTALSLVAPRYDRWRIRRAAEWLMQCQNADGGWGETCWSYHDPSLKGKGDSTASQ TAWAIIGLLAAGDATGDYATEAIERGIAYLLETQRPDGTWHEDYFTGTMFPCHFYLKYHYYQQHFPLTAL GRYARWRNLLAT >TelSHCP3:SEQIDNO:360 MPTSLATAIDPKQLQQAIRASQDELFSQQYAEGYWWAELESNVTMTAEVILLHKIWGTEQRLPLAKAEQY LRNHQRDHGGWELFYGDGGDLSTSVEAYMGLRLLGVPETDPALVKARQFILARGGISKTRIFTKLHLALI GCYDWRGIPSLPPWIMLLPEGSPFTIYEMSSGARSSTVPLLIVMDRKPVYGMDPPITLDELYSEGRANVV WELPRQGDWRDVFIGLDRVFKLFETLNIHPLREQGLKAAEEWVLERQEASGDWGGIIPAMLNSLLALRAL DYAVDDPIVQRGMAAVDRFAIETETEYRVQVCVSPVWDTALVMRAMVDSGVAPDHPALVKAGEWLLSKQI LDYGDWHIKNKKGRPGGWAFEFENRFYPDVDDTAVVVMALHAVTLPNENLKRRAIERAVAWIASMQCRPG GWAAFDVDNDQDWLNGIPYGDLKAMIDPNTADVTARVLEMVGRCQLAFDRVALDRALAYLRNEQEPEGCW FGRWGVNYLYGTSGVLTALSLVAPRYDRWRIRRAAEWLMQCQNADGGWGETCWSYHDPSLKGKGDSTASQ TAWAIIGLLAAGDATGDYATEAIERGIAYLLETQRPDGTWHEDYFTGTMFPCHFYLKYHYYQQHEPLTAL GRYARWRNLLAT >ScoSHCP2:SEQIDNO:357 MTATTDGSTGASLRPLAASASDTDITIPAAAAGVPEAAARATRRATDELLAKQDAEGWWKGDLETNVTMD AEDLLLRQFLGIQDEETTRAAALFIRGEQREDGTWATFYGGPGELSTTIEAYVALRLAGDSPEAPHMARA AEWIRSRGGIASARVETRIWLALFGWWKWDDLPELPPELIYFPTWVPLNIYDFGCGARQTIVPLTIVSAK RPVRPAPFPLDELHTDPARPNPPRPLAPVASWDGAFQRIDKALHAYRKVAPRRLRRAAMNSAARWIIERQ ENDGCWGGIQPPAVYSVIALYLLGYDLEHPVMRAGLESLDRFAVWREDGARMIEACQSPVWDTCLATIAL ADAGVPEDHPQLVKASDWMLGEQIVRPGDWSVKRPGLPPGGWAFEFHNDNYPDIDDTAEVVLALRRVRHH DPERVEKAIGRGVRWNLGMQSKNGAWGAFDVDNTSAFPNRLPFCDFGEVIDPPSADVTAHVVEMLAVEGL AHDPRTRRGIQWLLDAQETDGSWFGRWGVNYVYGTGSVIPALTAAGLPTSHPAIRRAVRWLESVQNEDGG WGEDLRSYRYVREWSGRGASTASQTGWALMALLAAGERDSKAVERGVAWLAATQREDGSWDEPYFTGTME PWDESINYNLYRQVFPLTALGRYVHGEPFAKKPRAADAPAEAAPAEVKGS >ScoSHCP3:SEQIDNO:358 MTATTDGSTGASLRPLAASASDTDITIPAAAAGVPEAAARATRRATDELLAKQDAEGWWKGDLETNVTMD AEDLLLRQFLGIQDEETTRAAALFIRGEQREDGTWATFYGGPGELSTTIEAYVALRLAGDSPEAPHMARA AEWIRSRGGIASARVETRIWLALFGWWKWDDLPELPPELIYFPTWVPLNIYDFGCGARQTIVPLTIVSAK RPVRPAPFPLDELHTDPARPNPPRPLAPVASWDGAFQRIDKALHAYRKVAPRRLRRAAMNSAARWIIERQ ENDGCWGGIQPPAVYSVIALYLLGYDLEHPVMRAGLESLDRFAVWREDGARMIEVCQSPVWDTCLATIAL ADAGVPEDHPQLVKASDWMLGEQIVRPGDWSVKRPGLPPGGWAFEFHNDNYPDIDDTAEVVLALRRVRHH DPERVEKAIGRGVRWNLGMQSKNGAWGAFDVDNTSAFPNRLPFCDEGEVIDPPSADVTAHVVEMLAVEGL AHDPRTRRGIQWLLDAQETDGSWFGRWGVNYVYGTGSVIPALTAAGLPTSHPAIRRAVRWLESVQNEDGG WGEDLRSYRYVREWSGRGASTASQTGWALMALLAAGERDSKAVERGVAWLAATQREDGSWDEPYFTGTME PWDESINYNLYRQVFPLTALGRYVHGEPFAKKPRAADAPAEAAPAEVKGS AacSHCP1variant:SEQIDNO:4 MAEQLVEAPAYARTLDRAVEYLLSCQKDEGYWWGPLLSNVTMEAEYVLLCHILDRVDRDRMEKIRRYLLHEQREDGT WALYPGGPPDLDTTIEAYVALKYIGMSRDEEPMQKALRFIQSQGGIESSRVFTRMWLALVGEYPWEKVPMVPPEIMFL GKRMPLNIYEFGSGARATVVALSIVMSRQPVFPLPERARVPELYETDVPPRRRGAKGGGGWIFDALDRALHGYQKLSV HPFRRAAEIRALDWLLERQAGDGSWGGIQPPWFYALIALKILDMTQHPAFIKGWEGLELYGVELDYGGWMFQASISP VWDTGLAVLALRAAGLPADHDRLVKAGEWLLDRQITVPGDWAVKRPNLKPGGFAFQFDNVYYPDVDDTAVVVWAL NTLRLPDERRRRDAMTKGFRWIVGMQSSNGGWGAYDVDNTSDLPNHIPFCDFGEVTDPPSEDVTAHVLECFGSFGY DDAWKVIRRAVEYLKREQKPDGSWFGRWGVNYLYGTGAVVSALKAVGIDTREPYIQKALDWVEQHQNPDGGWGE DCRSYEDPAYAGKGASTPSQTAWALMALIAGGRAESEAARRGVQYLVETQRPDGGWDEPYYTGTGFPGDFYLGYTM YRHVFPTLALGRYKQAIERR AacSHCP2variant:SEQIDNO:5 MAEQLVEAPAYARTLDRAVEYLLSCQKDEGYWWGPLLSNVTMEAEYVLLCHILDRVDRDRMEKIRRYLLHEQREDGT WALYPGGPPDLDTTIEAYVALKYIGMSRDEEPMQKALRFIQSQGGIESSRVFTRMWLALVGEYPWEKVPMVPPEIMFL GKRMPLNIYEFGSGARATVVALSIVMSRQPVFPLPERARVPELYETDVPPRRRGAKGGGGWIFDALDRALHGYQKLSV HPFRRAAEIRALDWLLERQAGDGSWGGIQPPWFYALIALKILDMTQHPAFIKGWEGLELYGVELDYGGWMFQASISP VWDTGLAVLALRAAGLPADHDRLVKAGEWLLDRQITVPGDWAVKRPNLKPGGFAFQFDNVYYPDVDDTAVVVWAL NTLRLPDERRRRDAMTKGFRWIVGMQSSNGGWGAYDVDNTSDLPNHIPFCDFGEVTDPPSEDVTAHVLECFGSFGY DDAWKVIRRAVEYLKREQKPDGSWFGRWGVNYLYGTGAVVSALKAVGIDTREPYIQKALDWVEQHQNPDGGWGE DCRSYEDPAYAGKGASTPSQTAWALMALIAGGRAESEAARRGVQYLVETQRPDGGWDEPYYTGTMFPGDFYLGYTM YRHVFPTLALGRYKQAIERR AacSHCP3variant:SEQIDNO:6 MAEQLVEAPAYARTLDRAVEYLLSCQKDEGYWWGPLLSNVTMEAEYVLLCHILDRVDRDRMEKIRRYLLHEQREDGT WALYPGGPPDLDTTIEAYVALKYIGMSRDEEPMQKALRFIQSQGGIESSRVFTRMWLALVGEYPWEKVPMVPPEIMFL GKRMPLNIYEFGSGARATVVALSIVMSRQPVFPLPERARVPELYETDVPPRRRGAKGGGGWIFDALDRALHGYQKLSV HPFRRAAEIRALDWLLERQAGDGSWGGIQPPWFYALIALKILDMTQHPAFIKGWEGLELYGVELDYGGWMFQVSISP VWDTGLAVLALRAAGLPADHDRLVKAGEWLLDRQITVPGDWAVKRPNLKPGGFAFQFDNVYYPDVDDTAVVVWAL NTLRLPDERRRRDAMTKGFRWIVGMQSSNGGWGAYDVDNTSDLPNHIPFCDFGEVTDPPSEDVTAHVLECFGSFGY DDAWKVIRRAVEYLKREQKPDGSWFGRWGVNYLYGTGAVVSALKAVGIDTREPYIQKALDWVEQHQNPDGGWGE DCRSYEDPAYAGKGASTPSQTAWALMALIAGGRAESEAARRGVQYLVETQRPDGGWDEPYYTGTMFPGDFYLGYTM YRHVFPTLALGRYKQAIERR ZmoSHC1P1variant:SEQIDNO:312 MTRALRQAPESAGAIGIAAASPATETSGQDTHPREISGAITAARDALLKLQQADGHWCFMLEADCTIPAEYILWTHFTG ELEPEIERKLAARLRAKQASHGGWPLYEGGDLDISCSVKVYYALKLVGDDPNAPHMRRAREAILAQGGGARANVFTRL ALAMFSQIPWRGVPFIPVEIMLLPRWFPFHLSKVSYWSRTVMVPLAILYSLKAQAQNPRNVHIQELFTVPPEQERHYFP VRSRLNKILLSVERTARLLEPLIPSMLRRRALKKAETWFTERLNGEDGLGGIFPAMVNAHESLILLGYSPDHPWRVQAKK ALQNLVIEEKNSASCQPCLSPIWDTGLAALALQETEGGHTTAPVIRALDWLKERQILEQSGDWQVQHPNLKGGGWAF QYNNSYYPDLDDTALVAWSMDQAATPERYGEAIGRACDWLCGMQSRNGGFAAFESDNTHYYLNEIPFADHGALLDP PTADVTARCIVLLGRLNKPQYAETLQRALDYLRREQEPNGSWFGRWGTNYIYGTWSALTALEQANIDPQEGFIRKAVE WLKQVQRLDGGWGEDNYSYFDSSLAGRYQESTPVHTAWALLALMAVGEANSEAVKKGIAYLLQIQQEDGLWDHPAF NAPGFPRVFYLKYHGYDKFFPLWALARYRNHLNRQC TelSHCP1variant:SEQIDNO:304 MPTSLATAIDPKQLQQAIRASQDFLFSQQYAEGYWWAELESNVTMTAEVILLHKIWGTEQRLPLAKAEQYLRNHQRD HGGWELFYGDGGDLSTSVEAYMGLRLLGVPETDPALVKARQFILARGGISKTRIFTKLHLALIGCYDWRGIPSLPPWIML LPEGSPFTIYEMSSGARSSTVPLLIVMDRKPVYGMDPPITLDELYSEGRANVVWELPRQGDWRDVFIGLDRVFKLFETL NIHPLREQGLKAAEEWVLERQEASGDWGGIIPAMLNSLLALRALDYAVDDPIVQRGMAAVDRFAIETETEYRVQPCVS PVWDTALVMRAMVDSGVAPDHPALVKAGEWLLSKQILDYGDWHIKNKKGRPGGWAFEFENRFYPDVDDTAVVVM ALHAVTLPNENLKRRAIERAVAWIASMQCRPGGWAAFDVDNDQDWLNGIPYGDLKAMIDPNTADVTARVLEMVGR CQLAFDRVALDRALAYLRNEQEPEGCWFGRWGVNYLYGTSGVLTALSLVAPRYDRWRIRRAAEWLMQCQNADGG WGETCWSYHDPSLKGKGDSTASQTAWAIIGLLAAGDATGDYATEAIERGIAYLLETQRPDGTWHEDYFTGTGFPCHFY LKYHYYQQHFPLTALGRYARWRNLLAT ScoSHCP1variant:SEQIDNO:311 MTATTDGSTGASLRPLAASASDTDITIPAAAAGVPEAAARATRRATDFLLAKQDAEGWWKGDLETNVTMDAEDLLLR QFLGIQDEETTRAAALFIRGEQREDGTWATFYGGPGELSTTIEAYVALRLAGDSPEAPHMARAAEWIRSRGGIASARVF TRIWLALFGWWKWDDLPELPPELIYFPTWVPLNIYDFGCGARQTIVPLTIVSAKRPVRPAPFPLDELHTDPARPNPPRPL APVASWDGAFQRIDKALHAYRKVAPRRLRRAAMNSAARWIIERQENDGCWGGIQPPAVYSVIALYLLGYDLEHPVMR AGLESLDRFAVWREDGARMIEACQSPVWDTCLATIALADAGVPEDHPQLVKASDWMLGEQIVRPGDWSVKRPGLPP GGWAFEFHNDNYPDIDDTAEVVLALRRVRHHDPERVEKAIGRGVRWNLGMQSKNGAWGAFDVDNTSAFPNRLPFC DFGEVIDPPSADVTAHVVEMLAVEGLAHDPRTRRGIQWLLDAQETDGSWFGRWGVNYVYGTGSVIPALTAAGLPTS HPAIRRAVRWLESVQNEDGGWGEDLRSYRYVREWSGRGASTASQTGWALMALLAAGERDSKAVERGVAWLAATQ REDGSWDEPYFTGTGFPWDFSINYNLYRQVFPLTALGRYVHGEPFAKKPRAADAPAEAAPAEVKGS ZmoSCH2P1variant:SEQIDNO:313 MTVSTSSAFHHSPLSDDVEPIIQKATRALLEKQQQDGHWVFELEADATIPAEYILLKHYLGEPEDLEIEAKIGRYLRRIQGE HGGWSLFYGGDLDLSATVKAYFALKMIGDSPDAPHMLRARNEILARGGAMRANVFTRIQLALFGAMSWEHVPQMP VELMLMPEWFPVHINKMAYGARTVLVPLLVLQALKPVARNRRGILVDELFVPDVLPTLQESGDPIWRRFFSALDKVLHK VEPYWPKNMRAKAIHSCVHFVTERLNGEDGLGAIYPAIANSVMMYDALGYPENHPERAIARRAVEKLMVLDGTEDQG DKEVYCQPCLSPIWDTALVAHAMLEVGGDEAEKSAISALSWLKPQQILDVKGDWAWRRPDLRPGGWAFQYRNDYYP DVDDTAVVTMAMDRAAKLSDLHDDFEESKARAMEWTIGMQSDNGGWGAFDANNSYTYLNNIPFADHGALLDPPT VDVSARCVSMMAQAGISITDPKMKAAVDYLLKEQEEDGSWFGRWGVNYIYGTWSALCALNVAALPHDHLAVQKAV AWLKTIQNEDGGWGENCDSYALDYSGYEPMDSTASQTAWALLGLMAVGEANSEAVTKGINWLAQNQDEEGLWKE DYYSGGGFPRVFYLRYHGYSKYFPLWALARYRNLKKANQPIVHYGM

    TABLE-US-00020 TABLE 18 The correspondence between sequence ID numbers of WO2016/170099 and WO2021/110848 and the new sequence ID numbers of this disclosure is indicated in the table below. Source Original SEQ ID NO New SEQ ID NO WO2016/170099 5 361 WO2016/170099 7 362 WO2016/170099 9 363 WO2016/170099 11 364 WO2016/170099 13 365 WO2016/170099 15 366 WO2016/170099 17 367 WO2016/170099 19 368 WO2016/170099 23 369 WO2016/170099 25 370 WO2016/170099 27 371 WO2016/170099 29 372 WO2016/170099 31 373 WO2016/170099 33 374 WO2016/170099 35 375 WO2016/170099 37 376 WO2016/170099 39 377 WO2016/170099 171 378 WO2021/110848 2 379 WO2021/110848 4 380 WO2021/110848 5 381 WO2021/110848 17 382 WO2021/110848 18 383

    TABLE-US-00021 TABLE 19 summary of all sequences SHC Name/Accession Amino acid No/PCT SEQ ID No. Mutation (s) publication SEQ ID No. 1 None AacSHC SEQ ID No. 2 M132R + A224V + I432T + A557T + SHC65 R613S SEQ ID No. 3 M132R + A224V + I432T 215G2 SEQ ID No. 4 W169G AacSHC P1 SEQ ID No. 5 W169G + G600M AacSHCP2 SEQ ID No. 6 W169G + G600M + A306V AacSHCP3 SEQ ID No. 7 M132R + A224V + I432T + A557T + SHC65P1 R613S + W169G SEQ ID No. 8 M132R + A224V + I432T + A557T + SHC65P2 R613S + W169G + G600M SEQ ID No. 9 M132R + A224V + I432T + A557T + SHC65P3 R613S + W169G + G600M + A306V SEQ ID No. 10 M132R + A224V + I432T + W169G 215G2SHCP1 SEQ ID No. 11 M132R + A224V + I432T + W169G + 215G2SHCP2 G600M SEQ ID No. 12 M132R + A224V + I432T + W169G + 215G2SHCP3 G600M + A306V SEQ ID No. 13 Zymomonas mobilis subsp. mobilis AAV90172.1 ZM4 ATCC 31821 SEQ ID No. 14 Zymomonas mobilis (ZmoSHC1) WO2010139719 ATCC31821 US20120135477 PF62207_2 Genpept Accession No. AAV90172 AAF12829.1 AVZ42714.1 SEQ ID No. 15 ZmoSHC2 WO2010139719 EMBL/Genbank Accession No. US20120135477 X80766 SEQ ID No. 16 Bradryhizobium japonicum (BjpSHC) WO2010139719 PF62207_5 US20120135477 ABQ33590. SEQ ID No. 17 Burkholderia ambifaria WO2010139719 US20120135477 SEQ ID No. 18 Burkholderia ambifaria WO2010139719 US20120135477 SEQ ID No. 19 Bacillus anthracis WO2010139719 US20120135477 SEQ ID No. 20 Frankia alni WO2010139719 US20120135477 SEQ ID No. 21 Rhodopseudomonas palustris WO2010139719 US20120135477 SEQ ID No. 22 Gluconobacter morbifer (WT WO2018157021 GmoSHC) EHH69691.1 SEQ ID No. 23 Thermosynechococcus elongatus BAC09861.1 (TelSHC) SEQ ID No. 24 Acetobacter pasteurianus (ApaSHC1) ASC07046.1 SEQ ID No. 25 Bacillus megaterium (BmeSHC) WP_016763969 SEQ ID No. 26 Streptomyces albolongus SalSHC) AZN28579 SEQ ID No. 27 Acetobacter pasteurianus ApaSHCA) WP_003625617 SEQ ID No. 28 Burkholderia ambifaria BamSHC1) AJY25620.1 SEQ ID No. 29 Burkholderia ambifaria (BamSHC2) ABI91648.1 SEQ ID No. 30 Pelobacter carbinolicus (PcaSHC2) ABA87615.1 or Syntrophotalea carbinolica DSM 2380 SEQ ID No. 31 Rhodopseudomonas palustris ABJ08391.1 (RpaSHC1) SEQ ID No. 32 Streptomyces coelicolor (ScoSHC) CAB39697.1 SEQ ID No. 33 Syntrophobacter fumaroxidans ABK17672.1 (SfuSHC) SEQ ID No. 34 Teredinibacter turnerae (TtuSHC) ACR13362.1 SEQ ID No. 35 SEQ ID NO: 35 is the nucleotide sequence encoding the wild-type AacSHC. SEQ ID No. 36 SEQ ID NO: 36 is the nucleotide sequence encoding the polypeptide of SEQ ID NO: 2 (SHC#65 variant). SEQ ID No. 37 SEQ ID NO: 37 is the nucleotide sequence encoding the 215G2 variant (SEQ ID NO: 3). SEQ ID No. 38 SEQ ID NO: 38 is the nucleotide sequence encoding the AacSHC P1 represnted by SEQ ID NO: 4. SEQ ID No. 39 SEQ ID NO: 39 is the nucleotide sequence encoding the AacSHC P2 represented by SEQ ID NO: 5. SEQ ID No. 40 SEQ ID NO: 40 is the nucleotide sequence encoding the AacSHC P3 represented by SEQ ID NO: 6. SEQ ID No. 41 SEQ ID NO: 41 is the nucleotide sequence encoding the SHC#65 P1 variant represented by SEQ ID NO: 7. SEQ ID No. 42 SEQ ID NO: 42 is the nucleotide sequence encoding the SHC#65 P2 variant represented by SEQ ID NO: 8. SEQ ID No. 43 SEQ ID NO: 43 is the nucleotide sequence encoding the SHC#65 P3 variant represented by SEQ ID NO: 9. SEQ ID No. 44 SEQ ID NO: 44 is the nucleotide sequence encoding the 215G2 P1 variant represented by SEQ ID NO: 10 SEQ ID No. 45 SEQ ID NO: 45 is the nucleotide sequence encoding the 215G2 P2 variant represented by SEQ ID NO: 11 SEQ ID No. 46 SEQ ID NO: 46 is the nucleotide sequence encoding the 215G2 P3 variant represented by SEQ ID NO: 12 SEQ ID No. 47 M132R + A224V + I432T + Y81H + SHC66 A557T + R613S SEQ ID No. 48 M132R + A224V + I432T + Y81H + SHC110B8 H431L + A557T SEQ ID No. 49 M132R + A224V + I432T + T90A + SHC90C7 R613S SEQ ID No. 50 M132R + A224V + I432T + A172T + SHC115A7 M277K SEQ ID No. 51 M132R + A224V + I432T + L37Q SEQ ID No. 52 M132R + A224V + I432T + V174I SEQ ID No. 53 M132R + A224V + I432T + V174I + F601Y SEQ ID No. 54 M132R + A224V + I432T + L37Q + V1741 + F601Y SEQ ID No. 55 Acetobacter pasteurianus IFO 3283-01 BAH99456.1 squalenehopene cyclase[Acetobacter pasteurianus IFO3283-01] SEQ ID No. 56 Acidithiobacillus caldus EET25937.1 SEQ ID No. 57 Acidithiobacillus ferrooxidans ACH84004.1 SEQ ID No. 58 Acidothermus cellulolyticus ABK53469.1 SEQ ID No. 59 Adiantum capillus-veneris BAF93209.1 SEQ ID No. 60 Histoplasma capsulatum H143 EER40510.1 SEQ ID No. 61 Histoplasma capsulatum G186AR EEH02950.1 SEQ ID No. 62 Alicyclobacillus acidocaldarius LAA1 EED08231.1 SEQ ID No. 63 squalene-hopene cyclase-partial [Alicyclobacillus acidocaldarius] SEQ ID No. 64 Alicyclobacillus acidoterrestris CAA61950.1 SEQ ID No. 65 Anabaena variabilis ABA24268.1 SEQ ID No. 66 Anaeromyxobacter sp. ABS28257.1 SEQ ID No. 67 Aspergillus clavatus EAW07713.1 SEQ ID No. 68 Aspergillus flavus EED48353.1 SEQ ID No. 69 Aspergillus fumigatus EDP50814.1 SEQ ID No. 70 Aspergillus fumigatus EAL84865.1 SEQ ID No. 71 Aspergillus fumigatus EAL86291.2 SEQ ID No. 72 Aspergillus niger CAK43501.1 SEQ ID NO 73 Aspergillus niger SEQ ID No. 74 Aspergillus oryzae BAE63941.1 SEQ ID No. 75 Bacillus velezensis FZB42 ABS74269.1 SEQ ID No. 76 Bacillus wiedmannii EEK66523.1 SEQ ID No. 77 Bacillus cereus G9241 EAL12758.1 SEQ ID No. 78 Bacillus cereus Rock3-42 EEL44583.1 SEQ ID No. 79 Bacillus cereus m1293 EEK43841.1 SEQ ID No. 80 Bacillus cereus EEK82938.1 SEQ ID No. 81 Bacillus cereus EEK99528.1 SEQ ID No. 82 Bacillus cereus EEK77935.1 SEQ ID No. 83 Bacillus cereus EEL81079.1 SEQ ID No. 84 Bacillus cereus m1550 EEK88307.1 SEQ ID No. 85 Bacillus cereus F65185 EEL63943.1 SEQ ID No. 86 Bacillus cereus Rock4-18 EEL59884.1 SEQ ID Bacillus cereus EEL69857.1 No. 87Molybdopterin converting factor, subunit 1 [Bacillus cereus Rock4-18] EEL59884.2 SEQ ID No. 88 SEQ ID No. 89 Bacillus cereus AH1273 EEL92663.1 SEQ ID No. 90 Bacillus cereus Rock3-44 EEL49968.1 SEQ ID No. 91 Bacillus cereus E33L AAU16998.1 SEQ ID No. 92 Bacillus cereus ATCC 10987 AAS42477.1 SEQ ID No. 93 Bacillus cereus G9842 ACK95843.1 SEQ ID No. 94 Bacillus coahuilensis ZP_03226483.1 SEQ ID No. 95 Bacillus cytotoxicus ABS22481.1 SEQ ID No. 96 Bacillus licheniformis DSM 13 AAU23777.1 SEQ ID No. 97 Bacillus mycoides DSM 2048 EEL98438.1 SEQ ID No. 98 Bacillus pseudomycoides EEM04821.1 SEQ ID No. 99 Bacillus pseudomycoides DSM 12442 EEM16144.1 SEQ ID No. 100 Bacillus pumilus SAFR-032 ABV62529.1 SEQ ID No. 101 Bacillus pumilus ATCC 7061 EDW21137.1 102 Bacillus sp. NRRL B-14911 EAR64404.1 103 Bacillus sp. SG-1 EDL66148.1 104 Bacillus subtilis Q796C3.1 105 Bacillus subtilis AAB84441.1 106 Bacillus thuringiensis str. Al Hakam ABK86448.1 107 Bacillus thuringiensis serovar EEM21409.1 tochigiensis BGSC 4Y1 108 Bacillus thuringiensis serovar EEM82653.1 huazhongensis BGSC 4BD1 109 Bacillus thuringiensis serovar kurstaki EEM52372.1 str. T03a001 110 Bacillus thuringiensis Bt407 EEM27851.1 111 Bacillus thuringiensis serovar sotto EEM40716.1 str. T04001 112 Bacillus thuringiensis serovar pakistani EEM46814.1 str. T13001 113 Bacillus thuringiensis IBL 200 EEM94969.1 114 Bacillus mycoides KBAB4 ABY44436.1 115 Pedosphaera parvula Ellin514 EEF59508.1 116 Beijerinckia indica subsp. indica ATCC ACB96717.1 9039 117 Blastopirellula marina DSM 3645 EAQ81955.1 118 Blastopirellula marina DSM 3645 EAQ78122.1 119 Bradyrhizobium japonicum CAA60250.1 120 Acetobacter pasteurianus IFO 3283- BAH98349.1 01 121 Bradyrhizobium sp. ORS 278 CAL79893.1 122 Brevibacillus brevis NBRC 100599 BAH44778.1 123 Burkholderia ambifaria IOP40-10 EDT05097.1 124 Burkholderia ambifaria MEX-5 EDT37649.1 125 Burkholderia ambifaria MC40-6 ACB68303.1 126 Burkholderia ambifaria MEX-5 EDT42454.1 127 Burkholderia cenocepacia PC184 EAY66961.1 128 Burkholderia cenocepacia ACA95661.1 129 Burkholderia cenocepacia J2315 CAR57099.1 130 Burkholderia cenocepacia J2315 CAR56694.1 131 Burkholderia dolosa AU0158 EAY71311.1 132 Burkholderia glumae BGR1 ACR32572.1 133 Burkholderia glumae BGR1 ACR30752. 134 Burkholderia graminis C4D1M EDT12320.1 135 Burkholderia mallei SAVP1 ABM48844.1 136 Burkholderia multivorans ATCC 17616 ABX19650.1 137 Burkholderia multivorans ATCC 17616 ABX16859.1 138 Burkholderia phymatum ACC73258.1 139 Burkholderia phytofirmans PsJN ACD21317.1 140 Burkholderia pseudomallei EEC32728.1 141 Burkholderia sp. H160 EEA03553.1 142 Burkholderia lata ABB06563.1 143 Burkholderia lata ABB10136.1 144 Burkholderia sp. CCGE1002 EFA54357.1 145 Burkholderia xenovorans LB400 ABE35912.1 146 Candidatus Koribacter versatilis ABF40741.1 Ellin345 147 Candidatus Kuenenia stuttgartiensis CAJ71215.1 148 Candidatus Solibacter usitatus ABJ82180.1 Ellin6076 149 Candidatus Solibacter usitatus ABJ82254.1 Ellin6076 150 Catenulispora acidiphila DSM 44928 ACU75510.1 151 Chthoniobacter flavus Ellin428 EDY15838.1 152 Chthoniobacter flavus Ellin428 EDY22035.1 153 Crocosphaera watsonii WH 8501 EAM53094.1 154 Cupriavidus taiwanensis LMG 19424 CAQ72562.1 155 Crocosphaera subtropica ATCC ACB53858.1 51142 156 Gloeothece citriformis PCC 7424 ACK71719.1 157 Cyanothece sp. PCC 8802 EDY02410.1 158 Rippkaea orientalis PCC 8801 ACK66841.1 159 Cyanothece sp. PCC 7822 EDX97382.1 160 Crocosphaera chwakensis EAZ91809.1 161 Cyanothece sp. PCC 7425 ACL45896.1 162 Rippkaea orientalis PCC 8802 ACV02092.1 163 Desulfovibrio salexigens DSM 2638 EEC62384.1 164 Dryopteris crassirhizoma BAG68223.1 165 Frankia alni ACN14a CAJ61140.1 166 Frankia alni ACN14a CAJ60090.1 167 Frankia casuarinae ABD10207.1 168 Frankia sp. ABW15063.1 169 Frankia sp. ABW14125.1 170 Frankia sp. Eul1c EFA59873.1 171 Frankia sp. Eul1c EFA59089.1 172 Geobacillus sp. EED61885.1 173 Geobacillus thermodenitrificans EDY05760.1 174 Geobacillus sp. Y412MC52 EEN95021.1 175 Geobacillus sp. Y412MC61 ACX79399.1 176 Geobacter bemidjiensis ACH40355.1 177 Geobacter lovleyi ACD95949.1 178 Geobacter metallireducens ABB30662.1 179 Geobacter metallireducens ABB33038.1 180 Geotalea daltonii FRC-32 ACM21577.1 181 Geobacter sp. M21 EDV72707.1 182 Geotalea daltonii FRC-32. ACM22003.1 183 Geobacter sp. M18 EET34621.1 184 Geobacter sp. M21 ACT16952.1 185 Geobacter sulfurreducens AAR36453.1 186 Geobacter sulfurreducens AAR34018.1 187 Geotalea uraniireducens Rf4 ABQ25226.1 188 Gloeobacter violaceus PCC 7421 BAC91998.1 189 Gluconacetobacter diazotrophicus ACI51585.1 190 Gluconacetobacter diazotrophicus CAP55563.1 191 Gluconobacter oxydans AAW61994.1 192 Granulibacter bethesdensis ABI63005.1 193 Hyphomicrobium denitrificans ATCC EET65847.1 51888 194 Leptospirillum ferrodiazotrophum EES53667.1 195 Leptospirillum rubarum. EAY57382 196 Leptospirillum sp. EDZ38599.1 197 Magnetospirillum magnetotacticum ZP_00052068.2 198 Methylacidiphilum infernorum ACD82457.1 199 Methylorubrum extorquens CM4 ACK83067.1 200 Methylorubrum extorquens ACK86232.1 201 Methylobacterium extorquens CAX24364.1 202 Methylobacterium nodulans ACL61886.1 203 Methylobacterium populi ACB79998.1 204 Methylobacterium radiotolerans ACB27373.1 205 Methylobacterium sp. ACA20611.1 206 Methylocella silvestris ACK52150.1 207 Methylococcus capsulatus CAA71098.1 208 Neosartorya fischeri NRRL 181 EAW20752.1 209 Nitrobacter hamburgensis ABE63461.1 210 Nitrobacter sp. EAQ34404.1 211 Nitrobacter winogradskyi ABA05523.1 212 Nitrococcus mobilis EAR22397.1 213 Nitrosococcus oceani ATCC 19707 ABA57818.1 214 Nitrosomonas eutropha ABI59752.1 215 Nitrosomonas sp. AL212 EET32702.1 216 Nitrosospira multiformis ATCC 25196 ABB75845.1 217 Nostoc punctiforme PCC 73102 ACC84529.1 218 Nostoc sp. PCC 7120 BAB72732.1 219 Afipia carboxidovorans ACI93782.1 220 Paenibacillus sp. EDS49994.1 221 Paenibacillus sp. JDR-2 ACS99948.1 222 Paenibacillus sp. oral taxon 786 EES74793.1 223 Syntrophotalea carbinolica DSM 2380 ABA87701.1 224 Pelobacter propionicus DSM 2379 ABK98395.1 225 Pelobacter propionicus DSM 2379 ABK98811.1 226 Goniophlebium niponicum BAI48071.1 227 Goniophlebium niponicum BAI48070.1 228 Cupriavidus pinatubonensis JMP134 AAZ64302.1 229 Cupriavidus necator H16 CAJ96989.1 230 Ralstonia metallidurans ABF11015.1 231 Ralstonia metallidurans ABF11268.1 232 Rhizobium sp. P55348.1 233 Rhodopirellula baltica CAD74517.1 234 Rhodopseudomonas palustris ACF02757.1 235 Rhodopseudomonas palustris CAA71101.1 236 Rhodopseudomonas palustris ABD06434.1 237 Rhodopseudomonas palustris ABD87279.1 238 Rhodospirillum rubrum ATCC 11170 ABC20867.1 239 Rubrobacter xylanophilus DSM 9941 ABG05671.1 240 Saccharomonospora viridis DSM ACU97316.1 43017 241 Saccharopolyspora erythraea NRRL CAM03596.1 2338 242 Schizosaccharomyces japonicus EEB08219.1 243 Sphaerobacter thermophilus DSM ACZ39437.1 20745 244 Streptomyces albus ZP_04706071.1 245 Streptomyces avermitilis NBRC 14893 BAC69361.1 246 Acaryochloris marina ABW29816.1 247 Streptomyces roseosporus NRRL ZP_04697579.1 15998 248 Streptomyces flavogriseus ATCC EEW70811.1 33331 249 Streptomyces ghanaensis ATCC ZP_04684415.1 14672 250 Streptomyces griseoflavus ZP_05537325.1 251 Streptomyces griseus ATCC 53653 BAG17791.1 252 Streptomyces lividans ZP_05522220.1 253 Streptomyces peucetius subsp. ACA52082.1 caesius ATCC 27952 254 Streptomyces pristinaespiralis ATCC EDY61772.1 25486 255 Streptomyces scabiei CBG68454.1 256 Streptomyces sp. EDX25760.1 257 Streptomyces sp. EDY46371.1 258 Streptomyces sp. AA4 ZP_05479203.1 259 Streptomyces sp. ZP_05510126.1 260 Streptomyces sp. Mg1 ZP_05001249.1 261 Streptomyces sp. SPB74 ZP_04995097.1 262 Streptomyces sp. SPB78 ZP_05490781.1 263 Streptomyces sviceus ATCC 29083 EDY55942.1 264 Streptomyces viridochromogenes ZP_05535608.1 DSM 40736 265 Synechococcus sp. PCC 7335 EDX84551.1 266 Synechococcus sp. PCC 7335 ZP_05035816.1 267 Synechocystis sp. PCC 6803 BAA17978.1 268 Trichodesmium erythraeum ABG50159.1 269 Verrucomicrobium spinosum DSM ZP_02925563.1 4136 270 Acidiphilium cryptum ABQ30890.1 271 Acetobacter fabarum PAK78064.1 272 Acetobacter orleanensis JCM 7639 GAN69910.1 272 Acetobacter orleanensis JCM 7639 GAN69910.1 273 Acetobacter pasteurianus WP_012812952.1 274 Acidothermus cellulolyticus WP_011720532.1 275 Alicyclobacillus acidocaldarius WP_012811690.1 276 Bacillus megaterium WP_013083001.1 277 Bacillus subtilis WP_004399534.1 278 Bacillus thuringiensis AJI35613.1 279 Brevibacillus thermoruber WP_029099368.1 280 Chloracidobacterium thermophilum WP_014100779.1 281 Cohnella thermotolerans WP_027091823.1 282 Geobacillus thermodenitrificans WP_029761705.1 283 Geobacillus sp. WP_031409036.1 284 Gluconacetobacter xylinus CUW48332.1 285 Gluconobacter frateurii NBRC 103465 GAD08844.1 285 Gluconobacter frateurii NBRC 103465 GAD08844.1 286 Komagataeibacter nataicola AQU88860.1 287 Komagataeibacter xylinus AHI26287.1 288 Methylacidiphilum fumariolicum WP_009061034.1 289 Methylococcus capsulatus WP_010960137.1 290 Sphaerobacter thermophiles WP_012872483.1 291 Syntrophobacter fumaroxidans WP_011698842.1 292 Teredinibacter turnerae WP_015819476.1 293 Thermoactinomyces sp. Gus2-1 KFZ40906.1 294 Zymomonas mobilis WP_011241313.1 295 Alicyclobacillus acidocaldarius P33247.4 SEQ ID No. 296 WT Pseudomonas mendocina PmeSHC amino acid sequence SEQ ID No. 297 nucleotide sequence of SHC/HAC enzyme variant #66 SEQ ID No. 298 nucleotide sequence of SHC/HAC enzyme variant #110B8 SEQ ID No. 299 nucleotide sequence of SHC/HAC variant #90C7 SEQ ID No. 300 nucleotide sequence of SHC/HAC variant #115A7 SEQ ID No. 301 amino acid sequence of a GmoSHC variant with V45L, Q54E, M184I, T326S, F624Y SEQ ID No. 302 TelSHC with W172G , P311V, F425Y, G609A SEQ ID No. 303 ZmoSHC1 with Q221S, W222G, A368V, F486Y, G667A SEQ ID No. 304 TelSHC with W172G SEQ ID No. 305 AacSHC with W169G, G600M, M132R, A224V and I432T mutations SEQ ID No. 306 AacSHC with W169G, G600M , M132R and I432T mutations SEQ ID No. 307 EHH69691.1 squalene-hopene cyclase [Gluconobacter morbifer G707] SEQ ID No. 308 EER62728.1 squalene-hopene EER62728.1 cyclase [Zymomonas mobilis subsp. mobilis ATCC 10988] SEQ ID No. 309 AHI26287.1 squalene--hopene AHI26287.1 cyclase [Komagataeibacter xylinus E25] SEQ ID No. 310 Geobacillus vulcani WP_031409036 WP_031409036.1 MULTISPECIES: squalene--hopene cyclase [Geobacillus] SEQ ID No. 311 Sco SHC with the W196G mutation SEQ ID No. 312 ZmoSHC1 with the W222G mutation SEQ ID No. 313 ZmoSHC2 with the W177G mutation SEQ ID No. 314 <400> 314 Asp Xaa Asp Asp Thr Ala 1 5 Artificial Sequence (Motif) SEQ ID No. 315 W169G in WT AacSHC Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 316 W169A Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 317 W169V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 318 W169G + G600A Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 319 W169G + G600V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 320 W169G + G600L Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 321 W169G + G600I Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 322 W169G + G600M Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 323 W169A + G600A Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 324 W169A + G600V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 325 W169A + G600L Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 326 W169A + G600I Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 327 W169A + G600M Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 328 W169V + G600A Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 329 W169V + G600V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 330 W169V + G600L Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 331 W169V + G600I Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 332 W169V + G600M Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 333 W169G + G600A + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 334 W169G + G600V + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 335 W169G + G600L + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 336 W169G + G600I + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 337 W169G + G600M + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 338 W169A + G600A + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 339 W169A + G600V + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 340 W169A + G600L + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 341 W169A + G600I + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 342 W169A + G600M + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 343 W169V + G600A + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 344 W169V + G600V + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 345 W169V + G600L + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 346 W169V + G600I + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 347 W169V + G600M + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 348 M132R + A224V + I432T Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 349 Nucleotide sequence for WT AacSHC Coding DNA for (SEQ ID No. 1) mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 350 W169G + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 351 W169A + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 352 W169V + A306V Mutated SHC of Alicyclobacillus acidocaldarius SEQ ID No. 353 ZmoSHC1 P2 SEQ ID NO: 13 with the substitutions W222G and G667M SEQ ID No. 354 ZmoSHC1 P3 SEQ ID NO: 13 with the substitutions W222G, A368V and G667M SEQ ID No. 355 ZmoSHC2 P2 SEQ ID NO: 15 with the substitutions W177G and G619M SEQ ID No. 356 ZmoSHC2 P3 SEQ ID NO: 15 with the substitutions W177G, A321V and G619M SEQ ID No. 357 ScoSHC P2 SEQ ID NO: 32 with the substitutions W196G and G629M SEQ ID No. 358 ScoSHC P3 SEQ ID NO: 32 with the substitutions W196G, A335V and G629M SEQ ID No. 359 TelSHC P2 SEQ ID NO: 23 with the substitutions W172G and G609M SEQ ID No. 360 TelSHC P3 SEQ ID NO: 23 with the substitutions W172G, A311V and G609M SEQ ID No. 361 T77A SEQ ID No. 5 of Synthetic AacSHC Derivative WO2016/170099 SEQ ID No. 362 I92V SEQ ID No. 7 of Synthetic AacSHC Derivative WO2016/170099 SEQ ID No. 363 F129L SEQ ID No. 9 of WO2016/170099 SEQ ID No. 364 M132R SEQ ID No. 11 of WO2016/170099 SEQ ID No. 365 A224V SEQ ID No. 13 of WO2016/170099 SEQ ID No. 366 I432T SEQ ID No. 15 of WO2016/170099 SEQ ID No. 367 Q579H SEQ ID No. 17 of WO2016/170099 SEQ ID No. 368 F601Y SEQ ID No. 19 of WO2016/170099 SEQ ID No. 369 M132R + I432T SEQ ID No. 23 of WO2016/170099 SHC26 SEQ ID No. 370 F601Y SEQ ID No. 25 of WO2016/170099 SHC3 SEQ ID No. 371 T77A + I92V + F129L SEQ ID No. 27of WO2016/170099 111C8 SEQ ID No. 372 Q579H + F601Y SEQ ID No. 29 of WO2016/170099 101A10 SEQ ID No. 373 F129L SEQ ID No. 31 of WO2016/170099 SHC10 SEQ ID No. 374 F129L + F601Y SEQ ID No. 33 of WO2016/170099 SHC30 SEQ ID No. 375 F129L + M132R + I432T SEQ ID No. 35 of WO2016/170099 SHC31 SEQ ID No. 376 M132R + I432T + F601Y SEQ ID No. 37 of WO2016/170099 SHC32 SEQ ID No. 377 F129L + M132R + I432T + F601Y SEQ ID No. 39 of WO2016/170099 SHC33 SEQ ID No. 378 F605W SEQ ID No. 171 of WO2016/170099 SEQ ID No. 379 M132R, A224V, I432T, A557T and SHC#49 H431L, SEQ ID No. 380 M132R, A224V, I432T, Y81H, A557T SHC#66 and R613S SEQ ID No. 381 M132R, A224V, I432T, Y81H, H431L SHC#110B8 and A557T SEQ ID No. 382 M132R, A224V, I432T, T90A and SHC#90C7 R613S, SEQ ID No. 383 M132R, A224V, I432T, A172T and SHC#115A7 M277K SEQ ID No. 384 Zymomonas mobilis (ZmoSHC1) SEQ ID NO: 2 of ATCC31821 WO2010139719 PF62207_2 US20120135477 Genpept Accession No. AAV90172 AAF12829.1 AVZ42714.1 SEQ ID No. 385 M132R + A224V + I432T + W169G + A306V. SEQ ID No. 386 M132R + A224V + I432T + A557T + R613S + W169G + A306V.