ENZYMATIC SYNTHESIS OF MYCOSPORINE-LIKE AMINO ACIDS
20260043057 · 2026-02-12
Assignee
Inventors
Cpc classification
A61Q17/04
HUMAN NECESSITIES
C12N9/0071
CHEMISTRY; METALLURGY
C12N9/00
CHEMISTRY; METALLURGY
A61K8/44
HUMAN NECESSITIES
C12Y603/02
CHEMISTRY; METALLURGY
C12N9/0073
CHEMISTRY; METALLURGY
C12N15/70
CHEMISTRY; METALLURGY
International classification
A61K8/44
HUMAN NECESSITIES
A61Q17/04
HUMAN NECESSITIES
C12N9/00
CHEMISTRY; METALLURGY
Abstract
The present invention relates to methods of producing compounds of interest in a recombinant microorganism. In particular, the present invention relates to using a recombinant microorganism comprising a heterologous nucleic acid encoding one or more mycosporine-like amino acid (MAA) biosynthetic enzymes (e.g., MysH) to produce compounds of interest. Compositions comprising compounds produced using such methods are also provided herein. The present disclosure also provides methods of preventing sunburn, cancer, and chronic inflammatory diseases by administering such compositions to subjects in need thereof.
Claims
1. A method for producing a compound, comprising: a) culturing a recombinant microorganism under conditions suitable for production of the compound; and b) isolating the compound from the recombinant microorganism, wherein the recombinant microorganism comprises a heterologous nucleic acid encoding one or more mycosporine-like amino acid (MAA) biosynthetic enzymes, wherein the one or more MAA biosynthetic enzymes comprise a phytanoyl-CoA dioxygenase (MysH), or a homolog thereof.
2. The method of claim 1, wherein the phytanoyl-CoA dioxygenase comprises an amino acid sequence of any one of SEQ ID NOs: 1-11, or an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of any one of SEQ ID NOs: 1-11.
3. The method of claim 1 or 2, wherein the one or more MAA biosynthetic enzymes further comprise a D-alanine-D-alanine ligase (MysD), or a homolog thereof.
4. The method of claim 3, wherein the D-alanine-D-alanine ligase comprises an amino acid sequence of SEQ ID NO: 12, or an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 12.
5. The method of any one of claims 1-4, wherein the one or more MAA biosynthetic enzymes further comprise an ATP-grasp enzyme (MysC), or a homolog thereof.
6. The method of claim 5, wherein the ATP-grasp enzyme comprises an amino acid sequence of any one of SEQ ID NOs: 13-104 and 113-116, or an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of any one of SEQ ID NOs: 13-104 and 113-116.
7. The method of any one of claims 1-6, wherein the one or more biosynthetic enzymes further comprise one or more enzymes selected from the group consisting of a dimethyl-4-deoxygadusol synthase (MysA), an O-methyltransferase (MysB), and a non-ribosomal peptide synthetase (NRPS)-like enzyme (MysE).
8. The method of any one of claims 1-7, wherein the compound is a palythine analog.
9. The method of any one of claims 1-8, wherein the compound has UV-modulating activity.
10. The method of claim 9, wherein the UV-modulating activity comprises absorption of UV wavelengths between 310 and 362 nm.
11. The method of any one of claims 1-10, wherein the compound is of Formula (I), or a salt thereof: ##STR00047## wherein: each of R.sub.1, R.sub.2, R.sub.3, and R.sub.4 is independently selected from the group consisting of OR.sup.a, (NH)R.sup.b, and N(R.sup.b).sub.2, wherein each instance of R.sup.a is independently hydrogen or optionally substituted C.sub.1-6 alkyl and each instance of R.sup.b is independently hydrogen or optionally substituted C.sub.1-6 alkyl; and R.sub.5 is an amino acid.
12. The method of claim 11, wherein R.sub.1 is OR.sup.a, wherein R.sup.a is optionally substituted C.sub.1-6 alkyl.
13. The method of claim 12, wherein R.sub.1 is OCH.sub.3.
14. The method of any one of claims 11-13, wherein R.sub.2 is NH.sub.2.
15. The method of any one of claims 11-14, wherein R.sub.3 is OH.
16. The method of any one of claims 11-15, wherein R.sub.4 is OH.
17. The method of any one of claims 11-16, wherein R.sub.5 is threonine.
18. The method of any one of claims 11-16, wherein R.sub.5 is serine.
19. The method of any one of claims 11-16, wherein R.sub.5 is isoleucine.
20. The method of any one of claims 11-16, wherein R.sub.5 is methionine.
21. The method of any one of claims 11-16, wherein R.sub.5 is valine.
22. The method of any one of claims 1-11, wherein the compound is of the formula: ##STR00048## or a salt thereof.
23. The method of any one of claims 1-10, wherein the compound is of the formula: ##STR00049## or a salt thereof.
24. The method of any one of claims 1-23, further comprising providing a substrate of the one or more mycosporine-like amino acid (MAA) biosynthetic enzymes to the recombinant microorganism.
25. The method of claim 24, wherein the substrate is a compound of Formula (II), or a salt thereof: ##STR00050## wherein: each of R.sub.1, R.sub.2, R.sub.3, and R.sub.4 is independently selected from the group consisting of OR.sup.a, (NH)R.sup.b, and N(R.sup.b).sub.2, wherein each instance of R.sup.a is independently hydrogen or optionally substituted C.sub.1-6 alkyl and each instance of R.sup.b is independently hydrogen or optionally substituted C.sub.1-6 alkyl; and Y is O or NR.sub.5, wherein R.sub.5 is optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.1-6 alkenyl, or an amino acid.
26. The method of claim 25, wherein R.sub.1 is OH.
27. The method of claim 25, wherein R.sub.1 is OCH.sub.3.
28. The method of any one of claims 25-27, wherein R.sub.2 is OH.
29. The method of any one of claims 25-27, wherein R.sup.2 is NH.sub.2.
30. The method of any one of claims 25-27, wherein R.sub.2 is (NH)R.sup.b, wherein R.sup.b is optionally substituted alkyl.
31. The method of claim 30, wherein R.sub.2 is NHCH.sub.2CO.sub.2H.
32. The method of any one of claims 25-31, wherein R.sub.3 is OH.
33. The method of any one of claims 25-32, wherein R.sub.4 is OH.
34. The method of any one of claims 25-33, wherein Y is O.
35. The method of any one of claims 25-33, wherein Y is NR.sub.5.
36. The method of claim 35, wherein R.sub.5 is threonine.
37. The method of claim 35, wherein R.sub.5 is serine.
38. The method of claim 35, wherein R.sub.5 is isoleucine.
39. The method of claim 35, wherein R.sub.5 is methionine.
40. The method claim 35, wherein R.sub.5 is valine.
41. The method of claim 25, wherein the substrate is of the formula: ##STR00051## ##STR00052## or a salt thereof.
42. The method of any one of claims 1-41, wherein the one or more MAA biosynthetic enzymes further comprise a glycosyltransferase (GlyT), or a homolog thereof.
43. The method of any one of claims 1-42, wherein the recombinant microorganism is a species of bacteria or yeast.
44. The method of claim 43, wherein the bacteria is a species of cyanobacteria.
45. The method of claim 43, wherein the bacteria is a species from the human microbiome.
46. The method of claim 43, wherein the bacteria is E. coli.
47. A recombinant microorganism comprising a heterologous nucleic acid encoding one or more mycosporine-like amino acid (MAA) biosynthetic enzymes, wherein the one or more MAA biosynthetic enzymes comprise a phytanoyl-CoA dioxygenase (MysH), or a homolog thereof.
48. A method of producing a compound, comprising: a) culturing the recombinant microorganism of claim 47 under conditions suitable for production of the compound; and b) isolating the compound from the recombinant microorganism.
49. A composition comprising a compound produced by the method of any one of claims 1-46 or 48 and optionally an excipient.
50. The composition of claim 49, wherein the composition is for topical administration.
51. The composition of claim 49 or 50, wherein the composition is formulated as a sunscreen.
52. The composition of claim 49 or 50, wherein the composition is formulated as a cosmetic.
53. A method of making the composition of any one of claims 49-52, comprising: a) culturing a recombinant microorganism under conditions suitable for production of the compound; b) isolating the compound from the recombinant microorganism, wherein the recombinant microorganism comprises a heterologous nucleic acid encoding one or more mycosporine-like amino acid (MAA) biosynthetic enzymes, wherein the one or more MAA biosynthetic enzymes comprise a phytanoyl-CoA dioxygenase (MysH), or a homolog thereof, and c) adding the compound to one or more excipients to produce the composition.
54. A method of administering a compound, comprising applying the composition of any one of claims 49-52 to a subject.
55. A method of preventing sunburn, comprising applying the composition of any one of claims 49-52 on the skin of a subject in need thereof.
56. A method of preventing cancer, comprising applying the composition of any one of claims 49-52 on the skin of a subject in need thereof.
57. A method of preventing or treating a chronic inflammatory disease, comprising administering the composition of any one of claims 49-52 to a subject in need thereof.
58. A compound produced by: a) culturing a recombinant microorganism under conditions suitable for production of the compound; and b) isolating the compound from the recombinant microorganism, wherein the recombinant microorganism comprises a heterologous nucleic acid encoding one or more mycosporine-like amino acid (MAA) biosynthetic enzymes, wherein the one or more MAA biosynthetic enzymes comprise a phytanoyl-CoA dioxygenase (MysH), or a homolog thereof.
59. The compound of claim 58, wherein the compound is of Formula (I), or a salt thereof: ##STR00053## wherein: each of R.sub.1, R.sub.2, R.sub.3, and R.sub.4 is independently selected from the group consisting of OR.sup.a, (NH)R.sup.b, and N(R.sup.b).sub.2, wherein each instance of R.sup.a is independently hydrogen or optionally substituted C.sub.1-6 alkyl and each instance of R.sup.b is independently hydrogen or optionally substituted C.sub.1-6 alkyl; and R.sub.5 is an amino acid.
60. The compound of claim 59, wherein R.sub.1 is OR.sup.a, wherein R.sup.a is optionally substituted C.sub.1-6 alkyl.
61. The compound of claim 60, wherein R.sub.1 is OCH.sub.3.
62. The compound of any one of claims 59-61, wherein R.sub.2 is NH.sub.2.
63. The compound of any one of claims 59-62, wherein R.sub.3 is OH.
64. The compound of any one of claims 59-63, wherein R.sub.4 is OH.
65. The compound of any one of claims 59-64, wherein R.sub.5 is threonine.
66. The compound of any one of claims 59-65, wherein R.sub.5 is serine.
67. The compound of any one of claims 59-65, wherein R.sub.5 is isoleucine.
68. The compound of any one of claims 59-65, wherein R.sub.5 is methionine.
69. The compound of any one of claims 59-65, wherein, wherein R.sub.5 is valine.
70. The compound of any one of claims 59-69, wherein the compound is of the formula: ##STR00054## or a salt thereof.
71. The compound of claim 58, wherein the compound is of the formula: ##STR00055## or a salt thereof.
72. A composition comprising the compound of any one of claims 58-71, or a salt thereof.
73. The composition of claim 72, wherein the composition is for topical administration.
74. The composition of claim 72 or 73, wherein the composition is formulated as a sunscreen.
75. The composition of claim 72 or 73, wherein the composition is formulated as a cosmetic.
76. A method of administering a compound, comprising applying the composition of any one of claims 72-75 to a subject.
77. A method of preventing sunburn, comprising applying the composition of any one of claims 72-75 on the skin of a subject in need thereof.
78. A method of preventing cancer, comprising applying the composition of any one of claims 72-75 on the skin of a subject in need thereof.
79. A method of treating or preventing a chronic inflammatory disease, comprising applying the composition of any one of claims 72-75 on the skin of a subject in need thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0014] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present disclosure, which can be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
DEFINITIONS
[0058] Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of skill with a general definition of many of the terms used in this invention: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). As used herein, the following terms have the meanings ascribed to them unless specified otherwise.
[0059] Definitions of specific functional groups and chemical terms are described in more detail below. The chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75.sup.th Ed., inside cover, and specific functional groups are generally defined as described therein. Additionally, general principles of organic chemistry, as well as specific functional moieties and reactivity, are described in Thomas Sorrell, Organic Chemistry, University Science Books, Sausalito, 1999; Michael B. Smith, March's Advanced Organic Chemistry, 7.sup.th Edition, John Wiley & Sons, Inc., New York, 2013; Richard C. Larock, Comprehensive Organic Transformations, John Wiley & Sons, Inc., New York, 2018; and Carruthers, Some Modern Methods of Organic Synthesis, 3.sup.rd Edition, Cambridge University Press, Cambridge, 1987.
[0060] Compounds described herein can comprise one or more asymmetric centers, and thus can exist in various stereoisomeric forms, e.g., enantiomers and/or diastereomers. For example, the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer. Isomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high-pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses. See, for example, Jacques et al., Enantiomers, Racemates and Resolutions (Wiley Interscience, New York, 1981); Wilen et al., Tetrahedron 33:2725 (1977); Eliel, E. L. Stereochemistry of Carbon Compounds (McGraw-Hill, NY, 1962); and Wilen, S. H., Tables of Resolving Agents and Optical Resolutions p. 268 (E. L. Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, IN 1972). The invention additionally encompasses compounds as individual isomers substantially free of other isomers, and alternatively, as mixtures of various isomers.
[0061] When a range of values (range) is listed, it encompasses each value and sub-range within the range. A range is inclusive of the values at the two ends of the range unless otherwise provided. For example C.sub.1-6 alkyl encompasses, C.sub.1, C.sub.2, C.sub.3, C.sub.4, C.sub.5, C.sub.6, C.sub.1-6, C.sub.1-5, C.sub.1-4, C.sub.1-3, C.sub.1-2, C.sub.2-6, C.sub.2-5, C.sub.2-4, C.sub.2-3, C.sub.3-6, C.sub.3-5, C.sub.3-4, C.sub.4-6, C.sub.4-5, and C.sub.5-6 alkyl.
[0062] The term aliphatic refers to alkyl, alkenyl, alkynyl, and carbocyclic groups. Likewise, the term heteroaliphatic refers to heteroalkyl, heteroalkenyl, heteroalkynyl, and heterocyclic groups.
[0063] The term alkyl refers to a radical of a straight-chain or branched saturated hydrocarbon group having from 1 to 20 carbon atoms (C.sub.1-20 alkyl). In some embodiments, an alkyl group has 1 to 12 carbon atoms (C.sub.1-12 alkyl). In some embodiments, an alkyl group has 1 to 10 carbon atoms (C.sub.1-10 alkyl). In some embodiments, an alkyl group has 1 to 9 carbon atoms (C.sub.1-9 alkyl). In some embodiments, an alkyl group has 1 to 8 carbon atoms (C.sub.1-8 alkyl). In some embodiments, an alkyl group has 1 to 7 carbon atoms (C.sub.1-7 alkyl). In some embodiments, an alkyl group has 1 to 6 carbon atoms (C.sub.1-6 alkyl). In some embodiments, an alkyl group has 1 to 5 carbon atoms (C.sub.1-5 alkyl). In some embodiments, an alkyl group has 1 to 4 carbon atoms (C.sub.1-4 alkyl). In some embodiments, an alkyl group has 1 to 3 carbon atoms (C.sub.1-3 alkyl). In some embodiments, an alkyl group has 1 to 2 carbon atoms (C.sub.1-2 alkyl). In some embodiments, an alkyl group has 1 carbon atom (C.sub.1 alkyl). In some embodiments, an alkyl group has 2 to 6 carbon atoms (C.sub.2-6 alkyl). Examples of C.sub.1-6 alkyl groups include methyl (C.sub.1), ethyl (C.sub.2), propyl (C.sub.3) (e.g., n-propyl, isopropyl), butyl (C.sub.4) (e.g., n-butyl, tert-butyl, sec-butyl, isobutyl), pentyl (C.sub.5) (e.g., n-pentyl, 3-pentanyl, amyl, neopentyl, 3-methyl-2-butanyl, tert-amyl), and hexyl (C.sub.6) (e.g., n-hexyl). Additional examples of alkyl groups include n-heptyl (C.sub.7), n-octyl (C.sub.8), n-dodecyl (C.sub.12), and the like. Unless otherwise specified, each instance of an alkyl group is independently unsubstituted (an unsubstituted alkyl) or substituted (a substituted alkyl) with one or more substituents (e.g., halogen, such as F). In certain embodiments, the alkyl group is an unsubstituted C.sub.1-12 alkyl (such as unsubstituted C.sub.1-6 alkyl, e.g., CH.sub.3 (Me), unsubstituted ethyl (Et), unsubstituted propyl (Pr, e.g., unsubstituted n-propyl (n-Pr), unsubstituted isopropyl (i-Pr)), unsubstituted butyl (Bu, e.g., unsubstituted n-butyl (n-Bu), unsubstituted tert-butyl (tert-Bu or t-Bu), unsubstituted sec-butyl (sec-Bu or s-Bu), unsubstituted isobutyl (i-Bu)). In certain embodiments, the alkyl group is a substituted C.sub.1-12 alkyl (such as substituted C.sub.1-6 alkyl, e.g., CH.sub.2F, CHF.sub.2, CF.sub.3, CH.sub.2CH.sub.2F, CH.sub.2CHF.sub.2, CH.sub.2CF.sub.3, or benzyl (Bn)).
[0064] The term haloalkyl is a substituted alkyl group, wherein one or more of the hydrogen atoms are independently replaced by a halogen, e.g., fluoro, bromo, chloro, or iodo. Perhaloalkyl is a subset of haloalkyl and refers to an alkyl group wherein all of the hydrogen atoms are independently replaced by a halogen, e.g., fluoro, bromo, chloro, or iodo. In some embodiments, the haloalkyl moiety has 1 to 20 carbon atoms (C.sub.1-20 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 10 carbon atoms (C.sub.1-10 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 9 carbon atoms (C.sub.1-9 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 8 carbon atoms (C.sub.1-8 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 7 carbon atoms (C.sub.1-7 haloalkyl).In some embodiments, the haloalkyl moiety has 1 to 6 carbon atoms (C.sub.1-6 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 5 carbon atoms (C.sub.1-5 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 4 carbon atoms (C.sub.1-4 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 3 carbon atoms (C.sub.1-3 haloalkyl). In some embodiments, the haloalkyl moiety has 1 to 2 carbon atoms (C.sub.1-2 haloalkyl). In some embodiments, all of the haloalkyl hydrogen atoms are independently replaced with fluoro to provide a perfluoroalkyl group. In some embodiments, all of the haloalkyl hydrogen atoms are independently replaced with chloro to provide a perchloroalkyl group. Examples of haloalkyl groups include CHF.sub.2, CH.sub.2F, CF.sub.3, CH.sub.2CF.sub.3, CF.sub.2CF.sub.3, CF.sub.2CF.sub.2CF.sub.3, CCl.sub.3, CFCl.sub.2, CF.sub.2Cl, and the like.
[0065] The term heteroalkyl refers to an alkyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (e.g., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkyl group refers to a saturated group having from 1 to 20 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-20 alkyl). In certain embodiments, a heteroalkyl group refers to a saturated group having from 1 to 12 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-12 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 11 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-11 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 10 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-10 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 9 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-9 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 8 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-8 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 7 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-7 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 6 carbon atoms and 1 or more heteroatoms within the parent chain (heteroC.sub.1-6 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 5 carbon atoms and 1 or 2 heteroatoms within the parent chain (heteroC.sub.1-5 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 4 carbon atoms and 1 or 2 heteroatoms within the parent chain (heteroC.sub.1-4 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 3 carbon atoms and 1 heteroatom within the parent chain (heteroC.sub.1-3 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 to 2 carbon atoms and 1 heteroatom within the parent chain (heteroC.sub.1-2 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 1 carbon atom and 1 heteroatom (heteroC.sub.1 alkyl). In some embodiments, a heteroalkyl group is a saturated group having 2 to 6 carbon atoms and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-6 alkyl). Unless otherwise specified, each instance of a heteroalkyl group is independently unsubstituted (an unsubstituted heteroalkyl) or substituted (a substituted heteroalkyl) with one or more substituents. In certain embodiments, the heteroalkyl group is an unsubstituted heteroC.sub.1-12 alkyl. In certain embodiments, the heteroalkyl group is a substituted heteroC.sub.1-12 alkyl.
[0066] The term alkenyl refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 20 carbon atoms and one or more carbon-carbon double bonds (e.g., 1, 2, 3, or 4 double bonds). In some embodiments, an alkenyl group has 2 to 20 carbon atoms (C.sub.2-20 alkenyl). In some embodiments, an alkenyl group has 2 to 12 carbon atoms (C.sub.2-12 alkenyl). In some embodiments, an alkenyl group has 2 to 11 carbon atoms (C.sub.2-11 alkenyl). In some embodiments, an alkenyl group has 2 to 10 carbon atoms (C.sub.2-10 alkenyl). In some embodiments, an alkenyl group has 2 to 9 carbon atoms (C.sub.2-9 alkenyl). In some embodiments, an alkenyl group has 2 to 8 carbon atoms (C.sub.2-8 alkenyl). In some embodiments, an alkenyl group has 2 to 7 carbon atoms (C.sub.2-7 alkenyl). In some embodiments, an alkenyl group has 2 to 6 carbon atoms (C.sub.2-6 alkenyl). In some embodiments, an alkenyl group has 2 to 5 carbon atoms (C.sub.2-5 alkenyl). In some embodiments, an alkenyl group has 2 to 4 carbon atoms (C.sub.2-4 alkenyl). In some embodiments, an alkenyl group has 2 to 3 carbon atoms (C.sub.2-3 alkenyl). In some embodiments, an alkenyl group has 2 carbon atoms (C.sub.2 alkenyl). The one or more carbon-carbon double bonds can be internal (such as in 2-butenyl) or terminal (such as in 1-butenyl). Examples of C.sub.2-4 alkenyl groups include ethenyl (C.sub.2), 1-propenyl (C.sub.3), 2-propenyl (C.sub.3), 1-butenyl (C.sub.4), 2-butenyl (C.sub.4), butadienyl (C.sub.4), and the like. Examples of C.sub.2-6 alkenyl groups include the aforementioned C.sub.2-4 alkenyl groups as well as pentenyl (C.sub.5), pentadienyl (C.sub.5), hexenyl (C.sub.6), and the like. Additional examples of alkenyl include heptenyl (C.sub.7), octenyl (C.sub.8), octatrienyl (C.sub.8), and the like. Unless otherwise specified, each instance of an alkenyl group is independently unsubstituted (an unsubstituted alkenyl) or substituted (a substituted alkenyl) with one or more substituents. In certain embodiments, the alkenyl group is an unsubstituted C.sub.2-20 alkenyl. In certain embodiments, the alkenyl group is a substituted C.sub.2-20 alkenyl. In an alkenyl group, a CC double bond for which the stereochemistry is not specified (e.g., CHCHCH.sub.3 or
##STR00003##
may be in the (E)- or (Z)-configuration.
[0067] The term heteroalkenyl refers to an alkenyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (e.g., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkenyl group refers to a group having from 2 to 20 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-20 alkenyl). In certain embodiments, a heteroalkenyl group refers to a group having from 2 to 12 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-12 alkenyl). In certain embodiments, a heteroalkenyl group refers to a group having from 2 to 11 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-11 alkenyl). In certain embodiments, a heteroalkenyl group refers to a group having from 2 to 10 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-10 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 9 carbon atoms at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-9 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 8 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-8 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 7 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-7 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-6 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 5 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-5 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 4 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-4 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 3 carbon atoms, at least one double bond, and 1 heteroatom within the parent chain (heteroC.sub.2-3 alkenyl). In some embodiments, a heteroalkenyl group has 2 carbon atoms, at least one double bond, and 1 heteroatom within the parent chain (heteroC.sub.2 alkenyl). In some embodiments, a heteroalkenyl group has 2 to 6 carbon atoms, at least one double bond, and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-6 alkenyl). Unless otherwise specified, each instance of a heteroalkenyl group is independently unsubstituted (an unsubstituted heteroalkenyl) or substituted (a substituted heteroalkenyl) with one or more substituents. In certain embodiments, the heteroalkenyl group is an unsubstituted heteroC.sub.2-20 alkenyl. In certain embodiments, the heteroalkenyl group is a substituted heteroC.sub.2-20 alkenyl.
[0068] The term alkynyl refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 20 carbon atoms and one or more carbon-carbon triple bonds (e.g., 1, 2, 3, or 4 triple bonds) (C.sub.1-20 alkynyl). In some embodiments, an alkynyl group has 2 to 10 carbon atoms (C.sub.2-10 alkynyl). In some embodiments, an alkynyl group has 2 to 9 carbon atoms (C.sub.2-9 alkynyl). In some embodiments, an alkynyl group has 2 to 8 carbon atoms (C.sub.2-8 alkynyl). In some embodiments, an alkynyl group has 2 to 7 carbon atoms (C.sub.2-7 alkynyl). In some embodiments, an alkynyl group has 2 to 6 carbon atoms (C.sub.2-6 alkynyl). In some embodiments, an alkynyl group has 2 to 5 carbon atoms (C.sub.2-5 alkynyl). In some embodiments, an alkynyl group has 2 to 4 carbon atoms (C.sub.2-4 alkynyl). In some embodiments, an alkynyl group has 2 to 3 carbon atoms (C.sub.2-3 alkynyl). In some embodiments, an alkynyl group has 2 carbon atoms (C.sub.2 alkynyl). The one or more carbon-carbon triple bonds can be internal (such as in 2-butynyl) or terminal (such as in 1-butynyl). Examples of C.sub.2-4 alkynyl groups include, without limitation, ethynyl (C.sub.2), 1-propynyl (C.sub.3), 2-propynyl (C.sub.3), 1-butynyl (C.sub.4), 2-butynyl (C.sub.4), and the like. Examples of C.sub.2-6 alkenyl groups include the aforementioned C.sub.2-4 alkynyl groups as well as pentynyl (C.sub.5), hexynyl (C.sub.6), and the like. Additional examples of alkynyl include heptynyl (C.sub.7), octynyl (C.sub.8), and the like. Unless otherwise specified, each instance of an alkynyl group is independently unsubstituted (an unsubstituted alkynyl) or substituted (a substituted alkynyl) with one or more substituents. In certain embodiments, the alkynyl group is an unsubstituted C.sub.2-20 alkynyl. In certain embodiments, the alkynyl group is a substituted C.sub.2-20 alkynyl.
[0069] The term heteroalkynyl refers to an alkynyl group, which further includes at least one heteroatom (e.g., 1, 2, 3, or 4 heteroatoms) selected from oxygen, nitrogen, or sulfur within (e.g., inserted between adjacent carbon atoms of) and/or placed at one or more terminal position(s) of the parent chain. In certain embodiments, a heteroalkynyl group refers to a group having from 2 to 20 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-20 alkynyl). In certain embodiments, a heteroalkynyl group refers to a group having from 2 to 10 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-10 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 9 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-9 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 8 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-8 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 7 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-7 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or more heteroatoms within the parent chain (heteroC.sub.2-6 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 5 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-5 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 4 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-4 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 3 carbon atoms, at least one triple bond, and 1 heteroatom within the parent chain (heteroC.sub.2-3 alkynyl). In some embodiments, a heteroalkynyl group has 2 carbon atoms, at least one triple bond, and 1 heteroatom within the parent chain (heteroC.sub.2 alkynyl). In some embodiments, a heteroalkynyl group has 2 to 6 carbon atoms, at least one triple bond, and 1 or 2 heteroatoms within the parent chain (heteroC.sub.2-6 alkynyl). Unless otherwise specified, each instance of a heteroalkynyl group is independently unsubstituted (an unsubstituted heteroalkynyl) or substituted (a substituted heteroalkynyl) with one or more substituents. In certain embodiments, the heteroalkynyl group is an unsubstituted heteroC.sub.2-20 alkynyl. In certain embodiments, the heteroalkynyl group is a substituted heteroC.sub.2-20 alkynyl.
[0070] The term carbocyclyl or carbocyclic refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 14 ring carbon atoms (C.sub.3-14 carbocyclyl) and zero heteroatoms in the non-aromatic ring system. In some embodiments, a carbocyclyl group has 3 to 14 ring carbon atoms (C.sub.3-14 carbocyclyl). In some embodiments, a carbocyclyl group has 3 to 13 ring carbon atoms (C.sub.3-13 carbocyclyl). In some embodiments, a carbocyclyl group has 3 to 12 ring carbon atoms (C.sub.3-12 carbocyclyl). In some embodiments, a carbocyclyl group has 3 to 11 ring carbon atoms (C.sub.3-11 carbocyclyl). In some embodiments, a carbocyclyl group has 3 to 10 ring carbon atoms (C.sub.3-10 carbocyclyl). In some embodiments, a carbocyclyl group has 3 to 8 ring carbon atoms (C.sub.3-8 carbocyclyl). In some embodiments, a carbocyclyl group has 3 to 7 ring carbon atoms (C.sub.3-7 carbocyclyl). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms (C.sub.3-6 carbocyclyl). In some embodiments, a carbocyclyl group has 4 to 6 ring carbon atoms (C.sub.4-6 carbocyclyl). In some embodiments, a carbocyclyl group has 5 to 6 ring carbon atoms (C.sub.5-6 carbocyclyl). In some embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms (C.sub.5-10 carbocyclyl). Exemplary C.sub.3-6 carbocyclyl groups include cyclopropyl (C.sub.3), cyclopropenyl (C.sub.3), cyclobutyl (C.sub.4), cyclobutenyl (C.sub.4), cyclopentyl (C.sub.5), cyclopentenyl (C.sub.5), cyclohexyl (C.sub.6), cyclohexenyl (C.sub.6), cyclohexadienyl (C.sub.6), and the like. Exemplary C.sub.3-8 carbocyclyl groups include the aforementioned C.sub.3-6 carbocyclyl groups as well as cycloheptyl (C.sub.7), cycloheptenyl (C.sub.7), cycloheptadienyl (C.sub.7), cycloheptatrienyl (C.sub.7), cyclooctyl (C.sub.8), cyclooctenyl (C.sub.8), bicyclo[2.2.1]heptanyl (C.sub.7), bicyclo[2.2.2]octanyl (C.sub.8), and the like. Exemplary C.sub.3-10 carbocyclyl groups include the aforementioned C.sub.3-8 carbocyclyl groups as well as cyclononyl (C.sub.9), cyclononenyl (C.sub.9), cyclodecyl (C.sub.10), cyclodecenyl (C.sub.10), octahydro-1H-indenyl (C.sub.9), decahydronaphthalenyl (C.sub.10), spiro[4.5]decanyl (C.sub.10), and the like. Exemplary C.sub.3-8 carbocyclyl groups include the aforementioned C.sub.3-10 carbocyclyl groups as well as cycloundecyl (C.sub.11), spiro[5.5]undecanyl (C.sub.11), cyclododecyl (C.sub.12), cyclododecenyl (C.sub.12), cyclotridecane (C.sub.13), cyclotetradecane (C.sub.14), and the like. As the foregoing examples illustrate, in certain embodiments, the carbocyclyl group is either monocyclic (monocyclic carbocyclyl) or polycyclic (e.g., containing a fused, bridged or spiro ring system such as a bicyclic system (bicyclic carbocyclyl) or tricyclic system (tricyclic carbocyclyl)) and can be saturated or can contain one or more carbon-carbon double or triple bonds. Carbocyclyl also includes ring systems wherein the carbocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups wherein the point of attachment is on the carbocyclyl ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocyclic ring system. Unless otherwise specified, each instance of a carbocyclyl group is independently unsubstituted (an unsubstituted carbocyclyl) or substituted (a substituted carbocyclyl) with one or more substituents. In certain embodiments, the carbocyclyl group is an unsubstituted C.sub.3-14 carbocyclyl. In certain embodiments, the carbocyclyl group is a substituted C.sub.3-14 carbocyclyl.
[0071] In some embodiments, carbocyclyl is a monocyclic, saturated carbocyclyl group having from 3 to 14 ring carbon atoms (C.sub.3-14 cycloalkyl). In some embodiments, a cycloalkyl group has 3 to 10 ring carbon atoms (C.sub.3-10 cycloalkyl). In some embodiments, a cycloalkyl group has 3 to 8 ring carbon atoms (C.sub.3-8 cycloalkyl). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms (C.sub.3-6 cycloalkyl). In some embodiments, a cycloalkyl group has 4 to 6 ring carbon atoms (C.sub.4-6 cycloalkyl). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms (C.sub.5-6 cycloalkyl). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms (C.sub.5-10 cycloalkyl). Examples of C.sub.5-6 cycloalkyl groups include cyclopentyl (C.sub.5) and cyclohexyl (C.sub.5). Examples of C.sub.3-6 cycloalkyl groups include the aforementioned C.sub.5-6 cycloalkyl groups as well as cyclopropyl (C.sub.3) and cyclobutyl (C.sub.4). Examples of C.sub.3-8 cycloalkyl groups include the aforementioned C.sub.3-6 cycloalkyl groups as well as cycloheptyl (C.sub.7) and cyclooctyl (C.sub.8). Unless otherwise specified, each instance of a cycloalkyl group is independently unsubstituted (an unsubstituted cycloalkyl) or substituted (a substituted cycloalkyl) with one or more substituents. In certain embodiments, the cycloalkyl group is an unsubstituted C.sub.3-14 cycloalkyl. In certain embodiments, the cycloalkyl group is a substituted C.sub.3-14 cycloalkyl. In certain embodiments, the carbocyclyl includes 0, 1, or 2 CC double bonds in the carbocyclic ring system, as valency permits.
[0072] The term heterocyclyl or heterocyclic refers to a radical of a 3- to 14-membered non-aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (3-14 membered heterocyclyl). In heterocyclyl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. A heterocyclyl group can either be monocyclic (monocyclic heterocyclyl) or polycyclic (e.g., a fused, bridged or spiro ring system such as a bicyclic system (bicyclic heterocyclyl) or tricyclic system (tricyclic heterocyclyl)), and can be saturated or can contain one or more carbon-carbon double or triple bonds. Heterocyclyl polycyclic ring systems can include one or more heteroatoms in one or both rings. Heterocyclyl also includes ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more carbocyclyl groups wherein the point of attachment is either on the carbocyclyl or heterocyclyl ring, or ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclyl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclyl ring system. Unless otherwise specified, each instance of heterocyclyl is independently unsubstituted (an unsubstituted heterocyclyl) or substituted (a substituted heterocyclyl) with one or more substituents. In certain embodiments, the heterocyclyl group is an unsubstituted 3-14 membered heterocyclyl. In certain embodiments, the heterocyclyl group is a substituted 3-14 membered heterocyclyl. In certain embodiments, the heterocyclyl is substituted or unsubstituted, 3- to 7-membered, monocyclic heterocyclyl, wherein 1, 2, or 3 atoms in the heterocyclic ring system are independently oxygen, nitrogen, or sulfur, as valency permits.
[0073] In some embodiments, a heterocyclyl group is a 5-10 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-10 membered heterocyclyl). In some embodiments, a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-8 membered heterocyclyl). In some embodiments, a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-6 membered heterocyclyl). In some embodiments, the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur.
[0074] Exemplary 3-membered heterocyclyl groups containing 1 heteroatom include azirdinyl, oxiranyl, and thiiranyl. Exemplary 4-membered heterocyclyl groups containing 1 heteroatom include azetidinyl, oxetanyl, and thietanyl. Exemplary 5-membered heterocyclyl groups containing 1 heteroatom include tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, and pyrrolyl-2,5-dione. Exemplary 5-membered heterocyclyl groups containing 2 heteroatoms include dioxolanyl, oxathiolanyl and dithiolanyl. Exemplary 5-membered heterocyclyl groups containing 3 heteroatoms include triazolinyl, oxadiazolinyl, and thiadiazolinyl. Exemplary 6-membered heterocyclyl groups containing 1 heteroatom include piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include piperazinyl, morpholinyl, dithianyl, and dioxanyl. Exemplary 6-membered heterocyclyl groups containing 3 heteroatoms include triazinyl. Exemplary 7-membered heterocyclyl groups containing 1 heteroatom include azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl groups containing 1 heteroatom include azocanyl, oxecanyl and thiocanyl. Exemplary bicyclic heterocyclyl groups include indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, tetra-hydrobenzothienyl, tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, octahydrochromenyl, octahydroisochromenyl, decahydronaphthyridinyl, decahydro-1,8-naphthyridinyl, octahydropyrrolo[3,2-b]pyrrole, indolinyl, phthalimidyl, naphthalimidyl, chromanyl, chromenyl, 1H-benzo[e][1,4]diazepinyl, 1,4,5,7-tetrahydropyrano[3,4-b]pyrrolyl, 5,6-dihydro-4H-furo[3,2-b]pyrrolyl, 6,7-dihydro-5H-furo[3,2-b]pyranyl, 5,7-dihydro-4H-thieno[2,3-c]pyranyl, 2,3-dihydro-1H-pyrrolo[2,3-b]pyridinyl, 2,3-dihydrofuro[2,3-b]pyridinyl, 4,5,6,7-tetrahydro-1H-pyrrolo[2,3-b]pyridinyl, 4,5,6,7-tetrahydrofuro[3,2-c]pyridinyl, 4,5,6,7-tetrahydrothieno[3,2-b]pyridinyl, 1,2,3,4-tetrahydro-1,6-naphthyridinyl, and the like.
[0075] The term aryl refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system (C.sub.6-14 aryl). In some embodiments, an aryl group has 6 ring carbon atoms (C.sub.6 aryl; e.g., phenyl). In some embodiments, an aryl group has 10 ring carbon atoms (C.sub.10 aryl; e.g., naphthyl such as 1-naphthyl and 2-naphthyl). In some embodiments, an aryl group has 14 ring carbon atoms (C.sub.14 aryl; e.g., anthracyl). Aryl also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the aryl ring system. Unless otherwise specified, each instance of an aryl group is independently unsubstituted (an unsubstituted aryl) or substituted (a substituted aryl) with one or more substituents. In certain embodiments, the aryl group is an unsubstituted C.sub.6-14 aryl. In certain embodiments, the aryl group is a substituted C.sub.6-14 aryl.
[0076] Aralkyl is a subset of alkyl and refers to an alkyl group substituted by an aryl group, wherein the point of attachment is on the alkyl moiety.
[0077] The term heteroaryl refers to a radical of a 5-14 membered monocyclic or polycyclic (e.g., bicyclic, tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-14 membered heteroaryl). In heteroaryl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. Heteroaryl polycyclic ring systems can include one or more heteroatoms in one or both rings. Heteroaryl includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system. Heteroaryl also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused polycyclic (aryl/heteroaryl) ring system. Polycyclic heteroaryl groups wherein one ring does not contain a heteroatom (e.g., indolyl, quinolinyl, carbazolyl, and the like) the point of attachment can be on either ring, e.g., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5-indolyl). In certain embodiments, the heteroaryl is substituted or unsubstituted, 5- or 6-membered, monocyclic heteroaryl, wherein 1, 2, 3, or 4 atoms in the heteroaryl ring system are independently oxygen, nitrogen, or sulfur. In certain embodiments, the heteroaryl is substituted or unsubstituted, 9- or 10-membered, bicyclic heteroaryl, wherein 1, 2, 3, or 4 atoms in the heteroaryl ring system are independently oxygen, nitrogen, or sulfur.
[0078] In some embodiments, a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-10 membered heteroaryl). In some embodiments, a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-8 membered heteroaryl). In some embodiments, a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (5-6 membered heteroaryl). In some embodiments, the 5-6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur. Unless otherwise specified, each instance of a heteroaryl group is independently unsubstituted (an unsubstituted heteroaryl) or substituted (a substituted heteroaryl) with one or more substituents. In certain embodiments, the heteroaryl group is an unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is a substituted 5-14 membered heteroaryl.
[0079] Exemplary 5-membered heteroaryl groups containing 1 heteroatom include pyrrolyl, furanyl, and thiophenyl. Exemplary 5-membered heteroaryl groups containing 2 heteroatoms include imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl. Exemplary 5-membered heteroaryl groups containing 3 heteroatoms include triazolyl, oxadiazolyl, and thiadiazolyl. Exemplary 5-membered heteroaryl groups containing 4 heteroatoms include tetrazolyl. Exemplary 6-membered heteroaryl groups containing 1 heteroatom include pyridinyl. Exemplary 6-membered heteroaryl groups containing 2 heteroatoms include pyridazinyl, pyrimidinyl, and pyrazinyl. Exemplary 6-membered heteroaryl groups containing 3 or 4 heteroatoms include triazinyl and tetrazinyl, respectively. Exemplary 7-membered heteroaryl groups containing 1 heteroatom include azepinyl, oxepinyl, and thiepinyl. Exemplary 5,6-bicyclic heteroaryl groups include indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl. Exemplary 6,6-bicyclic heteroaryl groups include naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl. Exemplary tricyclic heteroaryl groups include phenanthridinyl, dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl, and phenazinyl.
[0080] Heteroaralkyl is a subset of alkyl and refers to an alkyl group substituted by a heteroaryl group, wherein the point of attachment is on the alkyl moiety.
[0081] The term unsaturated bond refers to a double or triple bond.
[0082] The term unsaturated or partially unsaturated refers to a moiety that includes at least one double or triple bond.
[0083] The term saturated or fully saturated refers to a moiety that does not contain a double or triple bond, e.g., the moiety only contains single bonds.
[0084] Affixing the suffix -ene to a group indicates the group is a divalent moiety, e.g., alkylene is the divalent moiety of alkyl, alkenylene is the divalent moiety of alkenyl, alkynylene is the divalent moiety of alkynyl, heteroalkylene is the divalent moiety of heteroalkyl, heteroalkenylene is the divalent moiety of heteroalkenyl, heteroalkynylene is the divalent moiety of heteroalkynyl, carbocyclylene is the divalent moiety of carbocyclyl, heterocyclylene is the divalent moiety of heterocyclyl, arylene is the divalent moiety of aryl, and heteroarylene is the divalent moiety of heteroaryl.
[0085] A group is optionally substituted unless expressly provided otherwise. The term optionally substituted refers to being substituted or unsubstituted. In certain embodiments, alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups are optionally substituted. Optionally substituted refers to a group which is substituted or unsubstituted (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted heteroalkenyl, substituted or unsubstituted heteroalkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl or substituted or unsubstituted heteroaryl group). In general, the term substituted means that at least one hydrogen present on a group is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction. Unless otherwise indicated, a substituted group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position. The term substituted is contemplated to include substitution with all permissible substituents of organic compounds and includes any of the substituents described herein that results in the formation of a stable compound. The present invention contemplates any and all such combinations in order to arrive at a stable compound. For purposes of this invention, heteroatoms such as nitrogen may have hydrogen substituents and/or any suitable substituent as described herein which satisfy the valencies of the heteroatoms and results in the formation of a stable moiety. The invention is not limited in any manner by the exemplary substituents described herein.
[0086] Exemplary carbon atom substituents include halogen, CN, NO.sub.2, N.sub.3, SO.sub.2H, SO.sub.3H, OH, OR.sup.aa, ON(R.sup.bb).sub.2, N(R.sup.bb).sub.2, N(R.sup.bb).sub.3.sup.+X.sup., N(OR.sup.cc)R.sup.bb, SH, SR.sup.aa, SSR.sup.cc, C(O)R.sup.aa, CO.sub.2H, CHO, C(OR.sup.cc).sub.2, CO.sub.2R.sup.aa, OC(O)R.sup.aa, OCO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, OC(O)N(R.sup.bb).sub.2, NR.sup.bbC(O)R.sup.aa, NR.sup.bbCO.sub.2R.sup.aa, NR.sup.bbC(O)N(R.sup.bb).sub.2, C(NR.sup.bb)R.sup.aa, C(NR.sup.bb)OR.sup.aa, OC(NR.sup.bb)R.sup.aa, OC(NR.sup.bb)OR.sup.aa, C(NR.sup.bb)N(R.sup.bb).sub.2, OC(NR.sup.bb)N(R.sup.bb).sub.2, NR.sup.bbC(NR.sup.bb)N(R.sup.bb).sub.2, C(O)NR.sup.bbSO.sub.2R.sup.aa, NR.sup.bbSO.sub.2R.sup.aa, SO.sub.2N(R.sup.bb).sub.2, SO.sub.2R.sup.aa, SO.sub.2OR.sup.aa, OSO.sub.2R.sup.aa, S(O)R.sup.aa, OS(O)R.sup.aa, Si(R.sup.aa).sub.3, OSi(R.sup.aa).sub.3 C(S)N(R.sup.bb).sub.2, C(O)SR.sup.aa, C(S)SR.sup.aa, SC(S)SR.sup.aa, SC(O)SR.sup.aa, OC(O)SR.sup.aa, SC(O)OR.sup.aa, SC(O)R.sup.aa, P(O)(R.sup.aa).sub.2, P(O)(OR.sup.cc).sub.2, OP(O)(R.sup.aa).sub.2, OP(O)(OR.sup.ccC).sub.2, P(O)(N(R.sup.bb).sub.2).sub.2, OP(O)(N(R.sup.bb).sub.2).sub.2, NR.sup.bbP(O)(R.sup.aa).sub.2, NR.sup.bbP(O)(OR.sup.cc).sub.2, NR.sup.bbP(O)(N(R.sup.bb).sub.2).sub.2, P(R.sup.cc).sub.2, P(OR.sup.cc).sub.2, P(R.sup.cc).sub.3.sup.+X.sup., P(OR.sup.cc).sub.3.sup.+X.sup., P(R.sup.cc).sub.4, P(OR.sup.cc).sub.4, OP(R.sup.cc).sub.2, OP(R.sup.cc).sub.3.sup.+X.sup., OP(OR.sup.cc).sub.2, OP(OR.sup.cc).sub.3.sup.+X.sup., OP(R.sup.cc).sub.4, OP(OR.sup.cc).sub.4, B(R.sup.aa).sub.2, B(OR.sup.cc).sub.2, BR.sup.aa(OR.sup.cc), C.sub.1-20 alkyl, C.sub.1-20 perhaloalkyl, C.sub.1-20 alkenyl, C.sub.1-20 alkynyl, heteroC.sub.1-20 alkyl, heteroC.sub.1-20 alkenyl, heteroC.sub.1-20 alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups; wherein X.sup. is a counterion; [0087] or two geminal hydrogens on a carbon atom are replaced with the group O, S, NN(R.sup.bb).sub.2, NNR.sup.bbC(O)R.sup.aa, NNR.sup.bbC(O)OR.sup.aa, NNR.sup.bbS(O).sub.2R.sup.aa, NR.sup.bb, or NOR.sup.cc; [0088] wherein: [0089] each instance of R.sup.aa is, independently, selected from C.sub.1-20 alkyl, C.sub.1-20 perhaloalkyl, C.sub.1-20 alkenyl, C.sub.1-20 alkynyl, heteroC.sub.1-20 alkyl, heteroC.sub.1-20alkenyl, heteroC.sub.1-20alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two R.sup.aa groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each of the alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups; [0090] each instance of R.sup.bb is, independently, selected from hydrogen, OH, OR.sup.aa, N(R.sup.c).sub.2, CN, C(O)R.sup.aa, C(O)N(R.sup.cc).sub.2, CO.sub.2R.sup.aa, SO.sub.2R.sup.aa, C(NR.sup.cc)OR.sup.aa, C(NR.sup.cc)N(R.sup.cc).sub.2, SO.sub.2N(R.sup.cc).sub.2, SO.sub.2R.sup.cc, SO.sub.2OR.sup.cc, SOR.sup.aa, C(S)N(R.sup.cc).sub.2, C(O)SR.sup.cc, C(S)SR.sup.cc, P(O)(R.sup.aa).sub.2, P(O)(OR.sup.cc).sub.2, P(O)(N(R.sup.cc).sub.2).sub.2, C.sub.1-20 alkyl, C.sub.1-20 perhaloalkyl, C.sub.1-20 alkenyl, C.sub.1-20 alkynyl, heteroC.sub.1-20alkyl, heteroC.sub.1-20alkenyl, heteroC.sub.1-20alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two R.sup.bb groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups; [0091] each instance of R.sup.cc is, independently, selected from hydrogen, C.sub.1-20 alkyl, C.sub.1-20 perhaloalkyl, C.sub.1-20 alkenyl, C.sub.1-20 alkynyl, heteroC.sub.1-20 alkyl, heteroC.sub.1-20 alkenyl, heteroC.sub.1-20 alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two R.sup.cc groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups; [0092] each instance of R.sup.dd is, independently, selected from halogen, CN, NO.sub.2, N.sub.3, SO.sub.2H, SO.sub.3H, OH, OR.sup.ee, ON(R.sup.ff).sub.2, N(R.sup.ff).sub.2, N(R.sup.ff).sub.3.sup.+X.sup., N(OR.sup.ee)R.sup.ff, SH, SR.sup.ee, SSR.sup.ee, C(O)R.sup.ee, CO.sub.2H, CO.sub.2R.sup.ee, OC(O)R.sup.ee, OCO.sub.2R.sup.ee, C(O)N(R.sup.ff).sub.2, OC(O)N(R.sup.ff).sub.2, NR.sup.ffC(O)R.sup.ee, NR.sup.ffCO.sub.2R.sup.ee, NR.sup.ffC(O)N(R.sup.ff).sub.2, C(NR.sup.ff)OR.sup.ee, OC(NR.sup.ff)R.sup.ee, OC(NR.sup.ff)OR.sup.ee, C(NR.sup.ff)N(R.sup.ff).sub.2, OC(NR.sup.ff)N(R.sup.ff).sub.2, NR.sup.ffC(NR.sup.ff)N(R.sup.ff).sub.2, NR.sup.ffSO.sub.2R.sup.ee, SO.sub.2N(R.sup.ff).sub.2, SO.sub.2R.sup.ee, SO.sub.2OR.sup.ee, OSO.sub.2R.sup.ee, S(O)R.sup.ee, Si(R.sup.ee).sub.3, OSi(R.sup.ee).sub.3, C(S)N(R.sup.ff).sub.2, C(O)SR.sup.ee, C(S)SR.sup.ee, SC(S)SR.sup.ee, P(O)(OR.sup.ee).sub.2, P(O)(R.sup.ee).sub.2, OP(O)(R.sup.ee).sub.2, OP(O)(OR.sup.ee).sub.2, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.1-10 alkenyl, C.sub.1-10 alkynyl, heteroC.sub.1-10alkyl, heteroC.sub.1-10alkenyl, heteroC.sub.1-10alkynyl, C.sub.3-10 carbocyclyl, 3-10 membered heterocyclyl, C.sub.6-10 aryl, and 5-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.gg groups, or two geminal R.sup.dd substituents are joined to form O or S; wherein X.sup. is a counterion; [0093] each instance of R.sup.ee is, independently, selected from C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.1-10 alkenyl, C.sub.1-10 alkynyl, heteroC.sub.1-10 alkyl, heteroC.sub.1-10 alkenyl, heteroC.sub.1-10 alkynyl, C.sub.3-10 carbocyclyl, C.sub.6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.gg groups; [0094] each instance of R.sup.ff is, independently, selected from hydrogen, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.1-10 alkenyl, C.sub.1-10 alkynyl, heteroC.sub.1-10 alkyl, heteroC.sub.1-10 alkenyl, heteroC.sub.1-10 alkynyl, C.sub.3-10 carbocyclyl, 3-10 membered heterocyclyl, C.sub.6-10 aryl, and 5-10 membered heteroaryl, or two R.sup.ff groups are joined to form a 3-10 membered heterocyclyl or 5-10 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.gg groups; [0095] each instance of R.sup.gg is, independently, halogen, CN, NO.sub.2, N.sub.3, SO.sub.2H, SO.sub.3H, OH, OC.sub.1-6 alkyl, ON(C.sub.1-6 alkyl).sub.2, N(C.sub.1-6 alkyl).sub.2, N(C.sub.1-6 alkyl).sub.3.sup.+X.sup., NH(C.sub.1-6 alkyl).sub.2.sup.+X.sup., NH.sub.2(C.sub.1-6 alkyl).sup.+X.sup., NH.sub.3.sup.+X.sup., N(OC.sub.1-6 alkyl)(C.sub.1-6 alkyl), N(OH)(C.sub.1-6 alkyl), NH(OH), SH, SC.sub.1-6 alkyl, SS(C.sub.1-6 alkyl), C(O)(C.sub.1-6 alkyl), CO.sub.2H, CO.sub.2(C.sub.1-6 alkyl), OC(O)(C.sub.1-6 alkyl), OCO.sub.2(C.sub.1-6 alkyl), C(O)NH.sub.2, C(O)N(C.sub.1-6 alkyl).sub.2, OC(O)NH(C.sub.1-6 alkyl), NHC(O)(C.sub.1-6 alkyl), N(C.sub.1-6 alkyl)C(O)(C.sub.1-6 alkyl), NHCO.sub.2(C.sub.1-6 alkyl), NHC(O)N(C.sub.1-6 alkyl).sub.2, NHC(O)NH(C.sub.1-6 alkyl), NHC(O)NH.sub.2, C(NH)O(C.sub.1-6 alkyl), OC(NH)(C.sub.1-6 alkyl), OC(NH)OC.sub.1-6 alkyl, C(NH)N(C.sub.1-6 alkyl).sub.2, C(NH)NH(C.sub.1-6 alkyl), C(NH)NH.sub.2, OC(NH)N(C.sub.1-6 alkyl).sub.2, OC(NH)NH(C.sub.1-6 alkyl), OC(NH)NH.sub.2, NHC(NH)N(C.sub.1-6 alkyl).sub.2, NHC(NH)NH.sub.2, NHSO.sub.2(C.sub.1-6 alkyl), SO.sub.2N(C.sub.1-6 alkyl).sub.2, SO.sub.2NH(C.sub.1-6 alkyl), SO.sub.2NH.sub.2, SO.sub.2C.sub.1-6 alkyl, SO.sub.2OC.sub.1-6 alkyl, OSO.sub.2C.sub.1-6 alkyl, SOC.sub.1-6 alkyl, Si(C.sub.1-6 alkyl).sub.3, OSi(C.sub.1-6 alkyl).sub.3 C(S)N(C.sub.1-6 alkyl).sub.2, C(S)NH(C.sub.1-6 alkyl), C(S)NH.sub.2, C(O)S(C.sub.1-6 alkyl), C(S)SC.sub.1-6 alkyl, SC(S)SC.sub.1-6 alkyl, P(O)(OC.sub.1-6 alkyl).sub.2, P(O)(C.sub.1-6 alkyl).sub.2, OP(O)(C.sub.1-6 alkyl).sub.2, OP(O)(OC.sub.1-6 alkyl).sub.2, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.1-10 alkenyl, C.sub.1-10 alkynyl, heteroC.sub.1-10 alkyl, heteroC.sub.1-10 alkenyl, heteroC.sub.1-10 alkynyl, C.sub.3-10 carbocyclyl, C.sub.6-10 aryl, 3-10 membered heterocyclyl, or 5-10 membered heteroaryl; or two geminal R.sup.gg substituents can be joined to form O or S; and [0096] each X.sup. is a counterion.
[0097] In certain embodiments, each carbon atom substituent is independently halogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-6 alkyl, OR.sup.aa, SR.sup.aa, N(R.sup.bb).sub.2, CN, SCN, NO.sub.2, C(O)R.sup.aa, CO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, OC(O)R.sup.aa, OCO.sub.2R.sup.aa, OC(O)N(R.sup.bb).sub.2, NR.sup.bbC(O)R.sup.aa, NR.sup.bbCO.sub.2R.sup.aa, or NR.sup.bbC(O)N(R.sup.bb).sub.2. In certain embodiments, each carbon atom substituent is independently halogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, OR.sup.aa, SR.sup.aa, N(R.sup.bb).sub.2, CN, SCN, NO.sub.2, C(O)R.sup.aa, CO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, OC(O)R.sup.aa, OCO.sub.2R.sup.aa, OC(O)N(R.sup.bb).sub.2, NR.sup.bbC(O)R.sup.aa, NR.sup.bbCO.sub.2R.sup.aa, or NR.sup.bbC(O)N(R.sup.bb).sub.2, wherein R.sup.aa is hydrogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, an oxygen protecting group (e.g., silyl, TBDPS, TBDMS, TIPS, TES, TMS, MOM, THP, t-Bu, Bn, allyl, acetyl, pivaloyl, or benzoyl) when attached to an oxygen atom, or a sulfur protecting group (e.g., acetamidomethyl, t-Bu, 3-nitro-2-pyridine sulfenyl, 2-pyridine-sulfenyl, or triphenylmethyl) when attached to a sulfur atom; and each R.sup.bb is independently hydrogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, or a nitrogen protecting group (e.g., Bn, Boc, Cbz, Fmoc, trifluoroacetyl, triphenylmethyl, acetyl, or Ts). In certain embodiments, each carbon atom substituent is independently halogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-6 alkyl, OR.sup.aa, SR.sup.aa, N(R.sup.bb).sub.2, CN, SCN, or NO.sub.2. In certain embodiments, each carbon atom substituent is independently halogen, substituted (e.g., substituted with one or more halogen moieties) or unsubstituted C.sub.1-10 alkyl, OR.sup.aa, SR.sup.aa, N(R.sup.bb).sub.2, CN, SCN, or NO.sub.2, wherein R.sup.aa is hydrogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, an oxygen protecting group (e.g., silyl, TBDPS, TBDMS, TIPS, TES, TMS, MOM, THP, t-Bu, Bn, allyl, acetyl, pivaloyl, or benzoyl) when attached to an oxygen atom, or a sulfur protecting group (e.g., acetamidomethyl, t-Bu, 3-nitro-2-pyridine sulfenyl, 2-pyridine-sulfenyl, or triphenylmethyl) when attached to a sulfur atom; and each R.sup.bb is independently hydrogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, or a nitrogen protecting group (e.g., Bn, Boc, Cbz, Fmoc, trifluoroacetyl, triphenylmethyl, acetyl, or Ts).
[0098] In certain embodiments, the molecular weight of a carbon atom substituent is lower than 250, lower than 200, lower than 150, lower than 100, or lower than 50 g/mol. In certain embodiments, a carbon atom substituent consists of carbon, hydrogen, fluorine, chlorine, bromine, iodine, oxygen, sulfur, nitrogen, and/or silicon atoms. In certain embodiments, a carbon atom substituent consists of carbon, hydrogen, fluorine, chlorine, bromine, iodine, oxygen, sulfur, and/or nitrogen atoms. In certain embodiments, a carbon atom substituent consists of carbon, hydrogen, fluorine, chlorine, bromine, and/or iodine atoms. In certain embodiments, a carbon atom substituent consists of carbon, hydrogen, fluorine, and/or chlorine atoms.
[0099] The term halo or halogen refers to fluorine (fluoro, F), chlorine (chloro, Cl), bromine (bromo, Br), or iodine (iodo, I).
[0100] The term hydroxyl or hydroxy refers to the group OH. The term substituted hydroxyl or substituted hydroxyl, by extension, refers to a hydroxyl group wherein the oxygen atom directly attached to the parent molecule is substituted with a group other than hydrogen, and includes groups selected from OR.sup.aa, ON(R.sup.bb).sub.2, OC(O)SR.sup.aa, OC(O)R.sup.aa, OCO.sub.2R.sup.aa, OC(O)N(R.sup.bb).sub.2, OC(NR.sup.bb)R.sup.aa, OC(NR.sup.bb)OR.sup.aa, OC(NR.sup.bb)N(R.sup.bb).sub.2, OS(O)R.sup.aa, OSO.sub.2R.sup.aa, OSi(R.sup.aa).sub.3, OP(R.sup.cc).sub.2, OP(R.sup.cc).sub.3.sup.+X.sup., OP(OR.sup.cc).sub.2, OP(OR.sup.cc).sub.3.sup.+X.sup., OP(O)(R.sup.aa).sub.2, OP(O)(OR.sup.cc).sub.2, and OP(O)(N(R.sup.bb)).sub.2, wherein X.sup., R.sup.aa, R.sup.bb, and R.sup.cc are as defined herein.
[0101] The term thiol or thio refers to the group SH. The term substituted thiol or substituted thio, by extension, refers to a thiol group wherein the sulfur atom directly attached to the parent molecule is substituted with a group other than hydrogen, and includes groups selected from SR.sup.aa, SSR.sup.cc, SC(S)SR.sup.aa, SC(S)OR.sup.aa, SC(S) N(R.sup.bb).sub.2, SC(O)SR.sup.aa, SC(O)OR.sup.aa, SC(O)N(R.sup.bb).sub.2, and SC(O)R.sup.aa, wherein R.sup.aa and R.sup.cc are as defined herein.
[0102] The term amino refers to the group NH.sub.2. The term substituted amino, by extension, refers to a monosubstituted amino, a disubstituted amino, or a trisubstituted amino. In certain embodiments, the substituted amino is a monosubstituted amino or a disubstituted amino group.
[0103] The term monosubstituted amino refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with one hydrogen and one group other than hydrogen, and includes groups selected from NH(R.sup.bb), NHC(O)R.sup.aa, NHCO.sub.2R.sup.aa, NHC(O)N(R.sup.bb).sub.2, NHC(NR.sup.bb)N(R.sup.bb).sub.2, NHSO.sub.2R.sup.aa, NHP(O)(OR.sup.cc).sub.2, and NHP(O)(N(R.sup.bb).sub.2).sub.2, wherein R.sup.aa, R.sup.bb and R.sup.cc are as defined herein, and wherein R.sup.bb of the group NH(R.sup.bb) is not hydrogen.
[0104] The term disubstituted amino refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with two groups other than hydrogen, and includes groups selected from N(R.sup.bb).sub.2, NR.sup.bb C(O)R.sup.aa, NR.sup.bbCO.sub.2R.sup.aa, NR.sup.bbC(O)N(R.sup.bb).sub.2, NR.sup.bbC(NR.sup.bb)N(R.sup.bb).sub.2, NR.sup.bbSO.sub.2R.sup.aa, NR.sup.bbP(O)(OR.sup.cc).sub.2, and NR.sup.bbP(O)(N(R.sup.bb).sub.2).sub.2, wherein R.sup.aa, R.sup.bb, and R.sup.cc are as defined herein, with the proviso that the nitrogen atom directly attached to the parent molecule is not substituted with hydrogen.
[0105] The term trisubstituted amino refers to an amino group wherein the nitrogen atom directly attached to the parent molecule is substituted with three groups, and includes groups selected from N(R.sup.bb).sub.3 and N(R.sup.bb).sub.3.sup.+X.sup., wherein R.sup.bb and X.sup. are as defined herein.
[0106] The term sulfonyl refers to a group selected from SO.sub.2N(R.sup.bb).sub.2, SO.sub.2R.sup.aa, and SO.sub.2OR.sup.aa, wherein R.sup.aa and R.sup.bb are as defined herein.
[0107] The term sulfinyl refers to the group S(O)R.sup.aa, wherein R.sup.aa is as defined herein.
[0108] The term acyl refers to a group having the general formula C(O)R.sup.X1, C(O)OR.sup.X1, C(O)OC(O)R.sup.X1, C(O)SR.sup.X1, C(O)N(R.sup.X1).sub.2, C(S)R.sup.X1, C(S)N(R.sup.X1).sub.2, and C(S)S(R.sup.X1), C(NR.sup.X1)R.sup.X1, C(NR.sup.X1)OR.sup.X1, C(NR.sup.X1)SR.sup.X1, and C(NR.sup.X1)N(R.sup.X1).sub.2, wherein R.sup.X1 is hydrogen; halogen; substituted or unsubstituted hydroxyl; substituted or unsubstituted thiol; substituted or unsubstituted amino; substituted or unsubstituted acyl, cyclic or acyclic, substituted or unsubstituted, branched or unbranched aliphatic; cyclic or acyclic, substituted or unsubstituted, branched or unbranched heteroaliphatic; cyclic or acyclic, substituted or unsubstituted, branched or unbranched alkyl; cyclic or acyclic, substituted or unsubstituted, branched or unbranched alkenyl; substituted or unsubstituted alkynyl; substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, aliphaticoxy, heteroaliphaticoxy, alkyloxy, heteroalkyloxy, aryloxy, heteroaryloxy, aliphaticthioxy, heteroaliphaticthioxy, alkylthioxy, heteroalkylthioxy, arylthioxy, heteroarylthioxy, mono- or di-aliphaticamino, mono- or di-heteroaliphaticamino, mono- or di-alkylamino, mono- or di-heteroalkylamino, mono- or di-arylamino, or mono- or di-heteroarylamino; or two R.sup.X1 groups taken together form a 5- to 6-membered heterocyclic ring. Exemplary acyl groups include aldehydes (CHO), carboxylic acids (CO.sub.2H), ketones, acyl halides, esters, amides, imines, carbonates, carbamates, and ureas. Acyl substituents include, but are not limited to, any of the substituents described herein, that result in the formation of a stable moiety (e.g., aliphatic, alkyl, alkenyl, alkynyl, heteroaliphatic, heterocyclic, aryl, heteroaryl, acyl, oxo, imino, thiooxo, cyano, isocyano, amino, azido, nitro, hydroxyl, thiol, halo, aliphaticamino, heteroaliphaticamino, alkylamino, heteroalkylamino, arylamino, heteroarylamino, alkylaryl, arylalkyl, aliphaticoxy, heteroaliphaticoxy, alkyloxy, heteroalkyloxy, aryloxy, heteroaryloxy, aliphaticthioxy, heteroaliphaticthioxy, alkylthioxy, heteroalkylthioxy, arylthioxy, heteroarylthioxy, acyloxy, and the like, each of which may or may not be further substituted).
[0109] The term carbonyl refers to a group wherein the carbon directly attached to the parent molecule is sp.sup.2 hybridized, and is substituted with an oxygen, nitrogen or sulfur atom, e.g., a group selected from ketones (C(O)R.sup.aa), carboxylic acids (CO.sub.2H), aldehydes (CHO), esters (CO.sub.2R.sup.aa, C(O)SR.sup.aa, C(S)SR.sup.aa), amides (C(O)N(R.sup.bb).sub.2, C(O)NR.sup.bbSO.sub.2R.sup.aa, C(S)N(R.sup.bb).sub.2), and imines (C(NR.sup.bb)R.sup.aa, C(NR.sup.bb)OR.sup.aa), C(NR.sup.bb)N(R.sup.bb).sub.2), wherein R.sup.aa and R.sup.bb are as defined herein.
[0110] The term silyl refers to the group Si(R.sup.aa).sub.3, wherein R.sup.aa is as defined herein.
[0111] The term phosphino refers to the group P(R.sup.cc).sub.2, wherein R.sup.cc is as defined herein.
[0112] The term phosphono refers to the group (PO)(OR.sup.cc).sub.2, wherein R.sup.aa and R.sup.cc are as defined herein.
[0113] The term phosphoramido refers to the group O(PO)(N(R.sup.bb).sub.2).sub.2, wherein each R.sup.bb is as defined herein.
[0114] The term oxo refers to the group O, and the term thiooxo refers to the group S.
[0115] Nitrogen atoms can be substituted or unsubstituted as valency permits, and include primary, secondary, tertiary, and quaternary nitrogen atoms. Exemplary nitrogen atom substituents include hydrogen, OH, OR.sup.aa, N(R.sup.cc).sub.2, CN, C(O)R.sup.aa, C(O)N(R.sup.cc).sub.2, CO.sub.2R.sup.aa, SO.sub.2R.sup.aa, C(NR.sup.bb)R.sup.aa, C(NR.sup.cc)OR.sup.aa, C(NR.sup.cc)N(R.sup.cc).sub.2, SO.sub.2N(R.sup.cc).sub.2, SO.sub.2R.sup.cc, SO.sub.2OR.sup.cc, SOR.sup.aa, C(S)N(R.sup.cc).sub.2, C(O)SR.sup.cc, C(S)SR.sup.cc, P(O)(OR.sup.cc).sub.2, P(O)(R.sup.aa).sub.2, P(O)(N(R.sup.cc).sub.2).sub.2, C.sub.1-20 alkyl, C.sub.1-20 perhaloalkyl, C.sub.1-20 alkenyl, C.sub.1-20 alkynyl, hetero C.sub.1-20 alkyl, hetero C.sub.1-20 alkenyl, hetero C.sub.1-20 alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two R.sup.cc groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups, and wherein R.sup.aa, R.sup.bb, R.sup.cc and R.sup.dd are as defined above.
[0116] In certain embodiments, each nitrogen atom substituent is independently substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-6 alkyl, C(O)R.sup.aa, CO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, or a nitrogen protecting group. In certain embodiments, each nitrogen atom substituent is independently substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, C(O)R.sup.aa, CO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, or a nitrogen protecting group, wherein R.sup.aa is hydrogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, or an oxygen protecting group when attached to an oxygen atom; and each R.sup.bb is independently hydrogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, or a nitrogen protecting group. In certain embodiments, each nitrogen atom substituent is independently substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-6 alkyl or a nitrogen protecting group.
[0117] In certain embodiments, the substituent present on the nitrogen atom is a nitrogen protecting group (also referred to herein as an amino protecting group). Nitrogen protecting groups include OH, OR.sup.aa, N(R.sup.cc).sub.2, C(O)R.sup.aa, C(O)N(R.sup.cc).sub.2, CO.sub.2R.sup.aa, SO.sub.2R.sup.aa, C(NR.sup.cc)R.sup.aa, C(NR.sup.cc)OR.sup.aa, C(NR.sup.cc)N(R.sup.cc).sub.2, SO.sub.2N(R.sup.cc).sub.2, SO.sub.2R.sup.cc, SO.sub.2OR.sup.cc, SOR.sup.aa, C(S)N(R.sup.cc).sub.2, C(O)SR.sup.cc, C(S)SR.sup.cc, C.sub.1-10 alkyl (e.g., aralkyl, heteroaralkyl), C.sub.1-20 alkenyl, C.sub.1-20 alkynyl, hetero C.sub.1-20 alkyl, hetero C.sub.1-20 alkenyl, hetero C.sub.1-20 alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups, and wherein R.sup.aa, R.sup.bb, R.sup.cc and R.sup.dd are as defined herein. Nitrogen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3.sup.rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
[0118] For example, in certain embodiments, at least one nitrogen protecting group is an amide group (e.g., a moiety that include the nitrogen atom to which the nitrogen protecting groups (e.g., C(O)R.sup.aa) is directly attached). In certain such embodiments, each nitrogen protecting group, together with the nitrogen atom to which the nitrogen protecting group is attached, is independently selected from the group consisting of formamide, acetamide, chloroacetamide, trichloroacetamide, trifluoroacetamide, phenylacetamide, 3-phenylpropanamide, picolinamide, 3-pyridylcarboxamide, N-benzoylphenylalanyl derivatives, benzamide, p-phenylbenzamide, o-nitophenylacetamide, o-nitrophenoxyacetamide, acetoacetamide, (N-dithiobenzyloxyacylamino)acetamide, 3-(p-hydroxyphenyl)propanamide, 3-(o-nitrophenyl)propanamide, 2-methyl-2-(o-nitrophenoxy)propanamide, 2-methyl-2-(o-phenylazophenoxy)propanamide, 4-chlorobutanamide, 3-methyl-3-nitrobutanamide, o-nitrocinnamide, N-acetylmethionine derivatives, o-nitrobenzamide, and o-(benzoyloxymethyl)benzamide.
[0119] In certain embodiments, at least one nitrogen protecting group is a carbamate group (e.g., a moiety that includes the nitrogen atom to which the nitrogen protecting groups (e.g., C(O)OR.sup.aa) is directly attached). In certain such embodiments, each nitrogen protecting group, together with the nitrogen atom to which the nitrogen protecting group is attached, is independently selected from the group consisting of methyl carbamate, ethyl carbamate, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluoroenylmethyl carbamate, 2,7-di-t-butyl-[9-(10,10-dioxo-10,10,10,10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), 1-(1-adamantyl)-1-methylethyl carbamate (Adpoc), 1,1-dimethyl-2-haloethyl carbamate, 1,1-dimethyl-2,2-dibromoethyl carbamate (DB-t-BOC), 1,1-dimethyl-2,2,2-trichloroethyl carbamate (TCBOC), 1-methyl-1-(4-biphenylyl)ethyl carbamate (Bpoc), 1-(3,5-di-t-butylphenyl)-1-methylethyl carbamate (t-Bumeoc), 2-(2- and 4-pyridyl)ethyl carbamate (Pyoc), 2-(N,N-dicyclohexylcarboxamido)ethyl carbamate, t-butyl carbamate (BOC or Boc), 1-adamantyl carbamate (Adoc), vinyl carbamate (Voc), allyl carbamate (Alloc), 1-isopropylallyl carbamate (Ipaoc), cinnamyl carbamate (Coc), 4-nitrocinnamyl carbamate (Noc), 8-quinolyl carbamate, N-hydroxypiperidinyl carbamate, alkyldithio carbamate, benzyl carbamate (Cbz), p-methoxybenzyl carbamate (Moz), p-nitobenzyl carbamate, p-bromobenzyl carbamate, p-chlorobenzyl carbamate, 2,4-dichlorobenzyl carbamate, 4-methylsulfinylbenzyl carbamate (Msz), 9-anthrylmethyl carbamate, diphenylmethyl carbamate, 2-methylthioethyl carbamate, 2-methylsulfonylethyl carbamate, 2-(p-toluenesulfonyl)ethyl carbamate, [2-(1,3-dithianyl)]methyl carbamate (Dmoc), 4-methylthiophenyl carbamate (Mtpc), 2,4-dimethylthiophenyl carbamate (Bmpc), 2-phosphonioethyl carbamate (Peoc), 2-triphenylphosphonioisopropyl carbamate (Ppoc), 1,1-dimethyl-2-cyanoethyl carbamate, m-chloro-p-acyloxybenzyl carbamate, p-(dihydroxyboryl)benzyl carbamate, 5-benzisoxazolylmethyl carbamate, 2-(trifluoromethyl)-6-chromonylmethyl carbamate (Tcroc), m-nitrophenyl carbamate, 3,5-dimethoxybenzyl carbamate, o-nitrobenzyl carbamate, 3,4-dimethoxy-6-nitrobenzyl carbamate, phenyl(o-nitrophenyl)methyl carbamate, t-amyl carbamate, S-benzyl thiocarbamate, p-cyanobenzyl carbamate, cyclobutyl carbamate, cyclohexyl carbamate, cyclopentyl carbamate, cyclopropylmethyl carbamate, p-decyloxybenzyl carbamate, 2,2-dimethoxyacylvinyl carbamate, o-(N,N-dimethylcarboxamido)benzyl carbamate, 1,1-dimethyl-3-(N,N-dimethylcarboxamido)propyl carbamate, 1,1-dimethylpropynyl carbamate, di(2-pyridyl)methyl carbamate, 2-furanylmethyl carbamate, 2-iodoethyl carbamate, isoborynl carbamate, isobutyl carbamate, isonicotinyl carbamate, p-(p-methoxyphenylazo)benzyl carbamate, 1-methylcyclobutyl carbamate, 1-methylcyclohexyl carbamate, 1-methyl-1-cyclopropylmethyl carbamate, 1-methyl-1-(3,5-dimethoxyphenyl)ethyl carbamate, 1-methyl-1-(p-phenylazophenyl)ethyl carbamate, 1-methyl-1-phenylethyl carbamate, 1-methyl-1-(4-pyridyl)ethyl carbamate, phenyl carbamate, p-(phenylazo)benzyl carbamate, 2,4,6-tri-t-butylphenyl carbamate, 4-(trimethylammonium)benzyl carbamate, and 2,4,6-trimethylbenzyl carbamate.
[0120] In certain embodiments, at least one nitrogen protecting group is a sulfonamide group (e.g., a moiety that include the nitrogen atom to which the nitrogen protecting groups (e.g., S(O).sub.2R.sup.aa) is directly attached). In certain such embodiments, each nitrogen protecting group, together with the nitrogen atom to which the nitrogen protecting group is attached, is independently selected from the group consisting of p-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6-trimethyl-4-methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6-dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5,6-tetramethyl-4-methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6-trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7,8-pentamethylchroman-6-sulfonamide (Pmc), methanesulfonamide (Ms), -trimethylsilylethanesulfonamide (SES), 9-anthracenesulfonamide, 4-(4,8-dimethoxynaphthylmethyl)benzenesulfonamide (DNMBS), benzylsulfonamide, trifluoromethylsulfonamide, and phenacylsulfonamide.
[0121] In certain embodiments, each nitrogen protecting group, together with the nitrogen atom to which the nitrogen protecting group is attached, is independently selected from the group consisting of phenothiazinyl-(10)-acyl derivatives, N-p-toluenesulfonylaminoacyl derivatives, N-phenylaminothioacyl derivatives, N-benzoylphenylalanyl derivatives, N-acetylmethionine derivatives, 4,5-diphenyl-3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-1,1,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted 1,3-dimethyl-1,3,5-triazacyclohexan-2-one, 5-substituted 1,3-dibenzyl-1,3,5-triazacyclohexan-2-one, 1-substituted 3,5-dinitro-4-pyridone, N-methylamine, N-allylamine, N-[2-(trimethylsilyl)ethoxy]methylamine (SEM), N-3-acetoxypropylamine, N-(1-isopropyl-4-nitro-2-oxo-3-pyroolin-3-yl)amine, quaternary ammonium salts, N-benzylamine, N-di(4-methoxyphenyl)methylamine, N-5-dibenzosuberylamine, N-triphenylmethylamine (Tr), N-[(4-methoxyphenyl)diphenylmethyl]amine (MMTr), N-9-phenylfluorenylamine (PhF), N-2,7-dichloro-9-fluorenylmethyleneamine, N-ferrocenylmethylamino (Fcm), N-2-picolylamino N-oxide, N-1,1-dimethylthiomethyleneamine, N-benzylideneamine, N-p-methoxybenzylideneamine, N-diphenylmethyleneamine, N-[(2-pyridyl)mesityl]methyleneamine, N(N,N-dimethylaminomethylene)amine, N-p-nitrobenzylideneamine, N-salicylideneamine, N-5-chlorosalicylideneamine, N-(5-chloro-2-hydroxyphenyl)phenylmethyleneamine, N-cyclohexylideneamine, N-(5,5-dimethyl-3-oxo-1-cyclohexenyl)amine, N-borane derivatives, N-diphenylborinic acid derivatives, N-[phenyl(pentaacylchromium- or tungsten)acyl]amine, N-copper chelate, N-zinc chelate, N-nitroamine, N-nitrosoamine, amine N-oxide, diphenylphosphinamide (Dpp), dimethylthiophosphinamide (Mpt), diphenylthiophosphinamide (Ppt), dialkyl phosphoramidates, dibenzyl phosphoramidate, diphenyl phosphoramidate, benzenesulfenamide, o-nitrobenzenesulfenamide (Nps), 2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4-methoxybenzenesulfenamide, triphenylmethylsulfenamide, and 3-nitropyridinesulfenamide (Npys). In some embodiments, two instances of a nitrogen protecting group together with the nitrogen atoms to which the nitrogen protecting groups are attached are N,N-isopropylidenediamine.
[0122] In certain embodiments, at least one nitrogen protecting group is Bn, Boc, Cbz, Fmoc, trifluoroacetyl, triphenylmethyl, acetyl, or Ts.
[0123] In certain embodiments, each oxygen atom substituent is independently substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, C(O)R.sup.aa, CO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, or an oxygen protecting group. In certain embodiments, each oxygen atom substituents is independently substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-6 alkyl, C(O)R.sup.aa, CO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, or an oxygen protecting group, wherein R.sup.aa is hydrogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, or an oxygen protecting group when attached to an oxygen atom; and each R.sup.bb is independently hydrogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, or a nitrogen protecting group. In certain embodiments, each oxygen atom substituent is independently substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-6 alkyl or an oxygen protecting group.
[0124] In certain embodiments, the substituent present on an oxygen atom is an oxygen protecting group (also referred to herein as an hydroxyl protecting group). Oxygen protecting groups include R.sup.aa, N(R.sup.bb).sub.2, C(O)SR.sup.aa, C(O)R.sup.aa, CO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, C(NR.sup.bb)R.sup.aa, C(NR.sup.bb)OR.sup.aa, C(NR.sup.bb)N(R.sup.bb).sub.2, S(O)R.sup.aa, SO.sub.2R.sup.aa, Si(R.sup.aa).sub.3, P(R.sup.cc).sub.2, P(R.sup.cc).sub.3.sup.+X.sup., P(OR.sup.cc).sub.2, P(OR.sup.cc).sub.3.sup.+X.sup., P(O)(R.sup.aa).sub.2, P(O)(OR.sup.cc).sub.2, and P(O)(N(R.sup.bb).sub.2).sub.2, wherein X.sup., R.sup.aa, R.sup.bb, and R.sup.cc are as defined herein. Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3.sup.rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
[0125] In certain embodiments, each oxygen protecting group, together with the oxygen atom to which the oxygen protecting group is attached, is selected from the group consisting of methyl, methoxymethyl (MOM), methylthiomethyl (MTM), t-butylthiomethyl, (phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), p-methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p-AOM), guaiacolmethyl (GUM), t-butoxymethyl, 4-pentenyloxymethyl (POM), siloxymethyl, 2-methoxyethoxymethyl (MEM), 2,2,2-trichloroethoxymethyl, bis(2-chloroethoxy)methyl, 2-(trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3-bromotetrahydropyranyl, tetrahydrothiopyranyl, 1-methoxycyclohexyl, 4-methoxytetrahydropyranyl (MTHP), 4-methoxytetrahydrothiopyranyl, 4-methoxytetrahydrothiopyranyl S,S-dioxide, 1-[(2-chloro-4-methyl)phenyl]-4-methoxypiperidin-4-yl (CTMP), 1,4-dioxan-2-yl, tetrahydrofuranyl, tetrahydrothiofuranyl, 2,3,3a,4,5,6,7,7a-octahydro-7,8,8-trimethyl-4,7-methanobenzofuran-2-yl, 1-ethoxyethyl, 1-(2-chloroethoxy)ethyl, 1-methyl-1-methoxyethyl, 1-methyl-1-benzyloxyethyl, 1-methyl-1-benzyloxy-2-fluoroethyl, 2,2,2-trichloroethyl, 2-trimethylsilylethyl, 2-(phenylselenyl)ethyl, t-butyl, allyl, p-chlorophenyl, p-methoxyphenyl, 2,4-dinitrophenyl, benzyl (Bn), p-methoxybenzyl (PMB), 3,4-dimethoxybenzyl, o-nitrobenzyl, p-nitrobenzyl, p-halobenzyl, 2,6-dichlorobenzyl, p-cyanobenzyl, p-phenylbenzyl, 2-picolyl, 4-picolyl, 3-methyl-2-picolyl N-oxido, diphenylmethyl, p,p-dinitrobenzhydryl, 5-dibenzosuberyl, triphenylmethyl, -naphthyldiphenylmethyl, p-methoxyphenyldiphenylmethyl, di(p-methoxyphenyl)phenylmethyl, tri(p-methoxyphenyl)methyl, 4-(4-bromophenacyloxyphenyl)diphenylmethyl, 4,4,4-tris(4,5-dichlorophthalimidophenyl)methyl, 4,4,4-tris(levulinoyloxyphenyl)methyl, 4,4,4-tris(benzoyloxyphenyl)methyl, 4,4-Dimethoxy-3-[N-(imidazolylmethyl)]trityl Ether (IDTr-OR), 4,4-Dimethoxy-3-[N-(imidazolylethyl)carbamoyl]trityl Ether (IETr-OR), 1,1-bis(4-methoxyphenyl)-1-pyrenylmethyl, 9-anthryl, 9-(9-phenyl)xanthenyl, 9-(9-phenyl-10-oxo)anthryl, 1,3-benzodithiolan-2-yl, benzisothiazolyl S,S-dioxido, trimethylsilyl (TMS), triethylsilyl (TES), triisopropylsilyl (TIPS), dimethylisopropylsilyl (IPDMS), diethylisopropylsilyl (DEIPS), dimethylthexylsilyl, t-butyldimethylsilyl (TBDMS), t-butyldiphenylsilyl (TBDPS), tribenzylsilyl, tri-p-xylylsilyl, triphenylsilyl, diphenylmethylsilyl (DPMS), t-butylmethoxyphenylsilyl (TBMPS), formate, benzoylformate, acetate, chloroacetate, dichloroacetate, trichloroacetate, trifluoroacetate, methoxyacetate, triphenylmethoxyacetate, phenoxyacetate, p-chlorophenoxyacetate, 3-phenylpropionate, 4-oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate (levulinoyldithioacetal), pivaloate, adamantoate, crotonate, 4-methoxycrotonate, benzoate, p-phenylbenzoate, 2,4,6-trimethylbenzoate (mesitoate), methyl carbonate, 9-fluorenylmethyl carbonate (Fmoc), ethyl carbonate, 2,2,2-trichloroethyl carbonate (Troc), 2-(trimethylsilyl)ethyl carbonate (TMSEC), 2-(phenylsulfonyl) ethyl carbonate (Psec), 2-(triphenylphosphonio) ethyl carbonate (Peoc), isobutyl carbonate, vinyl carbonate, allyl carbonate, t-butyl carbonate (BOC or Boc), p-nitrophenyl carbonate, benzyl carbonate, p-methoxybenzyl carbonate, 3,4-dimethoxybenzyl carbonate, o-nitrobenzyl carbonate, p-nitrobenzyl carbonate, S-benzyl thiocarbonate, 4-ethoxy-1-napththyl carbonate, methyl dithiocarbonate, 2-iodobenzoate, 4-azidobutyrate, 4-nitro-4-methylpentanoate, o-(dibromomethyl)benzoate, 2-formylbenzenesulfonate, 2-(methylthiomethoxy)ethyl carbonate (MTMEC-OR), 4-(methylthiomethoxy)butyrate, 2-(methylthiomethoxymethyl)benzoate, 2,6-dichloro-4-methylphenoxyacetate, 2,6-dichloro-4-(1,1,3,3-tetramethylbutyl)phenoxyacetate, 2,4-bis(1,1-dimethylpropyl)phenoxyacetate, chlorodiphenylacetate, isobutyrate, monosuccinoate, (E)-2-methyl-2-butenoate, o-(methoxyacyl)benzoate, -naphthoate, nitrate, alkyl N,N,N,N-tetramethylphosphorodiamidate, alkyl N-phenylcarbamate, borate, dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate, sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts).
[0126] In certain embodiments, at least one oxygen protecting group is silyl, TBDPS, TBDMS, TIPS, TES, TMS, MOM, THP, t-Bu, Bn, allyl, acetyl, pivaloyl, or benzoyl.
[0127] In certain embodiments, each sulfur atom substituent is independently substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, C(O)R.sup.aa, CO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, or a sulfur protecting group. In certain embodiments, each sulfur atom substituent is independently substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, C(O)R.sup.aa, CO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, or a sulfur protecting group, wherein R.sup.aa is hydrogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, or an oxygen protecting group when attached to an oxygen atom; and each R.sup.bb is independently hydrogen, substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-10 alkyl, or a nitrogen protecting group. In certain embodiments, each sulfur atom substituent is independently substituted (e.g., substituted with one or more halogen) or unsubstituted C.sub.1-6 alkyl or a sulfur protecting group.
[0128] In certain embodiments, the substituent present on a sulfur atom is a sulfur protecting group (also referred to as a thiol protecting group). In some embodiments, each sulfur protecting group is selected from the group consisting of R.sup.aa, N(R.sup.bb).sub.2, C(O)SR.sup.aa, C(O)R.sup.aa, CO.sub.2R.sup.aa, C(O)N(R.sup.bb).sub.2, C(NR.sup.bb)R.sup.aa, C(NR.sup.bb)OR.sup.aa, C(NR.sup.bb)N(R.sup.bb).sub.2, S(O)R.sup.aa, SO.sub.2R.sup.aa, Si(R.sup.aa).sub.3, P(R.sup.cc).sub.2, P(R.sup.cc).sub.3.sup.+X.sup., P(OR.sup.cc).sub.2, P(OR.sup.cc).sub.3.sup.+X.sup., P(O)(R.sup.aa).sub.2, P(O)(OR.sup.cc).sub.2, and P(O)(N(R.sup.bb).sub.2).sub.2, wherein R.sup.aa, R.sup.bb, and R.sup.cc are as defined herein. Sulfur protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3.sup.rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
[0129] In certain embodiments, the molecular weight of a substituent is lower than 250, lower than 200, lower than 150, lower than 100, or lower than 50 g/mol. In certain embodiments, a substituent consists of carbon, hydrogen, fluorine, chlorine, bromine, iodine, oxygen, sulfur, nitrogen, and/or silicon atoms. In certain embodiments, a substituent consists of carbon, hydrogen, fluorine, chlorine, bromine, iodine, oxygen, sulfur, and/or nitrogen atoms. In certain embodiments, a substituent consists of carbon, hydrogen, fluorine, chlorine, bromine, and/or iodine atoms. In certain embodiments, a substituent consists of carbon, hydrogen, fluorine, and/or chlorine atoms. In certain embodiments, a substituent comprises 0, 1, 2, or 3 hydrogen bond donors. In certain embodiments, a substituent comprises 0, 1, 2, or 3 hydrogen bond acceptors.
[0130] A counterion or anionic counterion is a negatively charged group associated with a positively charged group in order to maintain electronic neutrality. An anionic counterion may be monovalent (e.g., including one formal negative charge). An anionic counterion may also be multivalent (e.g., including more than one formal negative charge), such as divalent or trivalent. Exemplary counterions include halide ions (e.g., F.sup., Cl.sup., Br.sup., I.sup.), NO.sub.3.sup., ClO.sub.4.sup., OH.sup., H.sub.2PO.sub.4.sup., HCO.sub.3.sup., HSO.sub.4.sup., sulfonate ions (e.g., methansulfonate, trifluoromethanesulfonate, p-toluenesulfonate, benzenesulfonate, 10-camphor sulfonate, naphthalene-2-sulfonate, naphthalene-1-sulfonic acid-5-sulfonate, ethan-1-sulfonic acid-2-sulfonate, and the like), carboxylate ions (e.g., acetate, propanoate, benzoate, glycerate, lactate, tartrate, glycolate, gluconate, and the like), BF.sub.4.sup., PF.sub.4.sup., PF.sub.6.sup., AsF.sub.6.sup., SbF.sub.6.sup., B[3,5-(CF.sub.3).sub.2C.sub.6H.sub.3].sub.4].sup., B(C.sub.6F.sub.5).sub.4.sup., BPh.sub.4.sup., Al(OC(CF.sub.3).sub.3).sub.4.sup., and carborane anions (e.g., CB.sub.11H.sub.12.sup. or (HCB.sub.11Me.sub.5Br.sub.6).sup.). Exemplary counterions which may be multivalent include CO.sub.3.sup.2-, HPO.sub.4.sup.2-, PO.sub.4.sup.3-, B.sub.4O.sub.7.sup.2-, S.sub.4.sup.2-, S.sub.2O.sub.3.sup.2-, carboxylate anions (e.g., tartrate, citrate, fumarate, maleate, malate, malonate, gluconate, succinate, glutarate, adipate, pimelate, suberate, azelate, sebacate, salicylate, phthalates, aspartate, glutamate, and the like), and carboranes.
[0131] A leaving group (LG) is an art-understood term referring to an atomic or molecular fragment that departs with a pair of electrons in heterolytic bond cleavage, wherein the molecular fragment is an anion or neutral molecule. As used herein, a leaving group can be an atom or a group capable of being displaced by a nucleophile. See e.g., Smith, March Advanced Organic Chemistry 6th ed. (501-502). Exemplary leaving groups include, but are not limited to, halo (e.g., fluoro, chloro, bromo, iodo) and activated substituted hydroxyl groups (e.g., OC(O)SR.sup.aa, OC(O)R.sup.aa, OCO.sub.2R.sup.aa, OC(O)N(R.sup.bb).sub.2, OC(NR.sup.bb)R.sup.aa, OC(NR.sup.bb)OR.sup.aa, OC(NR.sup.bb)N(R.sup.bb).sub.2, OS(O)R.sup.aa, OSO.sub.2R.sup.aa, OP(R.sup.cc).sub.2, OP(R.sup.cc).sub.3, OP(O).sub.2R.sup.aa, OP(O)(R.sup.aa).sub.2, OP(O)(OR.sup.cc).sub.2, OP(O).sub.2N(R.sup.bb).sub.2, and OP(O)(NR.sup.bb).sub.2 wherein R.sup.aa, R.sup.bb, and R.sup.cc are as defined herein). Additional examples of suitable leaving groups include, but are not limited to, halogen alkoxycarbonyloxy, aryloxycarbonyloxy, alkanesulfonyloxy, arenesulfonyloxy, alkyl-carbonyloxy (e.g., acetoxy), arylcarbonyloxy, aryloxy, methoxy, N,O-dimethylhydroxylamino, pixyl, and haloformates. In some embodiments, the leaving group is a sulfonic acid ester, such as toluenesulfonate (tosylate, -OTs), methanesulfonate (mesylate, -OMs), p-bromobenzenesulfonyloxy (brosylate, -OBs), OS(O).sub.2(CF.sub.2).sub.3CF.sub.3 (nonaflate, -ONf), or trifluoromethanesulfonate (triflate, -OTf). In some embodiments, the leaving group is a brosylate, such asp-bromobenzenesulfonyloxy. In some embodiments, the leaving group is a nosylate, such as 2-nitrobenzenesulfonyloxy. In some embodiments, the leaving group is a sulfonate-containing group. In some embodiments, the leaving group is a tosylate group. In some embodiments, the leaving group is a phosphineoxide (e.g., formed during a Mitsunobu reaction) or an internal leaving group such as an epoxide or cyclic sulfate. Other non-limiting examples of leaving groups are water, ammonia, alcohols, ether moieties, thioether moieties, zinc halides, magnesium moieties, diazonium salts, and copper moieties.
[0132] Use of the phrase at least one instance refers to 1, 2, 3, 4, or more instances, but also encompasses a range, e.g., for example, from 1 to 4, from 1 to 3, from 1 to 2, from 2 to 4, from 2 to 3, or from 3 to 4 instances, inclusive.
[0133] A non-hydrogen group refers to any group that is defined for a particular variable that is not hydrogen.
[0134] These and other exemplary substituents are described in more detail in the Detailed Description, Examples, and Claims. The invention is not limited in any manner by the above exemplary listing of substituents.
[0135] As used herein, the term salt refers to any and all salts and encompasses pharmaceutically acceptable salts. Salts include ionic compounds that result from the neutralization reaction of an acid and a base. A salt is composed of one or more cations (positively charged ions) and one or more anions (negative ions) so that the salt is electrically neutral (without a net charge). Salts of the compounds of this invention include those derived from inorganic and organic acids and bases. Examples of acid addition salts are salts of an amino group formed with inorganic acids, such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid, and perchloric acid, or with organic acids, such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid, or malonic acid or by using other methods known in the art such as ion exchange. Other salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, p-toluenesulfonate, undecanoate, valerate, hippurate, and the like. Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and N.sup.+(C.sub.1-4 alkyl).sub.4 salts. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like. Further salts include ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate, and aryl sulfonate.
[0136] A subject to which administration is contemplated refers to a human (i.e., male or female of any age group, e.g., pediatric subject (e.g., infant, child, or adolescent) or adult subject (e.g., young adult, middle-aged adult, or senior adult)) or non-human animal. In certain embodiments, the non-human animal is a mammal (e.g., primate (e.g., cynomolgus monkey or rhesus monkey), commercially relevant mammal (e.g., cattle, pig, horse, sheep, goat, cat, or dog), or bird (e.g., commercially relevant bird, such as chicken, duck, goose, or turkey)). In certain embodiments, the non-human animal is a fish, reptile, or amphibian. The non-human animal may be a male or female at any stage of development. The non-human animal may be a transgenic animal or genetically engineered animal. The term patient refers to a human subject in need of treatment of a disease.
[0137] The term administer, administering, or administration refers to implanting, absorbing, ingesting, injecting, inhaling, or otherwise introducing a compound described herein, or a composition thereof, in or on a subject.
[0138] The terms treatment, treat, and treating refer to reversing, alleviating, delaying the onset of, or inhibiting the progress of a disease described herein. In some embodiments, treatment may be administered after one or more signs or symptoms of the disease have developed or have been observed. In other embodiments, treatment may be administered in the absence of signs or symptoms of the disease. For example, treatment may be administered to a susceptible subject prior to the onset of symptoms (e.g., in light of a history of symptoms and/or in light of exposure to a pathogen). Treatment may also be continued after symptoms have resolved, for example, to delay or prevent recurrence.
[0139] The term prevent, preventing, or prevention refers to a prophylactic treatment of a subject who is not and was not with a disease but is at risk of developing the disease or who was with a disease, is not with the disease, but is at risk of regression of the disease. In certain embodiments, the subject is at a higher risk of developing the disease or at a higher risk of regression of the disease than an average healthy member of a population. In some embodiments, the subject is at risk of developing a disease or condition due to environmental factors (e.g., exposure to the sun).
[0140] An effective amount of a compound described herein refers to an amount sufficient to elicit the desired biological response. An effective amount of a compound described herein may vary depending on such factors as the desired biological endpoint, severity of side effects, disease, or disorder, the identity, pharmacokinetics, and pharmacodynamics of the particular compound, the condition being treated, the mode, route, and desired or required frequency of administration, the species, age and health or general condition of the subject. In certain embodiments, an effective amount is a therapeutically effective amount. In certain embodiments, an effective amount is a prophylactic treatment. In certain embodiments, an effective amount is the amount of a compound described herein in a single dose. In certain embodiments, an effective amount is the combined amounts of a compound described herein in multiple doses. In certain embodiments, the desired dosage is delivered three times a day, two times a day, once a day, every other day, every third day, every week, every two weeks, every three weeks, or every four weeks. In certain embodiments, the desired dosage is delivered using multiple administrations (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or more administrations).
[0141] In certain embodiments, an effective amount of a compound for administration one or more times a day to a 70 kg adult human comprises about 0.0001 mg to about 3000 mg, about 0.0001 mg to about 2000 mg, about 0.0001 mg to about 1000 mg, about 0.001 mg to about 1000 mg, about 0.01 mg to about 1000 mg, about 0.1 mg to about 1000 mg, about 1 mg to about 1000 mg, about 1 mg to about 100 mg, about 10 mg to about 1000 mg, or about 100 mg to about 1000 mg, of a compound per unit dosage form.
[0142] It will be appreciated that dose ranges as described herein provide guidance for the administration of provided pharmaceutical compositions to an adult. The amount to be administered to, for example, a child or an adolescent can be determined by a medical practitioner or person skilled in the art and can be lower or the same as that administered to an adult.
[0143] A therapeutically effective amount of a compound described herein is an amount sufficient to provide a therapeutic benefit in the treatment of a condition or to delay or minimize one or more symptoms associated with the condition. A therapeutically effective amount of a compound means an amount of therapeutic agent, alone or in combination with other therapies, which provides a therapeutic benefit in the treatment of the condition. The term therapeutically effective amount can encompass an amount that improves overall therapy, reduces or avoids symptoms, signs, or causes of the condition, and/or enhances the therapeutic efficacy of another therapeutic agent. In certain embodiments, a therapeutically effective amount is an amount sufficient to provide anti-oxidative or anti-inflammatory effects. In some embodiments, a therapeutically effective amount is an amount sufficient to provide UV-modulating effects (e.g., absorption of UV wavelengths between 310 and 362 nm). In certain embodiments, a therapeutically effective amount is an amount sufficient for preventing sunburn. In certain embodiments, a therapeutically effective amount is an amount sufficient for preventing cancer. In certain embodiments, a therapeutically effective amount is an amount sufficient for preventing or treating a chronic inflammatory disease.
[0144] The term cancer refers to a class of diseases characterized by the development of abnormal cells that proliferate uncontrollably and have the ability to infiltrate and destroy normal body tissues. See e.g., Stedman's Medical Dictionary, 25th ed.; Hensyl ed.; Williams & Wilkins: Philadelphia, 1990. Exemplary cancers include, but are not limited to, acoustic neuroma; adenocarcinoma; adrenal gland cancer; anal cancer; angiosarcoma (e.g., lymphangiosarcoma, lymphangioendotheliosarcoma, hemangiosarcoma); appendix cancer; benign monoclonal gammopathy; biliary cancer (e.g., cholangiocarcinoma); bladder cancer; breast cancer (e.g., adenocarcinoma of the breast, papillary carcinoma of the breast, mammary cancer, medullary carcinoma of the breast); brain cancer (e.g., meningioma, glioblastomas, glioma (e.g., astrocytoma, oligodendroglioma), medulloblastoma); bronchus cancer; carcinoid tumor; cervical cancer (e.g., cervical adenocarcinoma); choriocarcinoma; chordoma; craniopharyngioma; colorectal cancer (e.g., colon cancer, rectal cancer, colorectal adenocarcinoma); connective tissue cancer; epithelial carcinoma; ependymoma; endotheliosarcoma (e.g., Kaposi's sarcoma, multiple idiopathic hemorrhagic sarcoma); endometrial cancer (e.g., uterine cancer, uterine sarcoma); esophageal cancer (e.g., adenocarcinoma of the esophagus, Barrett's adenocarcinoma); Ewing's sarcoma; ocular cancer (e.g., intraocular melanoma, retinoblastoma); familiar hypereosinophilia; gall bladder cancer; gastric cancer (e.g., stomach adenocarcinoma); gastrointestinal stromal tumor (GIST); germ cell cancer; head and neck cancer (e.g., head and neck squamous cell carcinoma, oral cancer (e.g., oral squamous cell carcinoma), throat cancer (e.g., laryngeal cancer, pharyngeal cancer, nasopharyngeal cancer, oropharyngeal cancer)); hematopoietic cancers (e.g., leukemia such as acute lymphocytic leukemia (ALL) (e.g., B-cell ALL, T-cell ALL), acute myelocytic leukemia (AML) (e.g., B-cell AML, T-cell AML), chronic myelocytic leukemia (CML) (e.g., B-cell CML, T-cell CML), and chronic lymphocytic leukemia (CLL) (e.g., B-cell CLL, T-cell CLL)); lymphoma such as Hodgkin lymphoma (HL) (e.g., B-cell HL, T-cell HL) and non-Hodgkin lymphoma (NHL) (e.g., B-cell NHL such as diffuse large cell lymphoma (DLCL) (e.g., diffuse large B-cell lymphoma), follicular lymphoma, chronic lymphocytic leukemia/small lymphocytic lymphoma (CLL/SLL), mantle cell lymphoma (MCL), marginal zone B-cell lymphomas (e.g., mucosa-associated lymphoid tissue (MALT) lymphomas, nodal marginal zone B-cell lymphoma, splenic marginal zone B-cell lymphoma), primary mediastinal B-cell lymphoma, Burkitt lymphoma, lymphoplasmacytic lymphoma (i.e., Waldenstrm's macroglobulinemia), hairy cell leukemia (HCL), immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma and primary central nervous system (CNS) lymphoma; and T-cell NHL such as precursor T-lymphoblastic lymphoma/leukemia, peripheral T-cell lymphoma (PTCL) (e.g., cutaneous T-cell lymphoma (CTCL) (e.g., mycosis fungoides, Sezary syndrome), angioimmunoblastic T-cell lymphoma, extranodal natural killer T-cell lymphoma, enteropathy type T-cell lymphoma, subcutaneous panniculitis-like T-cell lymphoma, and anaplastic large cell lymphoma); a mixture of one or more leukemia/lymphoma as described above; and multiple myeloma (MM)), heavy chain disease (e.g., alpha chain disease, gamma chain disease, mu chain disease); hemangioblastoma; hypopharynx cancer; inflammatory myofibroblastic tumors; immunocytic amyloidosis; kidney cancer (e.g., nephroblastoma a.k.a. Wilms' tumor, renal cell carcinoma); liver cancer (e.g., hepatocellular cancer (HCC), malignant hepatoma); lung cancer (e.g., bronchogenic carcinoma, small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), adenocarcinoma of the lung); leiomyosarcoma (LMS); mastocytosis (e.g., systemic mastocytosis); muscle cancer; myelodysplastic syndrome (MDS); mesothelioma; myeloproliferative disorder (MPD) (e.g., polycythemia vera (PV), essential thrombocytosis (ET), agnogenic myeloid metaplasia (AMM) a.k.a. myelofibrosis (MF), chronic idiopathic myelofibrosis, chronic myelocytic leukemia (CML), chronic neutrophilic leukemia (CNL), hypereosinophilic syndrome (HES)); neuroblastoma; neurofibroma (e.g., neurofibromatosis (NF) type 1 or type 2, schwannomatosis); neuroendocrine cancer (e.g., gastroenteropancreatic neuroendoctrine tumor (GEP-NET), carcinoid tumor); osteosarcoma (e.g., bone cancer); ovarian cancer (e.g., cystadenocarcinoma, ovarian embryonal carcinoma, ovarian adenocarcinoma); papillary adenocarcinoma; pancreatic cancer (e.g., pancreatic andenocarcinoma, intraductal papillary mucinous neoplasm (IPMN), Islet cell tumors); penile cancer (e.g., Paget's disease of the penis and scrotum); pinealoma; primitive neuroectodermal tumor (PNT); plasma cell neoplasia; paraneoplastic syndromes; intraepithelial neoplasms; prostate cancer (e.g., prostate adenocarcinoma); rectal cancer; rhabdomyosarcoma; salivary gland cancer; skin cancer (e.g., squamous cell carcinoma (SCC), keratoacanthoma (KA), melanoma, basal cell carcinoma (BCC)); small bowel cancer (e.g., appendix cancer); soft tissue sarcoma (e.g., malignant fibrous histiocytoma (MFH), liposarcoma, malignant peripheral nerve sheath tumor (MPNST), chondrosarcoma, fibrosarcoma, myxosarcoma); sebaceous gland carcinoma; small intestine cancer; sweat gland carcinoma; synovioma; testicular cancer (e.g., seminoma, testicular embryonal carcinoma); thyroid cancer (e.g., papillary carcinoma of the thyroid, papillary thyroid carcinoma (PTC), medullary thyroid cancer); urethral cancer; vaginal cancer; and vulvar cancer (e.g., Paget's disease of the vulva). In some embodiments, cancer is skin cancer (e.g., basal-cell skin cancer, squamous-cell skin cancer, or melanoma).
[0145] The terms inflammatory disease and inflammatory condition are used interchangeably herein, and refer to a disease or condition caused by, resulting from, or resulting in inflammation. A chronic inflammatory disease is an inflammatory disease that causes symptoms over a prolonged period of time. Inflammatory diseases and conditions include those diseases, disorders or conditions that are characterized by signs of pain (dolor, from the generation of noxious substances and the stimulation of nerves), heat (calor, from vasodilatation), redness (rubor, from vasodilatation and increased blood flow), swelling (tumor, from excessive inflow or restricted outflow of fluid), and/or loss of function (functio laesa, which can be partial or complete, temporary or permanent). Inflammation takes on many forms and includes, but is not limited to, acute, adhesive, atrophic, catarrhal, chronic, cirrhotic, diffuse, disseminated, exudative, fibrinous, fibrosing, focal, granulomatous, hyperplastic, hypertrophic, interstitial, metastatic, necrotic, obliterative, parenchymatous, plastic, productive, proliferous, pseudomembranous, purulent, sclerosing, seroplastic, serous, simple, specific, subacute, suppurative, toxic, traumatic, and/or ulcerative inflammation. The term inflammatory disease may also refer to a dysregulated inflammatory reaction that causes an exaggerated response by macrophages, granulocytes, and/or T-lymphocytes leading to abnormal tissue damage and/or cell death. An inflammatory disease can be either an acute or chronic inflammatory condition and can result from infections or non-infectious causes. Inflammatory diseases include, without limitation, atherosclerosis, arteriosclerosis, autoimmune disorders, multiple sclerosis, systemic lupus erythematosus, polymyalgia rheumatica (PMR), gouty arthritis, degenerative arthritis, tendonitis, bursitis, psoriasis, cystic fibrosis, arthrosteitis, rheumatoid arthritis, inflammatory arthritis, Sjogren's syndrome, giant cell arteritis, progressive systemic sclerosis (scleroderma), ankylosing spondylitis, polymyositis, dermatomyositis, pemphigus, pemphigoid, diabetes (e.g., Type I), myasthenia gravis, Hashimoto's thyroiditis, Graves' disease, Goodpasture's disease, mixed connective tissue disease, sclerosing cholangitis, inflammatory bowel disease, Crohn's disease, ulcerative colitis, pernicious anemia, inflammatory dermatoses, usual interstitial pneumonitis (UIP), asbestosis, silicosis, bronchiectasis, berylliosis, talcosis, pneumoconiosis, sarcoidosis, desquamative interstitial pneumonia, lymphoid interstitial pneumonia, giant cell interstitial pneumonia, cellular interstitial pneumonia, extrinsic allergic alveolitis, Wegener's granulomatosis and related forms of angiitis (temporal arteritis and polyarteritis nodosa), inflammatory dermatoses, hepatitis, delayed-type hypersensitivity reactions (e.g., poison ivy dermatitis), pneumonia, respiratory tract inflammation, Adult Respiratory Distress Syndrome (ARDS), encephalitis, immediate hypersensitivity reactions, asthma, hayfever, allergies, acute anaphylaxis, rheumatic fever, glomerulonephritis, pyelonephritis, cellulitis, cystitis, chronic cholecystitis, ischemia (ischemic injury), reperfusion injury, allograft rejection, host-versus-graft rejection, appendicitis, arteritis, blepharitis, bronchiolitis, bronchitis, cervicitis, cholangitis, chorioamnionitis, conjunctivitis, dacryoadenitis, dermatomyositis, endocarditis, endometritis, enteritis, enterocolitis, epicondylitis, epididymitis, fasciitis, fibrositis, gastritis, gastroenteritis, gingivitis, ileitis, iritis, laryngitis, myelitis, myocarditis, nephritis, omphalitis, oophoritis, orchitis, osteitis, otitis, pancreatitis, parotitis, pericarditis, pharyngitis, pleuritis, phlebitis, pneumonitis, proctitis, prostatitis, rhinitis, salpingitis, sinusitis, stomatitis, synovitis, testitis, tonsillitis, urethritis, urocystitis, uveitis, vaginitis, vasculitis, vulvitis, vulvovaginitis, angitis, chronic bronchitis, osteomyelitis, optic neuritis, temporal arteritis, transverse myelitis, necrotizing fasciitis, and necrotizing enterocolitis. An ocular inflammatory disease includes, but is not limited to, post-surgical inflammation.
[0146] Additional exemplary inflammatory conditions include, but are not limited to, inflammation associated with acne, anemia (e.g., aplastic anemia, haemolytic autoimmune anaemia), asthma, arteritis (e.g., polyarteritis, temporal arteritis, periarteritis nodosa, Takayasu's arteritis), arthritis (e.g., crystalline arthritis, osteoarthritis, psoriatic arthritis, gouty arthritis, reactive arthritis, rheumatoid arthritis and Reiter's arthritis), ankylosing spondylitis, amylosis, amyotrophic lateral sclerosis, autoimmune diseases, allergies or allergic reactions, atherosclerosis, bronchitis, bursitis, chronic prostatitis, conjunctivitis, Chagas disease, chronic obstructive pulmonary disease, cermatomyositis, diverticulitis, diabetes (e.g., type I diabetes mellitus, Type II diabetes mellitus), a skin condition (e.g., psoriasis, eczema, burns, dermatitis, pruritus (itch)), endometriosis, Guillain-Barre syndrome, infection, ischaemic heart disease, Kawasaki disease, glomerulonephritis, gingivitis, hypersensitivity, headaches (e.g., migraine headaches, tension headaches), ileus (e.g., postoperative ileus and ileus during sepsis), idiopathic thrombocytopenic purpura, interstitial cystitis (painful bladder syndrome), gastrointestinal disorder (e.g., selected from peptic ulcers, regional enteritis, diverticulitis, gastrointestinal bleeding, eosinophilic gastrointestinal disorders (e.g., eosinophilic esophagitis, eosinophilic gastritis, eosinophilic gastroenteritis, eosinophilic colitis), gastritis, diarrhea, gastroesophageal reflux disease (GORD, or its synonym GERD), inflammatory bowel disease (IBD) (e.g., Crohn's disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, ischaemic colitis, diversion colitis, Behcet's syndrome, indeterminate colitis) and inflammatory bowel syndrome (IBS)), lupus, multiple sclerosis, morphea, myeasthenia gravis, myocardial ischemia, nephrotic syndrome, pemphigus vulgaris, pernicious aneaemia, peptic ulcers, polymyositis, primary biliary cirrhosis, neuroinflammation associated with brain disorders (e.g., Parkinson's disease, Huntington's disease, and Alzheimer's disease), prostatitis, chronic inflammation associated with cranial radiation injury, pelvic inflammatory disease, reperfusion injury, regional enteritis, rheumatic fever, systemic lupus erythematosus, schleroderma, scierodoma, sarcoidosis, spondyloarthopathies, Sjogren's syndrome, thyroiditis, transplantation rejection, tendonitis, trauma or injury (e.g., frostbite, chemical irritants, toxins, scarring, burns, physical injury), vasculitis, vitiligo and Wegener's granulomatosis. In certain embodiments, the inflammatory disorder is selected from arthritis (e.g., rheumatoid arthritis), inflammatory bowel disease, inflammatory bowel syndrome, asthma, psoriasis, endometriosis, interstitial cystitis and prostatistis. In certain embodiments, the inflammatory condition is an acute inflammatory condition (e.g., for example, inflammation resulting from infection). In certain embodiments, the inflammatory condition is a chronic inflammatory condition (e.g., conditions resulting from asthma, arthritis and inflammatory bowel disease). The compounds may also be useful in treating inflammation associated with trauma and non-inflammatory myalgia. The compounds disclosed herein may also be useful in treating inflammation associated with cancer.
[0147] A microorganism refers to a single-celled organism, or a colony of such cells. In some embodiments, the microorganism is a eukaryote. In certain embodiments, the eukaryote is a species of yeast. In some embodiments, the microorganism is a prokaryote. In certain embodiments, the prokaryote is a species of cyanobacteria or a species of bacteria from the human microbiome. In certain embodiments, the prokaryote is E. coli. A recombinant microorganism refers to a microorganism that has been genetically altered to express one or more heterologous genes. The genome of the microorganism may be altered, for example, by genetic engineering techniques. In some embodiments, the microorganism is transformed with a vector comprising one or more heterologous genes (e.g., heterologous nucleic acid encoding one or more MAA biosynthetic enzymes, as described herein).
[0148] The term cyanobacteria refers to members from the group of photoautotrophic prokaryotic microorganisms which can utilize solar energy and fix carbon dioxide. Cyanobacteria are also referred to as blue-green algae. The cyanobacteria species of the present invention can be selected from the group consisting of Synechocystis, Synechococcus, Anabaena, Chroococcidiopsis, Cyanothece, Lyngbya, Phormidium, Nostoc, Spirulina, Arthrospira, Trichodesmium, Leptolyngbya, Plectonema, Myxosarcina, Pleurocapsa, Oscillatoria, Pseudanabaena, Cyanobacterium, Geitlerinema, Euhalothece, Calothrix, and Scytonema.
[0149] The term human microbiome refers to the aggregate of all the microorganisms that reside on or within human tissues. In some cases, the human microbiome refers specifically to all of the species of bacteria that reside on or within human tissues. Species of human microbiome bacteria for use in the present invention can be selected from the group consisting of, but not limited to, Achromobacter, Acidaminococcus, Acinetobacter, Actinomyces, Aeromonas, Aggregatibacter, Acidaminococcus, Anaerobiospirillum, Alcaligenes, Arachnia, Bacillus, Bacteroides, Bacterionema, Burkholderia, Bifidobacterium, Buchnera, Butyriviberio, Campylobacter, Capnocytophaga, Candida, Clostridium, Chlamydia, Chlamydophila, Citrobacter, Cornybacterium, Cutibacterium, Demodex, Eikenella, Epidermophyton, Enterobacter, Enterococcus, Escherichia, Eubacterium, Faecalibacterium, Flavobacterium, Fusobacterium, Gingiva, Gordonia, Haemophilus, Lactobacillus, Leptotrichia, Malassezia, Methanobrevibacter, Morganella, Mycoplasma, Microbacterium, Micrococcus, Moraxella, Mycobacterium, Mycoplasma, Neisseria, Peptococcus, Peptostreptococcus, Plesiomonas, Porphyromonas, Propionibacterium, Providencia, Pseudomonas, Ruminococcus, Rothia, Ruminococcus, Sarcina, Staphylococcus, Streptococcus, Torulopsis, Treponema, Trichophyton, Veillonella, Vibrio, Wolinella, and Yersinia.
DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS
[0150] The aspects described herein are not limited to specific embodiments, systems, compositions, methods, or configurations, and as such can, of course, vary. The terminology used herein is for the purpose of describing particular aspects only and, unless specifically defined herein, is not intended to be limiting.
Methods for Producing a Compound
[0151] In one aspect, provided herein are methods for producing a compound comprising a) culturing a recombinant microorganism under conditions suitable for production of the compound; and b) isolating the compound from the recombinant microorganism. In some embodiments, the recombinant microorganism comprises a heterologous nucleic acid encoding (e.g., that encodes) one or more mycosporine-like amino acid (MAA) biosynthetic enzymes, wherein the one or more MAA biosynthetic enzymes comprise a phytanoyl-CoA dioxygenase (MysH), or a homolog thereof.
[0152] Exemplary MysH enzymes for use in the present invention include, but are not limited to, those of SEQ ID NOs: 1-11, or an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of any one of SEQ ID NOs: 1-11:
TABLE-US-00001 A0A1Z4LFF0 (SEQIDNO:1) MASLENQIILITGASSGIGTACAKIFAGAGAKLILAARRLERLQQLADILTQDENTEVH LLELDVRDRSAVESAISNLPASWSDIDILINNAGLSRGLDKLHEGSFTDWEEMIDTNIK GLLYLSRYVVPGMVSRGRGHVVNLGSIAGHQTYPGGNVYCATKAAVRAISEGLKQ DLLGTPVRVTSVDPGMVETEFSQVRFHGNAQRANQVYQGVTPLTPDDVADVIFFCV TRSPHVNINEVVLMPVDQASATLVNRRT A0A367QPY5 (SEQIDNO:2) MLKVDTLKISSQQVEAFERDGVICVKNALDDIWVERLRTAVDRNISIPGPLEEKNAPR PEGSVEHASSLWLVDADFRALAFESPLPTLAAQVLKSEKLNFLADGFFVKKPKTNGH IGWHNDLPYWPVQGWQCCKIWLPLDTVKQENGRLEYIKGSHQWGKELRERSNPSW FVEPEPHEILSWDMEAGDCLIHHFLTIHHSVTNISSTQRRAIVTNWTGDDVTYYQRPK AWPFKPLEEIDLPEFNSFKTKKVGEPIDCDIFPRVEVFR A0A2Z6D3B5 (SEQIDNO:3) MLKLELPKITLQEIEAFEQDGVICVKNVLDNIWVERMRKAVDKNISIAGPLEVKGISK PEGNVEHTNSLWLVDADFRALVFESPLATLAAQILKSTKLNFLADGFFVKQPKATSR VGWHNDLPYWPIQGWQCCKIWLALDKVNQQNGRLEYIKGSHRWGKELREDSNPA WFSQPESHELLSWDMEPGDCLVHHLLTIHHSVTNISSTQRRAVVTNWTGDDVTYYP RPKAWPFRPLDEIDIPEFDSLKAKKPGEPIDCDMFPKIKWHR A0A2T1LWM2 (SEQIDNO:4) MLIANSSKISRQEVENFKRDGVICLKNVVDDYWVERMRKAVDRNLLNSNGVRGRK LKTGDVVHDYGLWLKDNDFRDLVFKSPLARVAAQIMESETINFLCDGFFVKKAKAD SHVGWHNDLPYWPVKGWKCCKIWLALDPVNQENGRLEYIKGSHLWNKDLRENSN VSWFSEPSYSDILYWDMEPGDALVHHFQTIHHSIGNTTYKSRRAIVTNWTGDDVVY DPSPQTWPFQPIEEIGISEFNSLDTLRSGESIDCEIFPKIDLTPSPSPTSRGEQNPNFLKFP HRL A0A2L2NS52 (SEQIDNO:5) MLKVDTSKITTQQVEAFERDGVICVKNVLDDIWVERMRRAVDKNVLIPGPLEVKGIP RAEGHVEHTSSLWLTDADFRALAFESPLATLTAQVLKSKKLNFLGDGFFVKKPKGET GVGWHNDKSYWPIQGWQCCKIWLALDSVNQENGKLEYIKASHLWGKELREASDPS WFVEPEPHEIISWDMEPGDCLVHHFMTIHHSVRNTSSTRRRAVVINWTGDDVTYERR PNAWPFRPLEEIDIPEFESLKAKKSGEPIDCDIFPRVELHR A0A2C6TQQ8 (SEQIDNO:6) MLKVDTPKISPQQVEAFERDGVICVKNALDDIWIERMRKAVDKNISIPGPLEGKNTPK KEASAEHTSSLWLVDADFRALAFESPLPKLAVGVLKSEKLNFLADGFFVKRPEANGR IGWHNDLPYWPVQGWQCCKIWLALDTVKQENGRLEYIKGSHQWGRELRERSNPSW FVEPEPHEILSWDMEAGDCLIHHFLTIHHSVTNKSSTQRRAIVTNWTGDDVTYYQRP KAWPFKPLEEIDLPQFNSLKTKKFGEPIDCDIFPRVEVHRHRTHI A0A252E419 (SEQIDNO:7) MLKIDTLKISLQQIEAFERDGVICLRNVLDESWVERMRTAVDKNVSIPGPLEVKGISR PEASVEHTSSLWLVDPDFRALVFESPLSTIAAQLLRSEKLNFLADGFFVKKPKATSRV GWHNDLPYWPIQGWQFCKIWLALDNVNEENGRLEYIKGSHQWGKELREDSNPSWF VEPEPHELLSWDMEPGDCLVHHLLTIHHSVTNISSRQRRAVVTNWTGDDVTYYPRL KAWPFRPLEEIDLPEFNSLKTKKTGEQIDCYMFPPIQLHR A0A1Z4LFC6 (SEQIDNO:8) MLKVDTQKISPQQVEAFERDGVICVKNAVDDIWVERMRTAVDKNISIPGPLEDKNVP KPQGSAEHASSIWLIDADFRALAFESPLPTLAAQVLKSKKLNFLADGFFVKKPESNGR IGWHNDLPYWPVQGWQCCKIWLALDTVKQENGRLEYIKGSHQWGKELRERSNPSW FIEPEPHEILSWDMEAGDCLIHHFLTIHHSVTNISSTQRRAIVTNWTGDDVTYYQRPK AWPFKPLEEIDLPEFNSLKTKKSGEPIDCDIFPRVQVHR A0A1Z4IIA4 (SEQIDNO:9) MLKLDLPKITLQEIEAFEQDGVICVKNVLDNIWVERMRKAVDKNLSIAGPLEVKGIT KPEGNVEHSNSLWLVDTDFRALVFESPLANLAAQFLKSTKLNFLADGFFVKQPKASS RVGWHNDLPYWPIQGWQCCKIWLALDKVNQQNGRLEYIKGSHRWGKELREDSNPS WFSEPEPHELLSWDMEPGDCLVHHLLTIHHSVTNISSTKRRAVVTNWTGDDVTHYP RPKAWPFRPLDEIDIPEFDSLKAKKPGEPIDCDMFPKIKWHR A0A1Z4HWL1 (SEQIDNO:10) MLKIDTSKISFQQIGAFERDGVICLRNVLDENWVERMRTAVDKNVSINGPLEAKGISR AEASVEHTSSLWLVDPDFRALVFESPLSTIAAQLLQSEKLNFLADGFFVKKPKATSRV GWHNDLPYWPIQGWQCCKIWLALDHVNEKNGRLEYIKGSHKWGKELREDSNPLWF VEPEPHELLSWNMEPGDCLVHHLLTIHHSVTNISSTQRRAVVTNWTGDDVTYYPRPK AWPFRSVEEIDLPEFNSLKTKKTGEPIDCDMFPQVQLH A0A1U71924 (SEQIDNO:11) MLKVDTRKISHQQVEAFERDGVICVKNAVDDIWVQRMRTAVDKNVLIPGPLEEKNA PKPEASAEHTSNLWLVDADFRALAFESPLPTLAVQVLKSKKLNFLADGFFVKKPKSN SRIGWHNDLPYWPIQGWQCCKIWLALDTVNQENGRLEYIKGSHRWGKELRERSNPS WFVEPKPHEILSWDMEAGDCLIHHFLTIHHSVTNISSRQRRAVVTNWTGDDVTYYQR PKAWPFKSIEEIDLPQFNSFKTKKSGEPLDCDIFPRIEVHR
[0153] Biosynthetic enzymes other than MysH may also be encoded by the recombinant microorganism used in the methods disclosed herein. In some embodiments, the one or more MAA biosynthetic enzymes further comprise a D-alanine-D-alanine ligase (MysD), or a homolog thereof. Exemplary MysD enzymes for use in the present invention include, but are not limited to, the amino acid sequence of SEQ ID NO: 12, or an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 12:
TABLE-US-00002 A0A1Z4LFR3 (SEQIDNO:12) MPVLRILHLVGSAQDDFYCDLSRLYAQDCLAAMAELPYDSAIAYITPDGQWRFPRSL SREDIAQAKPMPVSEAIEFIAAQNIDIVLPQMFCIPGMTYYRALFDLLEIPYIGNTPDL MAITAHKARTKAIVEAAGVKVPRGEVLRRGDVPTITPPVVIKPVSSDNSLGVTLVKD AAEYEAALEKAFEHGDEAIVETFIEGREVRCGIIVKDGELIGLPLEEYLIDSQEKPIRTY ADKLKKTDDGSLGFAAKGNNKSWILDPNDPITQKVQEVAKKCHQALGCRHYSLFDF RIDSQGQPWFLEAGLYCSFAPKSVISSMAKAVGIPLNELLTIAIAETLGSNKYSDRISV VEINEPSKTPRKERELSQMI
[0154] In some embodiments, the one or more biosynthetic enzymes comprise an ATP-grasp enzyme (MysC), or a homolog thereof. Exemplary MysC enzymes for use in the present invention include, but are not limited to, the amino acid sequence of any one of SEQ ID NOs: 13-104 and 113-116, or an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of any one of SEQ ID NOs: 13-104 and 113-116:
TABLE-US-00003 A0A0Q2QHP0 (SEQIDNO:13) MSGVRVHRIWDAGPGRTVAALAALCATLPVDLAVVLVALLVGRQPPRGRLPAEAR RTVLLNGGKMTKALQLARSFHLAGHRVILVESAKYRWTGHRFSRAVDAFYCVPEPG TPGYAPALLNIVRYENVDVYVPVSSPAGSVPDAVARELLDGACDVVHSDAKTVQLL DDKAEFASTAASLSLQVPDSHRITDARQVADFPFPPGRSYILKRIAYNPVGRMNLTRL SAATPDRNAAYARSLSISEDDPWILQEFIEGREYCTHGTARSGRLQVYGCCESSAAQ VNYRSVDKPEIRRWVETFVKNLNLSGQVSFDFIEAHDGQVYAIECNPRTHSAITMFH DHPDLAAAYLNDGHPLITPKHNSRPTYWIYHELWRLLRHPGRLGRLATILRGTDAIFT GWDPVPYLMVHHLQIPALLWANLRVGKGWSRIDFNIGKLVENGGD A0A3S0TU06 (SEQIDNO:14) MGRTLATLVVLFGTLPFDLALVLVALLAGRRPSRGRLPAQARRTILLNGGKMTKAL QLARSFHLAGHRVILVESEKYRWTGHRFSRAVDAFYCVPEPTEPGYALALLDIVRYE NVDVYVPVSSPAGSVPDAVARELLDGACDVVHSDAKTVQLLDDKAEFASTAASLSL RVPDSHRITDARQVVDFAFPAGRSYILKRIAYDPVGRMNLTRLSGATPDHNAAYARS LPISEDDPWILQEFIEGREYCTHGTARSGRLQVYGCCESSSAQVNYRNVDKPEIRRWV ETFVKNLNLSGQVSFDFIEARDGQVYAIECNPRTHSAITMFHDHPDLAAAYLDDNHP LITPNDGARPTYWIYHELWRLLRHRGRISRLVTMLRGKDAIFAGWDPMPYLMVHHL QIPALLWANLRAGKGWSRIDFNIGKLVENGGD A0A5A7SAT3 (SEQIDNO:15) MREVFQAKTIGTLALLQVVLPLNLALTTFALLRGVFVAPPPVAVAAQRKTILVSGGK MTKALQLARSFHAAGHRVVLVESSKYRFNGHRFSRAVDRFYTVPAPDSDNYAVALL AVVRAEEVDVYVPVCSPVASYYDALAKDQLSPHCEVLHCDADMVARLDDKYEFFA LVASLGLSTPETHRVTAPGQVEEFDFTGTDYILKSIPYDPVHRRDMTTVPRPTATETT TYARSKPITEATPWIMQEFVRGQEYCTHSLVRDGAVQVFCCCESSAFQINYRMVDKP EIEEWVGEFAQRLNLTGQVSFDFIQGDDGRLHAIECNPRTHSAITMFYDHPDLARAY LERGVPVVKPLPHSKPTYWIYHELWRLVTQRGGRAHRLAVIAQGKDAIFDWDDPLP FLLVHHLQIPSLLLSNLLRRKGWTGIDFNIGKLIEAAGD A0A0G4HZ53 (SEQIDNO:16) MCRVETRPQVGEHAGMESVPLKAAEGGLVEERKAFLPQSYSLWKDSIEGRLWSLLT LFGLFISSPFLFAFVALSVLSAVVRKLLRLPAARKLPEGSNKGRGRTALVTGGKMTKS LDVCRHLKNEGFRVILTETPRYWMSASRFSSAVDKFVVLPVAPETHPEGYVEALRNL FEKENVSLFAPVCSPFSSLYDAKAAESLPEGAISWSLPAEMVQQLDDKVEFARMAKE VGLPVPDTLRVESKEEVRRFNSELAEKWRRDSSSAIASGAEKKKTDCRRYILKTLDY DPMRRLDLFTLPCGPKELEKYLDETTISPDRPWLVQEFLEGREYSSCALSWKGKLLA FTDNEAVISCYNFKYAGRDKIQEWVRVFCEKYQLSGVICVDFFERADGTQLAIECNP RFSSNMTAFYNNPRLGAAMADPDLALRSGVTETPLPSSKESNWTLVDLYFHSYTQM MKNPLAAFTAAAGLLLVSEETKEKQDAYWAPEDPLPSLALHCFHMPALLVRNVWD GRKWAKIDFCIGKMTEENGD R1G4T9 (SEQIDNO:17) EVKPNGKVAIVSGGKMTKAYVIARQLKAQGCRVVLLETSKYWMVASRASNCVDRF AMVPLPEKDLAGYLDAVRALAIEEKADLFIPVTSPAASEYEAQVAPVLPAGCVSWSL DLETVRDLDDKTAFCSSAERLGLPAPRSHRVASDEEAHAFNEKLLAEAATATAGAET RYILKSLAYDSMHRLDLFTLPCAPDNPWIIQTFVVGDEYSTCALVKEGRLLAFTDNR ACLSCFNYTPARSEALRSWVRDFCAARRLSGVVCIDFIVDAQSGTPYAIECNPRFSSN VLNLFWNPPFGGALFRPHKGGGVEAFFWPPPPPPPLQIWALLSKRPFSLRSAGALLST VATKKDAYFDVADPLPFIAHLFVHIPALLARNLSTGNKWAKIDPCIGKLTEENGD A0A433W0B3 (SEQIDNO:18) MLLPQSITPTMQIFAVFQNLGTLLLLAIAFPFNCIVVLTALLWNLVSKPFRDRGILPVH PKNIMLTGGKMTKALQLARSFHMVGHRVVLVETHKYWLTGHRFSNAVDRFYTVPA PEKDPEAYSQALLAIAKQENIDVYVPVCSPVASYYDSVAKSVLSGCCEVFHFDAEVT QMLDDKYEFAEKARSLGLSVPKSFKITNPEQVINFDFSDAERPYILKSIPYDSVRRLNL TKLPCATPAETAAFVNSLPISPEKPWIMQEFIPGQEYCTHSTVRNGELRMHCCCESSA FQVNYENVDKPEILAWVRHFVKELGITGQASFDFIQAEDGNVYAIECNPRTHSAITMF YNHPGVADAFCRDVTCNTSTSRAGLLNSSFINNISGEPAPTIYPLQPLSTSKPTYWTY HELWRLTGIRSFPQLQTWCKNILRGKDAIFAIDDPLPFLMVHHWQIPLLLLDNLRRLK GWIRIDFNIGKIVELGGD A0A139WZN8 (SEQIDNO:19) MTQSISFSSPVPATPPISVKARFIALFQNLGTLTLLLLALPVNAVIVVISLVWNSLTRLF STQQTTVARSKNILISGGKMTKALQLARSFGAAGHRVVLIETHKYWLSGHRFSNAVS RFYTTPTPQYDPEAYIQTLIDIVKRENIDVYVPVTSPVASYYDSLAKPALSPYCEVLHF DADVTKMLDDKFAFSEKARDLGLSVPKSFKITNPEQVLNFDFSQETRKYILKSIPYDS VRRLDLTKLPCDTLEETAAFVKSLPISPEKPWIMQEFIPGKEFCTHSTVRNGELRLHCC SESSAFQVNYENVENPEIQAWVKHFVNGLGFTGQVSFDFIQTDDGKVYAIECNPRTH SAITMFYNHPQVSDAYLGTEPLTEPLQPLPNSKPTYWLYHEVWRLTGIRSFSQLQNW VRNIFRGTDAIYKLHDPLPFLTVHHWQIPLLLLNNLWQLRGWTKIDFNIGKLVEFGG D A0A2Z5X784 (SEQIDNO:20) MLCPYERLVFCLKEKLMTQSIPLSFSQPTTPLTVVKTKIVALFKTLGTLALLLLALPLN GFVVLISLLWVIVRNPFTKPTAVAAHPQNILVSGAKMTKALQLARSFHAAGNRVILIE GHKYWLSGHRFSNAVSRFYTVPAPQDDPESYTQALLEIVKKEKIDVYIPVCSPVASY YDSLAKPVLSEYCEVFHFDADITAMLDDKFAFTDQARSLGLSVPKSFKITDPEQIINFD FSQETRKYIIKSISYDSVRRLNLTKLPCDTPEETAAFVRSLPISPEKPWIMQEFIPGKEL CTHSTVRDGELRLHCCSNSSAFQINYENVENPQIREWVQHFVKSLRLTGQVSFDFIQA EDGTVYAIECNPRTHSAITMFYNHPGVAQAYLGKTPQAAPLEPLADSKPTYWLYHEI WRLTSIRSWKHLQTWFKNLVRGTDAIYSMDDPIPFLTLHHWQITLLLLQNLQQLKG WVKIDEN A0A1Z4GTP3 (SEQIDNO:21) MAQSISLSLPSSTTPSTGVRVKIVALFKTLGTLTLLLIALPFNALIVLIALLWGIARSPF TKKAVVAANPQTILVSGAKMTKALQLARSFHAAGHRVILIEGHKYWLSGHRFSQAV SRFYTVPAPQSDPEAYIQALVEIVKKEKVDIYVPVCSPVASYYDSLAKPTLSEYCEVF HFDADITKMLDDKFAFTDKARSLGLSVPKSFKITDPQQVINFDFSQETRKYILKSIAYD SVRRLDLTKLPCDSPEETAAFVNSLPISPENPWIMQEFIPGKEFCTHSTVRDGELRLHC CCHSSAFQINYENVENPQIREWVQQFVKSLRLTGQVSFDFIQAEDGTVYAIECNPRTH SAITMFYNHPGVAEAYFGKTPLAAPLEPLASSKPTYWIYHEIWRLTNIRSWKQLQTRL NILFRGTDAIFRLNDPVPFLTLHHWQIPLLLLQNLQKLKGWVKIDFNIGKLVELGGD A0A1Q4RU46 (SEQIDNO:22) MAQSISLSSPAKTHAPGISASSLKTLGTLTLLLLALPLNASLVLVALLLKSLRPQNVTT EEPKNILISGGKMTKALQLARSFHEQGHRVILLEAHKYWLTGHRFSFAVNKFYTVEA PEKDPEGYIQSLVNIVEKENIDVYVPVCSPVASYYDSLAKKALPQCEVIHCDAEMTQ MLDDKYAFAQTAQSFGLSVPKSFKITEPEQVINFDFSQEKRKYILKSIPYDSVRRLDLT KLPCDTPEATAAFVRSLPISPEKPWIMQEFIPGKEYCTHSTVRNGVITLHCCCESSAFQ VNYENVDNPKIFEWVSRFVKELGITGQVSFDFIEAEDGNIYAIECNPRTHSAITMFYN HPGVADAYLGTGSNLAEPIQPKSTSKPTYWTYHEVWRLITTRSWSDFVYRFKIITHG KDAIFSWQDPLPFLMNPHWQIFLLLIQNLQKNRGWVRIDFNIGKLVELGGD A0A0C2R3C6 (SEQIDNO:23) MAQSLPLTSAGGATSPTAFVAQVKALFQNIATLTILLLVLPINAAIVLTSLFWSRVSRF VRPQTVVAANRKNILISGGKMTKALQIARSFHAAGHRVVLIETHKYWLSGHRFSDAI SRFYTTPTPQYDPEAYIQALLDIVKKENIDVYVPVTSPVASYYDSLAKPALSPYCEVF HFDADVTQMLDDKFAFSEKARSFGLSVPKSFKITNPEQVLNFDFSGETRKYILKSIPY DSVRRLDLTKLPCDTPEETAAFVRSLPISPEKPWIMQEFIPGKEFCTHSTVKNGELRLH CCAESSAFQVNYENVENPKIQEWVRHFVKELGITGQVSFDFIQAEDGTVYAIECNPRT HSAITMFYNHPDVADAYLSEEPFTEPLVPLPNSKPTYWTYHEVWRLTGIHSFAQLQT WIRNFLQGTDAIYQLDDPLPFLMVHHWQIPLLLLNNLRQLKGWTKIDFNIGKLVEIG GD A0A2R5FKA4 (SEQIDNO:24) MRKYIFVVFQNLGTLVLLAIAFPLNCIVVLTSLLWNFLKQPFNKSIVVNPNSKNILIAG ARMTKTLQLARSFHAAGHRVIIIDIEKFWSSGNKYSNSVAGFYTVPDPSKDLEGYVES LHAIAKTEKIDFFIPVAIFSVIHYDQGQPPLPDFVEFFHFDADVTKILDDKFAFAETARS FGLSVPKSFKITHPEQVINFDFSHEKRKYILKSIPYDQIRRLNLTKLPCATSAETAAFVN SLPISEENPWIMQEFIPGKEYCTHTTARDGESRMYCCCESSAFQVNYENVDQQEIMQ WATHFTKELGKTGQLSFDFIQAEDGTVYAIECNPRTHSAITMFYNHPGVADAYLGKE PLAESLQPLADSKPTYWLYHEVWRLNEIRNFEQLQTWVRNIRRGKEAIFEVSDPLPFL MVHHWQIPLLILDNLRRLKGWIRIDFNMGELIE A0A0M0SH70 (SEQIDNO:25) MTQSISVASPAPKTQSVPLGLRISALWKNVGTLALLLLVLPINAVIVLVSLLLGHQSQ AIATEPKNILISGAKMTKALQLARSFHAAGHRVVLVETHKYWLTGHRFSKAVSRFYT VPTPQSDPEAYTQALLDIVKTENIDVYVPVCSPIASYYDSLAKPVLSKFCEVFHCDAD VTQMLDDKYAFAEKARSLGLSVPKSFKITDPEQILNFDFSQEKRQYILKSIPYDSVRR LDLTKLPCETPEATADFVNSLPISPQKPWIMQEFIPGKEYCTHSTVRNGELRMHCCCE SSAFQVNYENVDHPQILEWVRHFVKALGITGQVSFDFIQAEDGTIYAIECNPRTHSAIT MFYNHPHVADAYLSEIPQLEPIQPLTNSKPTYWTYHEIWRLTGIRSFSQLQTWLKTFF GGKDAIYCFSDPLPFLTVHHWQIPLLLLQNLQQLKGWIRIDFNIGKLVEFGGD A0A2T1F866 (SEQIDNO:26) MLLPQSITPTMQIFAVFQNLGTLLLLAIAFPFNCIVVLTALLGNLVSKPFRDRGILPVS HPKNIMLTGGKMTKALQLARSFHMVGHRVVLVETHKYWLTGHRFSNAVDRFYTVP APEKDPEGYSQALLAIAKQENIDVYVPVCSPVASYYDSVAKSVLSGCCEVFHFDAEV TQMLDDKYEFAEKARSLGLSVPKSFKITNPEQVINFDFSDAERPYILKSIPYDSVRRLN LTKLPCATPAETAAFVNSLPISPEKPWIMQEFIPGQEYCTHSTVRNGELRMHCCCESS AFQVNYENVDKPEILAWVRHFVKELGITGQASFDFIQAEDGNVYAIECNPRTHSAIT MFYNHPGVADAFCRDVTCNTSTSRAGLLNSSFINNISGEPAPTIYPLQPLSTSKPTYW TYHELWRLTGIRSFPQLQTWCKNILRGKDAIFAIDDPLPFLMVHHWQIPLLLLDNLRR LKGWIRIDFNIGKIVELGGD A0A367QNV7 (SEQIDNO:27) MAQSISVSSSPAIPSFPSETKIAVIIQNLLTLALLLLALPINATIVLVTLLWHTISRPFQQP ATKAANPKNILISGGKMTKALQLARSCNAAGHRVVLIETHKYWLSGHRFSQAVDKF YTVPAPQENPERYTQALIDIIKQENIDVYIPVTSPLGSYYDSLAKPLLSKYCEVFHFDA DITERLDDKFAFAETARSLGLSVPKSFKITKAEQVLNFDFSQESRKYILKSIPYDSVRR LDLTKLPCATPEETAAFVRSLPISPEKPWIMQEFIPGKEFCTHSTVRDGELRLHCCCES SAFQVNYENVENSQIREWVRHFVKELKLTGQVSFDFIQAEDGKVYAIECNPRTHSAIT TFYDHPQVAQAYLDNEPMAQTLQPLPSSKPTYWTYHEVWRLTGIRSLTQFKKWIANI WRGTDAIYKSDDPLPFLMVHHWQIPLLLIKNLRQLKGWTRIDFNIGKLVELGGD A0A2N6JWS5 (SEQIDNO:28) MAQLQSIQASIFAVLQNLGTLALLMIAFPFNCIVVLLSLLLNFLSRPFHKPVILTKNPR NIMIAGARMTKTLQLARSFHAAGHRVILVDTEKFWLSGNQFSHAVAGFYTVPDPHK DLEGYTQALRAIAKKENIDFFIPVAIFAVIYYDSMSQHQLFDCCEVFHFNADVTKMLD DKFAFAEKARSLSLSVPKSFKITAPEQILNFDFSNEKRKYILKSIPYDAVRRLNMTLLP CDTPEQTAAFVKSLPISEEKPWIMQEFIPGKEYCTHSTVRDGKQTIYCCCESSAFQVN YENVDKPEILQWVNHFVKELGLTGQISFDFIQAVDGTVYVIECNPRTHSAITMFYNHP GVADAYLSKQPLAEPLQPLSDSKPTYWLYHEVWRLNEIRSLKQLQTWIKNILRGKDA IFTVNDPLPFLMVHHWQIPLLLLDNLRRLKGWIRIDENPLLSL B4VP63 (SEQIDNO:29) MTNSLILAVLQNLGTLTLLAIAFPFNLTVVVVALVWDSLTRPFQNPKVANPNPKTIM LTGGKMTKSLQLARSFYADGHRVILVESHKYWLVGHRFSRAVDRFYTVPAPNKDPD GYMEGLLAIAKQENVDVYVPVCSPVASYYDSLAKPVLSGCCEVFHFDPDVTQLLDD KFAFAQKAREFGLSVPKSFKITDPQQVIDFDFRGEKRKYILKSIPYDSVRRLNLTKLPC KTPSETAAFVKSLPISEDKPWIMQEFIPGKEYCTHSTVRNGELRLHCCCESSAFQVNY ENVDQPDILQWVSRFVQGLNLTGQASFDFIKTEDGIVYAIECNPRTHSAITMFYNHPG VAEAYLSDTPLPEPLQPLPESKPTYWLYHEVWRLNEIRSFGDIRRWFKTVFGGKDAIF QVNDPLPFLMVHHWQIPLLLLDNLRRMQGWIRIDFNIGKLVELGGD K9QUQ5 (SEQIDNO:30) MAQSISFDSSPATPSLGLETKIAAIIQNILTLALLLLALPINAIIVCIALVLGTIFRPQTTK TSNPKNILISGGKMTKALQLARSFHADGHRVVLLETHKYWLTGHRFSQAVDKFYTT PAPQKKPEDYIKALVDIVKRENIDVYIPVTSPVGSYYDSLAKPELSHHCEVFHFDAEIT QMLDDKFAMAEKARSLGLSVPKSFKITSGEQVINFDFSRETRKYILKSIAYDSVRRLD LTKLPCATPEETAAFVRKLPISPEKPWIMQEFIPGKEFCTHSTVRDGEIRLHCCCESSA FQVNYENIENPQILEWVRHFVKELKLTGQISFDFIQTEDGQVYAIECNPRTHSAITTFY NHPQVAEAYIGKQPMAETLQPLATSKPTYWTYHEIWRLTGIRSFTQLKTWLKNIWR GTDAILQLHDPLPFLMVHHWQIPLLLLNNLRQLKGWTRIDFNIGKLVEFGGD A0A0S3U2V2 (SEQIDNO:31) MLNKLIAALQNLLTLTALLITLPINLAIVLIASLIGLFQRETIPQSNSPKRILITGGKMTK ALQLARSFHAAGHFVVLVETQKYWLTGHQFSNAVDRFYTVPAPKQDSEAFIQALVD IVQRENIDFFVPVTSPIESYYCSLAKPELSKYCEVLHFDVGITQLLDDKFELSEKARSL NLTAPKTYRITDPQQVLDFEFDSSQYILKSIAYNSVHRLDMTKYPLESKAAMKAHLA TLPISEDNPWILQEFISGQEYCTHSTVRDGKVRLHCCAKSSAFQVNYEQVENSEIQAW VTTFVKALNLSGQISFDFIESSSGEVYAIECNPRTHSAITMFYNHPDVAKAYLGEPLTV EPIQPLPTSKPTYWTYHEVWRLITGDRPLYRLQTILHGKDAILQTSDPIPFLMVHHWQI PLLLLNNLRHLKGWVRIDFNIGKLVELGGD K9TVZ3 (SEQIDNO:32) MLLPQSITPTMQIFAVFQNLGTLLLLAIAFPFNCIVVLTALLWNLVSKPFRDRGILPVS HPKNIMLTGGKMTKALQLARSFHMVGHRVVLVETHKYWLTGHRFSNAVDRFYTVP APEKDPEAYSQALLAIAKQENIDVYVPVCSPVASYYDSVAKSVLSGCCEVFHFDAEV TQMLDDKYEFAEKARSLGLSVPKSFKITNPEQVINFDFSDAERPYILKSIPYDSVRRLN LTKLPCATPAETAAFVNSLPISPEKPWIMQEFIPGQEYCTHSTVRNGELRMHCCCESS AFQVNYENVDKPEIIAWVRHFVKELGITGQASFDFIQAEDGNVYAIECNPRTHSAITM FYNHPGVADAFCRDVTCNTSTSRAGLLNSSFINNISGEPAPTIYPLQPLSTSKPTYWTY HELWRLTGIRSFPQLQTWCKNILRGKDAIFAIDDPLPFLMVHHWQIPLLLLDNLRRLK GWIRIDFNIGKIVELGGD A0A2N6MZD6 (SEQIDNO:33) MAQLQSIQASIFAVLQNLGTLALLMIAFPFNCIVVLLSLLLNFLSRPFHKPVILTKNPR NIMIAGARMTKTLQLARSFHAAGHRVILVDTEKFWLSGNQFSHAVAGFYTVPDPHK DLEGYTQALRAIAKKENIDFFIPVAIFAVIYYDLMSQHPLFDCCEVFHFNADVTKMLD DKFAFAEKARLLSLSVPKSFKITAPEQILDFDFSNEKRKYILKSIPYDAVRRLNMTLLP CDTPEQTAAFVKSLPISEEKPWIMQEFIPGKEYCTHSTVRDGKQTIYCCCESSAFQVN YENVDKPEILQWVNHFVKELGLTGQISFDFIQAVDGTVYAIECNPRTHSAITMFYNHP GVADAYLSKQPLAEPLQPLSDSKPTYWLYHEVWRLNEIRSLKQLQTWVKNILRGKD AIFTVNDPLPFLMVHHWQIPLLLLDNLRRLKGWIRIDFNIGELIE A0A218PXL8 (SEQIDNO:34) MAQSISLSLAKSPGSSTGVWVKLVALFKTLGTLTLLLIALPFNALIVLISLLWGFVRSP FRQKAVVADHPQTILVSGAKMTKALQLARCFHAAGHRVILIEGHKYWLSGHRFSKA VSGFYTVPAPELDPLGYIQALVEIVKKEKVDVYVPVCSPVASYYDSLAKPALSEYCE VFHFDADVTKMLDDKFAFTDQARSLGLSVPKSFKITDHQQVINFDFSQETHKYILKNI AYDSVRRLNLTKLPCDTPEETAAFVNSLPISEENPWIMQEFIPGKELCTHSTVRDGEL RLHCCSDSSAFQINYENVENPQIREWVQHFVKSLALTGQVSFDFIQAESGTVYAIECN PRTHSAITMFYNHPGVAEAYLGKTPLTDLTEPLANSKPTYWIYHEIWRLTGIRSWKQ LQTSINTLAQGTDAVYQLDDPIPFLTLHHWQIPLLLLKNLQQLKGWVKIDFNIGKLVE LGGD A0A1Z4HW63 (SEQIDNO:35) MAQSISLSLPESTTPATSVGVKIAALFKTLGTLTLLLIALPFNALIVLIALLWGIVRSPF TKKAVVAAHSQTILVSGAKMTKALQLARSFHAAGHRVILIEGHKYWLSGHRFSQAV SRFYTVPAPQSDSEGYIQALVEIVKQEKVDIYVPVCSPIASYYDSLAKPALSEYCEVFH FDADITKMLDDKFAFTDKARSLGLSVPKSFKITDPQQVINFDFSQETRKYILKSIAYDS VRRLDLTKLPCNTSEETAAFVNSLPISPENPWIMQEFIPGKEFCTHSTVRDGELRLHCC CHSSAFQINYENVENPQICEWVQQFVKSLQLTGQVSFDFIQAEDGSVYAIECNPRTHS AITMFYNHHGVADAYFGKTPLAAPLEPLASSKPTYWIYHEIWRLTGIRSWKQLQTSV NTLLRGTDAIYNLNDPVPFLTLHHWQIPLLLLKNLQQLKGWVKIDFNIGKLVELGGD A0A1Z4LYV8 (SEQIDNO:36) MAQSSVSVSASQPIAPPTSIGMRFFALFQNLATLTLLLLALPINATIVLTTLLLNILTSP FQKKQTTVVATEKKNILISGGKMTKALQLARFFHSAGHRVILTETHKYWLSGHRFSQ SVDKFYTTPVPQKDSQAYTQALIDIINKEGIDIYIPVTSPIASYYDSLAKPALSEYCEVF HIDAATCEMLDDKFAFSEKARSFGLSIPKCFKITNPEQVINFDFSGETRKYILKSIPYDS VRRLDLTKLPCDTPEETEAFVRSLPISPQKPWIMQEFIPGKEYCTHSTVRDGVMRLHC CCESSAFQVNYENVENPKIREWVTHFVKELGVTGQLSFDFIEAEDGNVYAIECNPRT HSAITIFHDQLQQAANAYLSKEPIAAPLQALPNSKPTYWTYHEFWRLNEIRSLSQLGN WIKNMLRGTDAIYTFDDCLPFLMVHHWQIPVLLLKNLSKLKGWTRIDFNIGKLVELG GD A0A654SJH1 (SEQIDNO:37) MAKSVSLSLAKSTTPSTDVRLKLVALFKTLGTLTLLLIALPENGLIVLIALLWGIVQWP LRKKALVAADPRTVLVSGGKMTKALQLARCFHGAGHRVILIETHKYWLSGHKFSRA VSAFYTVPSPQSDPEGYIQSLVAIVKKEKVDFYVPVCSPVASYYDSLAKPALSAYCEV FHFDADITKMLDDKFAFTEQGRSLGLSVPKSFQITDPQQVINFDFSQETRKYILKNIAY DSVRRLNLTKLPCNTPEETAAFVNSLPISAQNPWIMQEFIPGKELCTHSTVRDGELRL HCCSNSSAFQINYQNVENPQIRQWVQQFVKSLGLTGQVSFDFIQAEDGTVYAIECNP RTHSAITMFYNHPGVADAYLGKTPQAAPVEPLANSKPTYWLYHEIWRLTGIRSWKQ LQTSVNTLVGGTDAIFCFDDPVPFLTLYHWQIPLLLLKNLQDLKGWVKIDFNIGKLVE LDGD A0A2C6VZE1 (SEQIDNO:38) MAQSISVSSSPAIPSFPSETKIAVIIQNLLTLALLLLALPFNATIVLVTLLWHTISRPFQ QATTKTANPKNVLISGAKMTKALQLARSFNAAGHRVVLIETHKYWLSGHRFSQAVD KFYTVPAPQENPERYTQALIDIIKQENIDVYVPVTSPLGSYYDSLAKPMLSNYCEVFH FDADITQKLDDKFAFAETARSLGLSVPKSFKITSAEQVLNFDFSQESRKYILKSIPYDS VRRLDLTKLPCATPEETAAFVKSLPISPEKPWIMQEFIPGKEFCTHSTVRNGELRLHCC CESSAFQVNYENVENSQIREWVRHFVKEQKLTGQVSFDFIQAEDGRVYAIECNPRTH SAITTFYDHPQVAQAYLDKEPMAETLQPLPTSKPTYWTYHEVWRLTGIRSFTQLKK WIANIWRGTDAIYKPDDPLPFLMVHHWQIPLLLLKNLRQLKGWTRIDFNIGKLVELG GD A0A2T1EQS1 (SEQIDNO:39) MLALFQNLGTLLLLALAFPFNCIVVLVALLTKPKLPQATVAKAQNILISGGKMTKAL QLARSFYAAGHRVVLIETDKYWLTGHRFSRAVDAFYTVPAPQKDPEAYIQALVNIA KKENIDVYIPVCSPISSYYDSLAKPALAGCCEVFHFDADITKMLDDKFAFAQTAQSFG LSVPKSYKITHPQQVLDFDFSTEQNKYILKSIPYDSVRRLNLTKLPCNTRAETAAFVN SLPISEEKPWIMQEFITGKEYCTHSTVRDGELRLHCCCESSAFQVNYENVDQPEILQW VSHFVKQLGVTGQASFDFIRAENGNIYAIECNPRTHSAITMFYNHPGVASAYLSSQPL KPLQPLTDSKPTYWLYHEVWRLNEIRSLQQLQTWFKNIRRGKESIFAFNDPLPFLMV HHWQIPLLLLDNLRRLAGWIRIDFNIGKLVEFGGD A0A1E5QWM1 (SEQIDNO:40) MFSTTFKSLGTLALLKLALPFNLTLVLIASIINIFSTPFKIKKKPNINSKTVLLTGGKMT KALQLARSFYSAGHRVILVETHKYWLSGHRFSVAVDKFFTIPDPVKDKEGYIDGLLDI VKRENVDIFIPVSSPVASYYDSVAKMVLSPYCKVLHFDVEMTLVLDDKASLCQKASS LGLTSPASYLITDVQEILDFDFSKNNHKYILKSIKYDSVYRLNMTQFPFEGMEEYVRS LPISEENPWVMQQFITGQEYCTHSTVLNGKIRLHCCSMSSHFQVNYEHVDNQKIYEW VEEFVGKLNLTGQISFDFIQTDDGTVYPIECNPRTHSAISMFYNHPLVADAYLNDGDD APITPLESSKPTFWTYHELWRLTEVRSPQDLSQWWQKVTKGQDGIFSWQDPLPFLM VHHWQIPLLLFGNLIKLKPWVKIDFNIGKLVESAGD A0A218ACV8 (SEQIDNO:41) MAQSISFDSSPATPSLGLETKIAAIIQNILTLTLLLLALPINTAIVFIYLVVGAIFRPQTSK TSNPKNILISGGKMTKSLQLARSFHAPGHRVVLVETHKYWLTGHRFSQAVDKFYTTP APQKDPEAYIQALEEIVKRENIDVYIPVTSPVGSYYDSLAKPKLSPHCEVLHFDAEITQ MLDDKFAMAEKARSLGLSVPKSFKITSSEQVINFDFSGETRKYILKSIPYDSVRRLDLT KLPCATPEETAAFVRNLPISPEKPWIMQEFIPGKEFCTHSTVRDGEIKLHCCCESSAFQ VNYENVENPQILEWVKHFVKELKLTGQISFDFIQTEDGQVYAIECNPRTHSAITAFYN HPLVAEAYIGSVTETLQPLSTSKPTYWTYHEVWRLTGIRSFTQLKTWLHNIWRGTDA ILKLDDPLPFLMVHHWQIPLLLLNNLRQLKGWTRIDFNIGKLVELGGD A0A2D3HK59 (SEQIDNO:42) MRKHIFVVFQNLGTLVLLAIAFPLNCIVVLTSLLWSFIKQPFNKSIVVNPNSKNILIAG ARMTKTLQLARSFHAAGHRVIIIDIEKYWLSGNKYSNSVAGFYTVPDPSKDLEGYVE TLHAIANTEKIDFFIPVAIFSVIHYDQGKPPLPDCVEFFHFDADVTKILDDKFAFAETA RSFGLSVPKSFKITDPEQVLNFDFSQEKRKYILKSIPYDQVRRLNLTKLPCDTKSETAA FVKSLPISEENPWIMQEFIPGKEYCTHTTARDGESRMYCCCESSAFQVNYENVDQREI MQWASHFTKELGKTGQLSFDFIQAEDGTVYAIECNPRTHSAITMFYNHPGVADAYL GKEPLAESLQPLPDSKPTYWLYHEVWRLNEIRSFKQLQTWVRNIRRGKEAIFEVSDPL PFLMVHHWQIPLLILDNLRRLKGWIRIDENMGELIE A0A2S6VI18 (SEQIDNO:43) MKSRQTPRERTFALLKSLGTLSLLLLAFPFSLSAVVGALLWSSLASLFQKRRVQAEPK RILLTGAKMTKCLTLARSFHAAGHQVVMVETHKYWLSGNRFSNCVEAFYTVPAPQ HDAEGYIQGLLNIVKQEKIDMFIPVSSPVASYYDSLAKPALSPYCEVFAFDAETTKLL DNKFTFNQKAHSVGLSAPKTFLITNPEQVLNFDFAADGSQYILKSIAYDSINRLALLK LPCAPQKMAEYVRSLPISEENPWIMQEFLKGQEYCTHAVVRDGKLLLYACSKSCDFL VNYEHDYNPAILDWVTRFVKELNLTGQICLDFIQAEDGTVYPIECNPRTSTCITMFHD QPKVVADAYLSSGAQASKEPVQPLPDSKPTYWTFHELWRLLTKVKSWKDLQYRLGI IFNGVDPVFHPRDPLPFLGVNHWQIPLLILNNVRQLKGWERIDFNIGKLVQLGGD K9X913 (SEQIDNO:44) MQSGQTTSERTFALLKSLGTLTLLLLAFPFSLSVVVGALLWSSLTSLFQKRRVQVEPK RILLTGAKMTKCLTLARSFHAAGHQVFMVETKKYWLSGNQFSNCVEALYTVPAPQH DAEGYIQGLLNIVKQEKIDMFIPVSSPVASYYDSLAKPALSPYCEVFAFDAETTKLLD NKFTFNQKAHSVGLSAPKTFLITNPEQVLNFDFAADGSQYILKSIAYDSINRLALLKLP CAPEKMAEYVHSLPISAENPWIMQEFLKGQEYCTHAVVRDGKLLLYACSKSCDFLV NYEHDYNPAILDWVTRFVKELNLTGQICLDFIQAEDGTVYPIECNPRTSTCITMFHDQ PKVVADAYLSSSAQAPKEPVQPLPESKPTYWTFHELWRLLTKVKSWKDLQYRLGIIF NGVDPVFHPRDPLPFLGVNHWQIPLLILNNVRQLKGWERIDFNIGKLVQLGGD A0A1Y0RL91 (SEQIDNO:45) MAHSISLSSRPATPAISIKALLVALFQNLGTLTILLLVLPINAAIVLISLLWSRLSSPWRS QKAVVATHRKNILISGGKMTKALQLARSFHAAGHRVVLIETHKYWLSGHRFSNAVS RFYTTPTPQHNPEAYIQALLDIVKREKIDVYVPVTSPVASYYDSLAKPALSPYCEVFH FDADVTQMLDDKFAFSEKARALGLSVPKSFKITNPEQVINFDFSQETRKYILKSIPYDS VRRLDLTKLPCDTPEETAAFVRSLPISPEKPWIMQEFIPGKEFCTHSTVKNGELRLHCC SESSAFQVNYENIENPKIQKWVTHFVKELGITGQISFDFIQAEDGTVYAIECNPRTHSA ITMFYNHPQVADAYLSQEAFTEPQEPLPNSKPTYWTYHEVWRLTGIRSFAQLQTWIR NFLRGKDAIYQVDDPLPFLMVHHWQIFLLLLDNLRQFRGWTRIDFNIGKLVELGGD A0A2P8QMI8 (SEQIDNO:46) MQIFAVFQNLGTLLLLAIAFPFNCIVVLTALFWNLVSKPFRDRGILPVSHPKNIMLTG GKMTKALQLARSFHMVGHRVVLVETHKYWLTGHRFSNAVDRFYTVPAPEKDPEGY SQALLAIAKQENIDVYVPVCSPVASYYDSVAKSVLSGCCEVFHFDAEVTQMLDDKY EFAEKARSLGLSVPKSFKITNPEQVINFDFSDAERPYILKSIPYDSVRRLNLTKLPCATQ AETAAFVNSLPISPEKPWIMQEFIPGQEYCTHSTVRNGELRMHCCCESSAFQVNYEN VDKPEILAWVRHFVKELGITGQASFDFIQAEDGNVYAIECNPRTHSAITMFYNHPGV ADAFCRDVTCNVSTLYPLQPLSTSKPTYWTYHELWRLTGIRSFPQLQTWFKNILRGK DAIFAIDDPLPFLMVHHWQIPLLLLDNLRRLKGWIRIDFNIGKIVELGGD A0A6B3P645 (SEQIDNO:47) MALILFVQGRAYALFQNLGTLILLLIVLPFNFLKVIPSLLWNFISQPFQKKVVAENPKN ILITGAKMTKCLQLARSFHAAGHKVFLLEANKYWLSGNRFSNAVTGFYTLPFPQKD WEGYSQGLLEIIKKEKIDVFIPVSSPAGSYYESLAKPLISEHCEVLHFDAEITQLLDNKF TFIEKAKSFGLSVPKSFLITNPEQVLNFDFATDGSKYILKSIPYDSVRRLDMTKLPMNS KAEMEEFVNSLPISEQRPWIMQEFVKGKEYCTHSTVRKGKVRLYCCCESSEFQVNYH HVDRPQIYQWVEKFVRELNITGQISFDFIQTEDGRVYPIECNPRTHSAITTFYDHPGVA DAYLKDSKDENEASLIPLPNSKPTYWTYHELWRLTGIRSLGQLKTWINRIFQGTDGIF QINDPLPFLMVHHWQIPLLLLGNLQKLKGWVRIDFNIGKLVELGGD A0A6B3MZW3 (SEQIDNO:48) MGLISGSQKPIYTVLQNLGTLTLLLSVLPFNLLKVLPALLWNFLSKPFQKKLVVENSK NIILTGAKMTKCLQLARSFQAAGHKVFMLETDKYWLSGNRFSNSVTGFYTVPNPKK DWNGYCQKLLDIVKKENIDVFIPVSSAVLNYYESLVKPILSEYCEVLHFDVEITKLLD NKFTFIEKAKSFGLTVPKSFLITKPEQIINFDFATDGSQYILKSIPYDSVRRLNMTKLPM KSVQEMSNFVKSLPINQEKPWIMQEFVKGKEYCTHSTVRKGQIRLHCCCESSEFQVN YEHVDHPQIYEWIEKFVKELNLTGQISFDFIQTEDNRVYPIECNPRTHSAITTFYNHPE VADAYLNDSQNDNESPITPLSNSKPTYWTYHELWRLTAIRSWEQLKAWSKKITAGT DSIFQFNDPLPFLMVHHWQIPLLLLENLKKLKGWVMIDFNIGKLVELEED A0A2K8WS68 (SEQIDNO:49) MFLTTFKSLGTLALLKLALPFNLTLVLIASIINIFSNPFKIKKKPNINSKTVLLTGGKMT KALQLARSFHSAGHRVILVETHKYWLSGHRFSVAVDKFFTMPNPVKDKEGYIDGLL DIVKRESVDIFIPVSSPVASYYDSVAKMVLSPYCEVLHFDVEMTLVLDDKANLCKKA SSLGLTSPASYLITNVQEILDFDFSKNNHKYILKSIKYDSVYRLNMTQFPFEGMEEYV RSLPISEENPWVMQQFITGQEYCTHSTVRNGKIRLHCCSESSHFQVNYKHIDNQKIYE WVEEFVGKLNLTGQISFDFIQTDDGTVYPIECNPRTHSAISMFYNHPLVADAYLNDG DDAPITPLESSKPTFWTYHELWRLTEVRSPQDLSQWWQKVTKGQDGIFSWQDPLPFL MVHHWQIPLLLFGNLMKLKPWVKIDFNIGKLVESAGD A0A4Q9JE38 (SEQIDNO:50) MTQSISVASVGQTTQSVTLGLRISALFKNLATLALLLLVLPINAAIVLVSLLLGSQSQA IATEPKNILISGGKMTKALQLARSFHAAGHRVVLVETHKYWLTGHRFSKAVSRFYTL PTPQSDPEAYTQALLDIVQKENIDVYVPVCSPVASYYDSLAKPVLSKYCEVFHCDAD VTQMLDDKYAFVEKARSLGLSVPKSFKITDPEQVSNFDFSQEKRKYILKSIPYDSVRR LDLTKLPCETPEATADFVNSLPISSQKPWIMQEFIPGKEFCTHSTVRNGELRMHCCCE SSAFQVNYENVDHPQILEWVRHFVKALGITGQVSFDFIEAQDGTIYAIECNPRTHSAIT MFYNHPDVANAYLSEIPQVEPIQPLINSKPTYWTYHEIWRLTGIRSFSQLQTWLKNFF GGKDAIYSLSDPLPFLTVHHWQIPLLLLQNLQQLKGWIRIDFNIGKLVEFGGD Q3M6C5 (SEQIDNO:51) MAQSLPLSSAPATPSLPSQTKIAAIIQNICTLALLLLALPINATIVFISLLVFRPQKVKA ANPQTILISGGKMTKALQLARSFHAAGHRVVLVETHKYWLTGHRFSQAVDKFYTVP APQDNPQAYIQALVDIVKQENIDVYIPVTSPVGSYYDSLAKPELSHYCEVFHFDADIT QMLDDKFALTQKARSLGLSVPKSFKITSPEQVINFDFSGETRKYILKSIPYDSVRRLDL TKLPCATPEETAAFVRSLPITPEKPWIMQEFIPGKEFCTHSTVRNGELRLHCCCESSAF QVNYENVNNPQITEWVQHFVKELKLTGQISFDFIQAEDGTVYAIECNPRTHSAITTFY DHPQVAEAYLSQAPTTETIQPLTTSKPTYWTYHEVWRLTGIRSFTQLQRWLGNIWRG TDAIYQPDDPLPFLMVHHWQIPLLLLNNLRRLKGWTRIDFNIGKLVELGGD A0A252E4S5 (SEQIDNO:52) MAQSISLSLPESTTPSTSAGVKIVALFKTLGTLTLLLIALPFNALIVLIALLWGIVRRPF TKKAAVAAHPQTILVSGAKMTKALQLARSFHAAGHRVILIEGHKYWLSGHRFSKAV SRFYTVPAPQKDPEGYIQALVEIVKKEKVDVYVPVCSPVASYYDSLAKPALSEYCEV FHFDADITKMLDDKFAFTDKARSLGLSVPKSFKITDPQQVINFDFSQETRKYILKSIAY DSVRRLDLTKLPCDTPEETAAFVNSLPISSENPWIMQEFIPGKEFCTHSTVRDGELRLH CCCNSSAFQINYENVENPQIREWVQQFVKSLRLTGQVSFDFIQAEDGTVYAIECNPRT HSAITMFYNHPGVADAYLGKTPLAAPLEPLASSKPTYWIYHEIWRLTGIRSWKQLQT SINTLLRGTDAICCLDDPVPFLTLHHWQIPLLLLKNLQQLKGWVKIDFNIGKLVELGG D A0A367RKS4 (SEQIDNO:53) MAQSISLSLPQSTTPSTGVKVKIVALFKTLGTLTLLLIALPFNALIVLISLLWGIGRSPF TKKAVVATHPQTILVSGAKMTKALQLARSFHAAGHRVILIEGHKYWLSGHRFSKAV SRFYTVPAPQEDPEGYIQALVEIVKQEKVDVYVPVCSPVASYYDSLAKPALSEYCEV FHFDADITKMLDDKFAFTDRARSLGLSVPKSFKITDPQQVINFDFSQEIRKYILKSISY DSVRRLDLTKLPCDTPEQTAAFVNSLPISPEKPWIMQEFIPGKELCTHSTVRNGELRL HCCSNSSAFQINYENVENPRIREWVQHFVKSLGLTGQVSFDFIQAEDGTTYAIECNPR THSAITMFYNHSGVANAYFGKTLLDAPLEPLASSKPTYWIYHEIWRLTGIRSWKQLQ TSVNTIVRGTDAIYCLDDPVPFLTLYHWQIPLLLLKNLQQLKGWVKIDFNIGKLVELG GD A0A1E2WNZ8 (SEQIDNO:54) MAQSISLSLPESTTPSTGIRIKIVALFKTLGTLTLLLIALPINALIVLLSLLWSILFTKKPA VAAHPQTILVSGGKMTKALQLARSFHAAGHRVILVEGHKYWLSGHRFSNAVSRFYT VPAPQDDPEGYIQALLEIVKKEKVDIYVPVCSPVASYYDSLAKPSLSAYCEVFHFDAE ITKMLDDKFAFTDQARSLGLSVPKSFKITDAEQVINFDFSKETRKYIIKSISYDSVRRL NLTKLPCDTPEETAAFVKSLPISPEKPWIMQEFIPGKELCTHSTVRDGELRLHCCSDSS AFQINYENVENPQIRQWVQHFVKSLGLTGQVSFDFIQAEDGTAYAIECNPRTHSAITM FYNHPGVAEAYFGKTLLAAPLEPLADSKPTYWIYHEIWRLTGIRSAKQLQTWFQRLV RGTDAIYQINDPIPFLTLHHWQITLLLLQNLQKLKGWVKIDFNIGKLVELGGD A0A1B2CWG9 (SEQIDNO:55) MAQSIPFDSASPTPQVSWGVRISALWKTVGTLLLLFLALPVNASIVLISLLWGIFSKPF EKRVVAAAPKNILISGGKMTKALQLARSFHAAGHRVVLVESHKYWLTGHQFSNAVS VFYTVSPPEKDPEGYTQQLLDIVKKERIDVYVPVCSPVASYYDSLVKPALSQHCEVF HCDAEITQMLDDKYAFSEKARSFGLSVPKSFKITNPEQVINFDFSQEKRKYILKSIPYD SVRRLNLTKLPCDTPEETAAFVRSLPISPEKPWIMQEFIPGKEFCTHSTVRNGELRLHC CCESSAFQVNYENVNNPQILEWVKHFIKEMGITGQVSFDFIQTEDGTVYAIECNPRTH SAITMFYNHPGVADAYLGKIPLPEPLQPLADSKPTYWLYHEIWRLTGIRSLSQFWTW LKNLMRGKDAIYQLNDPLPFLTVPHWQITLLLLQNLRQLRGWVKIDFNIGKLVELGG D A0A1U7HY56 (SEQIDNO:56) MQSGQTIRERTFASLKSLGTLTLLLLAFPFSLSVVVGALLWSSLTSLFQKHRVQVKPK RILLTGAKMTKCLTLARSFHAAGHQVFMVETKKYWLSGNQFSNCVEALYTVPAPQH DAEGYIQGLLNIVKQEKIDMFIPVSSPVASYYDSLAKPALSPYCEVFAFDAETTKLLD NKFTFNQKAHSVGLSAPKTFLITNPEQVLNFDFATDGSQYILKSIAYDSINRLALLKLP CAPATMAKYVHSLPISEENPWIMQEFLKGQEYCTHAVVREGKLMLYACSKSCDFLV NYEHDYNPAILDWVTRFVKALNLTGQICLDFIQAEDGTVYPIECNPRTSTCITMFHDQ PKVVADAYLSSSASILKEPVQPLPDSKPTYWTFHELWRLITKVKSWQDLQYRLGIIFN GVDPVFHPRDPLPFLGVNHWQIPLLILNNVRQLKGWERIDFNIGKLVQLGGD A0A1L9QXK4 (SEQIDNO:57) MLIILFIQNHAYALFQNLSTFLLLTLLLPFNLLKILPVVLWNILTPIRAKPPGYEKPKNI LITGAKMSKSLQLARSFNGSGHRVFLLEIHKYWLSGNRFSNAIKGFYTVPNPQKDWD GYQQAVLEIVQKENINLFIPVSSPAGSYDESRLKPILSPYCEVFHFNLDITELLDNKFTF IEKAKSLGLSVPQSFLITDSKQILDFDFAQDGSRYILKSIPYDSVRRLDMTKLPMKSEQ EMEEFVKKLPITEDKPWIMQEFVQGKEYCTHSTVRKGKIRLHCCCESSEFQVNYDHV EEPEIYQWVETFVRALNLTGQISFDFIKTEDGQVYPIECNPRTHSAITTFHDHPGVADA YLKDAEDETESPIFPLPDSKPTYWTYHELWRVTEIRSFGQFQAWIKRITEGTDGIFQLN DPLPFLMVHHWQIPLLLLQNLKKMKGWVRIDFNIGKLVELDGD A0A2L2NR98 (SEQIDNO:58) MGQSISLSLPQSPTSSTSVRVKIIALFKTLGTLTLLLIALPFNALIVLISLLWGIVRWTLP RRRRSLFTKNVVAAHPQTILVSGAKMTKALQLARSFHAAGHRVILIEGHKYWLSGH RFSKAVSRFYTVLAPQSDLEGYIQALVEIVKKEKVDVYVPVSSPVSSYYESLAKAALS EYCEVFHFDPDITKMLDDKFALTDRARSLGLSVPKSFKITDPQQVINFDFSQETRKYIL KSIDYDSVRRLNLTKLPCDTPEETAAFVNSLPISPEKPWIMQEFIPGKELCTHSTVRDG ELRLHCCSDSSAFQINYENVENPQIREWVQHFVKSLALTGQVSFDFIQAQDGTVYAIE CNPRTHSAITMFYNHPGVADAYLGKTPLAAPLEPLASSKPTYFIYHEIWRLTGIRSWK QLQTSVNTLVRGTDAIYSLDDPIPFLTLHHWQIPLLLLKNLQQLKGWVKIDFNIGKLV ELGGD A0A2H2XFD9 (SEQIDNO:59) MPQSISLTSSPTINQVNNKSVDISSSLKTLGTLTLLLLALPVNATLVLVALLLNSLRPR NITTAANPKNILISGGKMTKALQLARSFHNAGHRVVLLEAHKYWLTGHRFSFAVNK FYTVEAPEKDPEGYVQSLVDIVNKENIDVYVPVCSPVASYYDSLAKKALSSQCEVIH CDALTTQMLDDKYAFTETARGFGLSVPKSFKITDPEQVINFDFSQEKRKYILKSIPYDS VRRLDLTKLPCDTPEATAAFVRSLPISPEKPWIMQEFIPGKEYCTHSTVRNGEITLHCC CESSAFQVNYAQVDNPQIFEWVRHFLKQLGITGQVSFDFIEAEDGTVYAIECNPRTHS AITMFYNHPGVADAYLGTLNNLEEPIQPLPTSKPTYWIYHEMWRLINAGSWSKFVER LQIITRGTDAIFSWQDPLPFLMNPHWQIFLLLIQNLQKNRGWIRIDFNIGKLVELGGD A0A533NZW2 (SEQIDNO:60) MFLQAKIWAFFQNIGTLTLLLLALPFNAIVVLPCLLWSWIAKLFQKKVVAANPKNILI TGGKMTKALQLARCFHAAGHTVFLVETHKYWLSGHRFSRAVKGFFTVPAPEKHAN GYCQGLLDIVKQEKIDVFIPVSSPVASYYDSIAKSLLSPHCEALTFDAEITEMLDNKFT FCQKARELGLTAPKAFLITDPEQVLNFDFAADGSRYILKSIAYNSVYRLDLTKLPMSS KEQMASFVKGLPISESQPWIMQEFISGQEYCTHSTVRNGIVRLHCCSQSSPFQVNYEQ VDNQNIFQWVQQFVKALNLTGQISLDVIQTKDGKVYPVECNPRTHTAIAMFYNHPG VADAYILDSKDAREPPIQPLPESKPTYWTYHELWRLTGIRSWGQLKGWFNKIIKGTD GIFQVNDPLPFLMVHHWQIPLLLLNNMRKFKGWVKIDFNIGKLVELGGD A0A367RVN3 (SEQIDNO:61) MAQSISLSLPQSPTSSTGIKVKLVALFNTLGTLTLLLIALPFNALIVLISLLWGIVSSPF TKKAVVAAHPQTILVSGAKMTKALQLARSFHAAGHRVILIEGNKYWLSGHRFSKAV SRFYTVPAPQEDPEGYIQALVEIVKREKVDVYVPVCSPVASYYDSLAKPLLSEYCEVF HFDPDITKMLDDKFAFTDRARSLGLSVPKSFKITDPQQVINFDFSQETRKYILKSIDYD SVRRLNLTKLPCDTPEETAAFVNSLPISAEKPWIMQEFIPGKELCTHSTVRNGELRLH CCSNSSAFQINYENVENPQIREWVQHFVKSLALTGQVSFDFIQAEDGTAYAIECNPRT HSAITMFYNHPGVADAYLGKTPLAAPLEPLASSKPTYFLYHEIWRLTGIRSWKQLQT SVNTLVRGTDAIYSLDDPIPFLTLHHWQIPLLLLKNLQQLKGWVKIDFNIGKLVELGG D A0A1Z4TPY4 (SEQIDNO:62) MLMGFFEGEFMTQSISVASPAPKTQSVPLGFRISALWKNVGTLALLLLVLPINAVIVL VSLLLGHQSQAIATEPKNILISGGKMTKALQLARSFHAAGHRVVLVETHKYWLTGH RFSKAVSRFYTLPTPQSDPKAYTQALLDIVKKENIDVYVPVCSPVASYYDSLAKPVLS KYCEVFHCDADVTQMLDDKYAFAEKARSLGLSVPKSFKITDPEQVINFDFSQEKRQY ILKSIPYDSVRRLDLTKLPCETPEVTADFVNSLPISPQKPWIMQEFIPGKEFCTHSTVRN GELRMHCCCESSAFQVNYENVDHPQILEWVRHFVKELGITGQVSFDFIQAEDGTIYAI ECNPRTHSAITMFYNHPSVADAYLSEIPQLEPIQPLFNSKPTYWIYHEIWRLTGIRHWS QLQTWLKNFFGGKDAIYSFSDPLPFLTVHHWQIPLLLLQNLQQLKGWLRIDFNIGKL VEFGGD A0A6B3MAD2 (SEQIDNO:63) MGLISRSQKPVYIALQNLGILTLLLSVLPFNLLKVLPAVLWNFISKPFQKKVVAENSK NIILTGAKMTKCLQLARSFQVAGHKVFMLETDKYWLSGNRFSNTVTGFYTVPNPKK NWNGYCQELLDIVKREDIDVFIPVSGAALNYYESLIKPILSEHCEVLHFDIEITKLLDN KFTFIEKAKSFGLAVPKSFLITNPEQILNFDFPADGGQYILKSIPYDSVRRLDMRKLPM KSAQEMKDFVNSLPISEEKPWIMQEFVKGKEYCTHSTVRKGQIRLHCCCESSEFQVN YEHVNHPQIYEWVETFVKELNLTGQISFDFIQTEDNRVYPIECNPRTHSAITTFYNHPE VADAYLNDSQDDNESPLIPLPNSKPTYWIYHELWRLTAIRSWEQLKDWIKKITAGTD SIFQFNDPLPFLMVHHWQIPLLLLDNLKKLKGWVMIDFNIGKLVELEED A0A1Z4IH51 (SEQIDNO:64) MTQSISLSLPESTTPSVGIKVKILALFKTLGTLSLLLVALPFNVLIVLISLLWGIVRVPF TKNVVATHSQTILVSGAKMTKALQLARSFHADGHRVILIESHKYWLSGHRFSKAVSR FYTVPSPQKDPESYIQALIEIVKKEKVDVYVPVCSPVASYYDSLAKPALSEYCEVFHF NADITKMLDDKFAFTQKARALGLSVPKSFKITDPQQVINFDFSQETRKYILKSINYDS VRRLNLTKLLCDTPEETAAFVKSLPISPETPWIMQEFIPGKEFCTHSTVRDGELRLHCC CHSSAFQINYENVENPQIREWVQHFVKSLGLTGQVSFDFIQAEDGTVYAIECNPRTHS AITMFYNHPGVAEAYFGKIPLPAPVEPLATSKPTYWTYHEIWRLTGIRSWKQLQTAIK TIFQGTDAIYCLDDPLPFLTLHHWQIPLLLLQNLQQLKGWVKIDFNIGKLVELGGD A0A1Z4IB36 (SEQIDNO:65) MAQSLSLSSSHATPSIPWQTRVAAILQNIGTLTLLLLALPINASIVFISWLIFRPQKVKA ANPQNILISGGKMTKALQLARSFHAAGHRVVLLETHKYWLTGHRFSVAVDKFYTVP APQENPQAYIQALVDIVKQENIDVYVPVTSPAGSYYDSLAKPELSRYCEVFHFDADIT QMLDDKFALVEKARSLGLSVPKSFKITSPEQVINFDFSGESRKYILKSIPYDSVRRLDL TKLPCATPEETAAFVRTLPISQEKPWIMQEFIPGKEFCTHSTVRDGELRLHCCCESSAF QVNYENVDNPQIREWVRRFVKELKLTGQISFDFIQAEDGTVYAIECNPRTHSAITTFY DHPQVAQAYLSKETTAETLQPLATSKPTYWTYHEVWRLTGIRSLTQLGRWLGNIWR GTDAIYQPGDPLPFLMVHHWQIPLLLLNNLRRLKGWTRIDFNIGKLVELGGD K9VKW1 (SEQIDNO:66) MLETVSVAAMPSERETNTGNRRFPTAFKTIATLILLLLVMPLNLALTAIALLRSIIIKPF QSRSTTATPQTILISGGKMTKALQLARSFHQAGHRVILVETEKYWLTGHRYSRAVDR FYTVPNPQTEEYPQALLKIVRQEGVNVYVPVCSPVASYYDAEVKRVLSGHCTVMHV DVETLQRLDDKYEFATAAQALGLPVPKSYRITNPQQVIDFDFSDAQRKYIIKSIPYDS VRRLDLTKLPCETPAETAAFVNSLPISESKPWIMQEYIPGQEFCTHSTVRNGHLQLHC CCKSSAFQVNYENVDRPDIENWIRQFAKSLNLTGQVSFDFIQAADDGEIYAIECNPRT HSAITMFYNHPDVAKAYLEPDPLPQTVQPLASSRPTYWIYHEIWRLVTHLSSPKLVSE RLKIIAQGKDAIFDWDDPLPFLMVHHWQIPLLLWGNLQNPKEWIRIDFNIGKLVEIGG D A0A2T1F5R3 (SEQIDNO:67) SRSVDRFYTVPKPQEKDYIDALLEIVQREGVDVYIPVCSPVASYYDALAKQVLSKYC EVMHFDPELVQKLDDKSEFSAIATSLGLAVPDSYRITDTQQILDFDFAKQAHTYILKSI PYDSLRRLNLTQLPCETPQQTAAFVEQLPICESNPWIMQAFITGQEYCTHSTVRNGEL QLHCCCESSAFQINYEMVDKPEIEAWVRKFVSSLKLTGQVSFDFIQTRDGGVYAIEC NPRTHSAITMFYNHPDVARAYLESDFPLIKPLESSRPTYWIYHEIWRLVTQPTQIGQRL KIIASGKDAIFDWADPLPFLMVHHAQIPWLLLENLRQLKGWMRIDFNIGKLVEPAGD K9W0D3 (SEQIDNO:68) MAQVQPIKARIFAVFQNLGTLALLAIAFPINCIVVLASLLWNFCSRPFSKQGVSTLNPK NILIGGGKMTKTLQLARLFHAAGHRVILFDSEKFRFSGYRFSNAVDRFYTVPDPQTDL EGYTQALRAIAKQENIDIFIPVGIFAGGYFDSQRQPVLSGCCELFHFDADTMKMLDNK FTFGEIARSFGLSVPKTFLITDPEQVLQFDFANEKNKYILKSIVYDSVYRLDMTKLPME SQEKMAAHVNSLPIRKDNPWILQEFISGKEYCTHSTVRNGELTVHCCCESSAFQVNY ENVDHPEIMQWVSRFVKELKLSGQISFDFMQAEDGTLYAIECNPRTHSAITMYYNHP DLADAYLSAERRNYALPLQPLPDSKPTYWLYHEVWRLNEIRSLKQLQTWFKNIWRG KDAIFEVNDPLPFLMVHHCYIPLLLLDSLRKLKGWVRIDFNIGKLVQLEGD A0A1Z4SWP6 (SEQIDNO:69) MPQSISLTSSPTINQVNNKSVDISSSLKTLGTLTLLLLALPVNATLVLVALLLNSLRPR NITTAANPKNILISGGKMTKALQLARSFHNAGHRVVLLEAHKYWLTGHRFSFAVNK FYTVEAPEKDPEGYVQSLVDIVNKENIDVYVPVCSPVASYYDSLAKKALSSQCEVIH CDALTTQMLDDKYAFTETARGFGLSVPKSFKITDPEQVINFDFSQEKRKYILKSIPYDS VRRLDLTKLPCDTPEATAAFVRSLPISPEKPWIMQEFIPGKEYCTHSTVRNGEITLHCC CESSAFQVNYAQVDNPQIFEWVRHFLKQLGITGQVSFDFIEAEDGTVYAIECNPRTHS AITMFYNHPGVADAYLGTLNNLEEPIQPLPTSKPTYWIYHEMWRLINAGSWSKFVER LQIITRGTDAIFSWQDPLPFLMNPHWQIFLLLIQNLQKNRGWIRIDFNIGKLVELGGD A0A1U71932 (SEQIDNO:70) MAQSISVSSSPAMPSLAVETKIAVIIQNILTLALLLLALPINATIVVVTLLWCNISRPFQ HSATKAANPKNILISGGKMTKALQLARSFNAAGHRVVLIETHKYWLSGHRFSQAVD KFYTVPAPQENPECYTQALIDIIKQENIDVYIPVTSPLGSYYDSLAKPLLSEYCEVFHF DADITQKLDDKFAFAETARSLGLSAPKSFKITSAEQVLNFDFSQESRKYILKSIPYDSV RRLDLTKLPCATPEETAAFVRSLPISPEKPWIMQEFIPGKEFCTHSTVRDGELRLHCCC ESSAFQVNYENVENSQIREWVRHFVKELKLTGQISFDFIQAEDGRVYAIECNPRTHSA ITTFYDHPKVAQAYLDKEPMAETLQPLPTSQPTYWTYHEVWRLTGIRSFTQLKKWIA NIWRGTDAIYKSDDPLPFLMVHHWQIPLLLIDNLRRLKGWTRIDFNIGKLVELGGD A0A1W5CLX0 (SEQIDNO:71) MAQSLPLSSAPATPSLPSQTKIAAIIQNICTLALLLLALPINATIVFISLLVFRPQKVKAA NPQTILISGGKMTKALQLARSFHAAGHRVVLVETHKYWLTGHRFSQAVDKFYTVPA PQDNPQAYIQALVDIVKQENIDVYIPVTSPVGSYYDSLAKPELSHYCEVFHFDADITQ MLDDKFALTQKARSLGLSVPKSFKITSPEQVINFDFSGETRKYILKSIPYDSVRRLDLT KLPCATPEETAAFVRSLPITPEKPWIMQEFIPGKEFCTHSTVRNGELRLHCCCESSAFQ VNYENVNNPQITEWVQHFVKELKLTGQISFDFIQAEDGTVYAIECNPRTHSAITTFYD HPQVAEAYLSQAPTTETIQPLTTSKPTYWTYHEVWRLTGIRSFTQLQRWLGNIWRGT DAIYQPDDPLPFLMVHHWQIPLLLLNNLRRLKGWTRIDFNIGKLVELGGD A0A328IAQ4 (SEQIDNO:72) MTQSISVASVGQTTQSVTLGLRISALFKNLATLALLLLVLPINAVIVLVSVLLGSQSQA IATEPKNILISGGKMTKALQLARSFHAAGHRVVLVETHKYWLTGHRFSKAVSRFYTL PTPQSDPQAYTQALLDIVKKESIDVYVPVCSPVASYYDSLAKPVLSKYCEVFHCDAD VTQMLDDKYAFAEKARSLGLSVPKSFKITDPEQVINFDFSQEKRQYILKSIPYDSVRR LDLTKLPCETPQATADFVNSLPISPQKPWIMQEFIPGKEYCTHSTVRNGELRMHCCCE SSAFQVNYENVDHPQILEWVRHFVKALGITGQVSFDFIEAEDGTIYAIECNPRTHSAIT MFYNHPDVANAYLSEIPQVEPIQPLTNSKPTYWTYHEIWRLTGIRSFSQLQTWVKNFF GGKDAIYSLSDPLPFLAVHHWQIPLLLLQNLQQLKGWIRIDFNIGKLVEFGGD A0A533NF66 (SEQIDNO:73) MFLQAKIWAFFQNIGTLTLLLLALPFNAIVVLPCLLWSWIAKLFQKKVVAANPKNILI TGGKMTKALQLARCFHAAGHTVFLVETHKYWLSGHRFSRAVKGFFTVPAPEKHAN GYCQGLLDIVKQEKIDVFIPVSSPVASYYDSIAKSLLSPHCEALTFDAEITEMLDNKFT FCQKARELGLTAPKAFLITDPEQVLNFDFAADGSRYILKSIAYNSVYRLDLTKLPMSS KEQMASFVKGLPISESQPWIVQEFISGQEYCTHSTVRNGIVRLHCCSQSSPFQVNYEQ VDNQKIFQWVQQFVKALNLTGQISLDVIQTKDGKVYPVECNPRTHTAIAMFYNHPG VADAYLLDSKDAREPPIQPLPESKPTYWTYHELWRLTGIRSWGQLKGWFNKIIKGTD GIFQVNDPLPFLMVHHWQIPLLLLNNMRKFKGWVKIDFNIGKLVELGGD A0A479ZZ55 (SEQIDNO:74) MFPINLTLVITAFLTNLITLPFPKKITYENSKNILLTGGKMTKSLQLARSFHRAGHKVF MVETHKYWLSGHQYSKAVKKFLTVPAPEKDPEGYCQSLLDIVKREKIDVFIPVSSPV ASYYDSLAKPILSPYCEVFHFDTEMTKTLDDKFSLCEQARVLGLTAPKVFLITSPGEII NFDFSQEQNPYIIKSIQYDSVTRLDMTKFPFEGMKEYVKKLPISKERPWVMQEFIKGQ EYCTHSTVRDGEIRLHCCSKSSPFQVNYEQVDNPEIFQWVQKFVKELNLTGQISFDF MQTEDGKVYPIECNPRTHTAITMFYDHPGLADAYLEPGKNQPHIEPLPTSKPTYWLY HELWRITGIRSFNDLTNWLNKVIKGKDAMLDKDDPLPFLMVHHWQIVLLLLQNMV KLKGWVRIDFNIGKLVEIGGD A0A357A498 (SEQIDNO:75) MLIILFIQNRAYALFQNLSTFLLLTLLLPFNLLKILPALLWNILTSIRAKLPGDEKPKNI LITGAKMSKSLQLARSFNGAGHRVFLLETHKYWLSGNRFSNAIKDFYTVPNSEKNW DGYQQAVLEIVQKENINLFIPVSSAAGSYDESRLKAILSPYCEVFHFDLDITELLDNKF TFIEKAKNLGLSVPKSFLMTDSKQILDFDFVQDGSRYILKSIPYDSVRRLDMTKLPMK SEQEMEEFVKELPITEDKPWIMQEFVQGKEYCTHSTVRKGKIRLYCCCESSEFQVNY NHVEEPEIYQWVKTFVRALNLTGQISFDFIKTEDGQVYPIECNPRTHSAITTFHDHPGV ADAYLKDVEDETKSPIFPLPDSKPTYWTYHELWRLTQIRSFGQFKAWIKRMIEGTDGI FQPHDPLPFLMVHHWQIPLLILQNLKTMKGWVRIDFNIGKLVELDGD A0A1Z4QDW0 (SEQIDNO:76) MAQSISVDSSPAIPSLASETKIAVIIQNILTLALLLLALPINATIVLVTLFWGTILRPFQHS ATKTANPKNILISGGKMTKALQLARSFHAAGHKVVLLETHKYWLTGHRFSQAVDKF YTVPAPQENPESYTQALIDIIKQENIDVYIPVTSPLGSYYDSLAKPLLSRHCEVFHFDV DITQNLDDKFEFAQKARSLNLSAPKSFKITSAEQVLNFDFSQESRKYILKSIPYDSVRR LDLTKLPCATPEETAAFVRSLPISPEKPWIMQEFIPGKEFCTHSTVRDGELRLHCCCES SAFQVNYENVENSQIREWVRHFVKELKLTGQISFDFIQAEDGAVYAIECNPRTHSAIT TFYDHPKVAQAYLDQEPMAETLQPLPTSKPTYWTYHEVWRLTGIRSFTQLQKWLAN IGRGTDAIYKLDDPLPFLMVHHWQIPLLLLNNLLRLKGWTRIDFNIGKLVELGGD K9R4C7 (SEQIDNO:77) MAQSSIPVLSSQTATHTISLGRRFVALVQNLATLTALLLALPINATIVFISLVLKILISP FQKEQTTVTTAERKNILISGGKMTKALQLARFFHAAGHRVVLTETHKYWLSGHRFS QAVDKFYTTPVPQKDSQIYTQALIDIVNKENIDIYIPVTSPIASYYDALAKQTLSEYCE VFHIDAATCEMLDDKFAFSEKARSFGLSVPKSFKITNPEQVLNFDFSGETRKYILKSIP YDSVRRLDLTKLPCDTPEETEAFVRSLPISPQKPWIMQEFIPGKEYCTHSTIRDGVVRL HCCCESSAFQVNYENVENAKIREWVTHFVKELGVTGQLSFDFIEAEDGNVYAIECNP RTHSAITIFHDQLQPAANAYLSKEPIKEPLQALINSKPTYWTYHEFWRLNEIRSFSQLG NWIKNMLQGTDAIYTFDDSLPFLMVHHWQIPLLLLKNLFKLKGWTRIDFNIGKLVES GGD A0A3S0ZZ73 (SEQIDNO:78) MAQSISLTESQTTVKPLAVWGKINALLKNLGTLVLLLVALPINATIVLVSLLWNLLAK PFQKEQTVAGDRKNILISGAKMTKALQLARSFHAAGHRVVLLETHKYWLSGHRFSK AVDNFYTTPVPQRDPQAYTQALIDIIEKENIDVYIPVTSPIASYYDSLAKPVLSQYCEV FHFDAAVTQMLDDKFAFSEKARSLGLSVPKSFKITSPEQVLNFDFSQETRKYILKSIPY DSVRRLDLTKLPCDTPEQTEAFVRSLPISAQKPWIMQEFIPGKEFCTHSTVRDGEIRLH CCCESSAFQVNYEHVEHPQISEWIARFVKGLGITGQISFDFIQAEDGSVYAIECNPRTH SAITTFHDRPEVAQAYLGKEAMTEPLQPLPSSKPTYWLYHEVWRLTSIRSLAQLRTWI RNIWRGTDAIYKLDDPLPFLMLHHWQIPLLLLNNLWRLKGWTRIDFNIGKLVELGGD A0A3C0NJT8 (SEQIDNO:79) MAQLLFVRTPSFTMLKSLGTLTLLLIAFPINSIVVLTSLLWGLLSRPFQKQPLPADNQK TAMFTGGKMTKALQLARSFHAAGHRVILVETHKYWLTGHRFSNAVDRFYTIPAPQK DPEGYTQALLNIAKQENVDIYIPVCSPVSSYYDSLAKPALSGCCEVFHFDADITKMLD DKFAFSEKARALGLSVPKSFKITNPEQVLNFDFSNETRKYILKSIPYDSVRRLNLTKLP CDTPEETAAFVKSLPISEEKPWIMQEFIPGQEYCTHSTVRDGELRLHCCCESSAFQVN YENVDQPEIMKWVSHFVKELKLTGQASFDFIQAEDGAIYAIECNPRTHSAITMFYNHP GVADAYLGKEPLAEPLQPLPDSKPTYWLYHEIWRLNEIRSWSQLQTWMNNLLRGTD AIFDVNDPLPFLTVHHWQIPVLLLDNLRKLRGWVRIDFNIGKLVESGGD B2J6X7 (SEQIDNO:80) MAQSISLSLPQSTTPSKGVRLKIAALLKTIGTLILLLIALPLNALIVLISLMCRPFTKKPA VATHPQNILVSGGKMTKALQLARSFHAAGHRVILIEGHKYWLSGHRFSNSVSRFYTV PAPQDDPEGYTQALLEIVKREKIDVYVPVCSPVASYYDSLAKSALSEYCEVFHFDADI TKMLDDKFAFTDRARSLGLSAPKSFKITDPEQVINFDFSKETRKYILKSISYDSVRRLN LTKLPCDTPEETAAFVKSLPISPEKPWIMQEFIPGKELCTHSTVRDGELRLHCCSNSSA FQINYENVENPQIQEWVQHFVKSLRLTGQISLDFIQAEDGTAYAIECNPRTHSAITMF YNHPGVAEAYLGKTPLAAPLEPLADSKPTYWIYHEIWRLTGIRSGQQLQTWFGRLVR GTDAIYRLDDPIPFLTLHHWQITLLLLQNLQRLKGWVKIDFNIGKLVELGGD A0A0CINCV3 (SEQIDNO:81) MTKLQPIKARIIAVFQNLGTLLLLAIAFPINCSVVLVSLLWNFFSRPSHKQVVLTENPK NILIGGGRMTKTLQLARSFHAAGHRVILVDIDKYWLSGHRFSRAVAGYYTVPAPQK DLEGYTQALRAIAKKENIDFFIPVAIFAVSYFDSKGEPVLSGCCEIFHFDADITKMLDD KFAFAEKARSLGLSVPKSFKITDPEQVLNFDFSQEKRKYILKSIPYDCLRRLNMTKLP CDTFDMTAEFVKSLPISEEKPWIMQEFIPGKEYCTHSTVRDGELRLYCCCESSAFQVN YENVDRPEIRQWVQQFVQEVGLTGEISFDIIQADDGTVYPIECNPRTHSAITMFYNHP GVANAYLNKEPLVEPLQPLADSKPTYWLYHEVWRLTGIRSLKQLQTWIRNILRGKE AIFSVSDPLPFMMVHHWQIPLLLLDNLRRLKGWVRIDFNLGELIESEEY A0A1Z4S904 (SEQIDNO:82) MAQSISFSSAPATPSVPSTSKIAAIFPNIGTLTLLLLALPINASIVLITLLLRAILRPFQPSA VKAANPKNILISGGKMTKALQLARSFHAAGHRVVLLETHKYWLTGHQYSQAVDKF YTVSAPQENPERYTQALVDIIKQENIDVYIPVTSPLGSYYDSLAKPELSRYCEVFHFDA DITQMLDDKYELAQTARSLGLSVPKSFKITSAEQVLNFDFSGETRKYILKSIPYDSVRR LDLTKLPCATPEETAAFVRSLPISPEKPWIMQEFIPGKEFCTHSTVRNGELRLHCCCES SAFQVNYENVENPQILEWVKHFVKELKLTGQISFDFIQAEDGKVYAIECNPRTHSAIT TFYDHPKVAEAYLSQEATTETLQPLPTSKPTYWTYHEVWRLTGIRSFKQLKTWIVNI WRGTDAIYKFDDPLPFLMVHHWQIPLLLLKNLRQLKGWTRIDFNIGKLVELGGD A0A2K8SZ63 (SEQIDNO:83) MFQNLGTLVLLAIAFPLNCIVVLTSLLWSFIKQPFNKSIVVNPNSKNILIAGARMTKTL QLARSFHAAGHRVIIIDIEKYWLSGNKYSNSVAGFYTVPDPSKDLEGYVETLHAIANT EKIDFFIPVAIFSVIHYDQGKPPLPDCVEFFHFDADVTKILDDKFAFAETARSFGLSVPK SFKITDPEQVLNFDFSQEKRKYILKSIPYDQVRRLNLTKLPCDTKSETAAFVKSLPISEE NPWIMQEFIPGKEYCTHTTARDGESRMYCCCESSAFQVNYENVDQREIMQWASHFT KELGKTGQLSFDFIQAEDGTVYAIECNPRTHSAITMFYNHPGVADAYLGKEPLAESL QPLPDSKPTYWLYHEVWRLNEIRSFKQLQTWVRNIRRGKEAIFEVSDPLPFLMVHHW QIPLLILDNLRRLKGWIRIDFNMGELIE A0A3N6PGG7 (SEQIDNO:84) MALILFVQGRAYALFQNLGTLILLLIVLPFNFLKVIPSLLWNFISQPFQKKVVAENPKN ILITGAKMTKCLQLARSFHAAGHKVFLLEANKYWLSGNRFSNAVTGFYTLPFPQKD WEGYSQGLLEIIKKEKIDVFIPVSSPAGSYYESLAKPLISEHCEVLHFDAEITQLLDNKF TFIEKAKSFGLSVPKSFLITNPEQVLNFDFATDGSKYILKSIPYDSVRRLDMTKLPMNS KAEMEEFVNSLPISEQRPWIMQEFVKGKEYCTHSTVRKGKVRLYCCCESSEFQVNYH HVDRPQIYQWVEKFVRELNITGQISFDFIQTEDGRVYPIECNPRTHSAITTFYDHPGVA DAYLKDSKDENEASLIPLPNSKPTYWTYHELWRLTGIRSLGQLKTWINRIFQGTDGIF QINDPLPFLMVHHWQIPLLLLGNLQKLKGWVRIDFNIGKLVELGGD A0A0C2QMV0 (SEQIDNO:85) MKEQIFIVFQNLGTLVLLAIAFPFNCIVVLTSLVWNFIKQPFSQSIVVNPNSKNILIAGA RMTKTLQLARSFHAAGHRVIIIDIEKFWSSGNKYSNSVAGFYTVPDPSKDLEGYVESL HAIAKKEKIDFFIPVAIFSVIHYDSQGKPPLPDDVEFFHFDADVTKILDDKFAFAETAR SFGLSVPKSFKITDPEQVLNFDFSQEKRKYILKSIPYDQVRRLNLTKLPCDTPSQTAAF VKTLPISEEKPWIMQEFIPGKEYCTHTTARDGESRMYCCCESSAFQVNYENVDQPEI MQWASHFTKELGKTGQLSFDFIQAEDGTVYAIECNPRTHSAITMFYNHPGVADAYL GKEPLAESLQPLSDSKPTYWLYHEVWRLNEIRSFKQLQTWVRNIRRGKEAIFEVSDPL PFLMVHHWQIPLLILDNLRRLKGWIRIDFNMGELID Q3M6C5 (SEQIDNO:86) MAQSLPLSSAPATPSLPSQTKIAAIIQNICTLALLLLALPINATIVFISLLVFRPQKVKA ANPQTILISGGKMTKALQLARSFHAAGHRVVLVETHKYWLTGHRFSQAVDKFYTVP APQDNPQAYIQALVDIVKQENIDVYIPVTSPVGSYYDSLAKPELSHYCEVFHFDADIT QMLDDKFALTQKARSLGLSVPKSFKITSPEQVINFDFSGETRKYILKSIPYDSVRRLDL TKLPCATPEETAAFVRSLPITPEKPWIMQEFIPGKEFCTHSTVRNGELRLHCCCESSAF QVNYENVNNPQITEWVQHFVKELKLTGQISFDFIQAEDGTVYAIECNPRTHSAITTFY DHPQVAEAYLSQAPTTETIQPLTTSKPTYWTYHEVWRLTGIRSFTQLQRWLGNIWRG TDAIYQPDDPLPFLMVHHWQIPLLLLNNLRRLKGWTRIDFNIGKLVELGGD A0A1Z4ND62 (SEQIDNO:87) MIDTVSLNKSLAEKGFGRREIGVIGRNLATLGLLLLVLPINLLLTGVGLISRVSLRNPIS QKTILISGGKMTKALLIARRFHAAGHRVILIESHKYWLTGHRFSNAVNKFYTVPAPEK NPSAYIQALLDIIKREKVDLYVPVCSPVASYYDALVKSEMGFLTQVFHCDPEMVKML DDKFTFAETARKLGLSVPKSFLITHPHQVINFDFQKETRPYILKSIRYDSVRRLDLTKL PCETPEATERFVRSLPISPENPWIMQEFIPGQEYCTHSTVKNGELRMHCTSKSSAFQV NYENIDHPRIQSWVSKFVKELGITGQVSFDFIETEDGEVYAIECNPRTHSAITMFYNHP RVADAYLDEGVWEQPIQPLPDSKPTYWLYHEIWRLTGIRSWKDLQYRWKVLSTGV DAIYSLDDPLPFLMVHHWQIPLLLWQNLLQLRGWVRIDFNIGKLVELGGD A0A0D8ZR72 (SEQIDNO:88) MQKMFAIFQNLGTLTLLAIAFPFNCIVVLSALVWNLISQPFQKQVVFNPDAKNILIGG GRMTKTLQLARSFHAAGHRVILFDIDKNWFSGYRFSNAVAGFYTVPDPIKDLEGYTI ALRAIAKQENIDFFVPVGIFANDYFDSKRQPVLSGCCETFHFDADTMKMLDNKFTFT QKARSLSLSVPKAYLITDPEQVLKFDFSNEKNKYILKSIVYDPVFRLDLTKLPMESLE KMAIHVRNLPISKDNPWILQEFITGQEYCTHSTVRNGELTVHCCCESSAFQVNYENV DKPEILQWVSHFVKELQLTGQISFDFIQAEDGTIYAIECNPRTHSAITMYYNHPGLAD AYLGQKPLAELLQPLPDSKPTYWLYHEVWRLNEIRSLKQLQTWFKNILRGKDAIFDV NDPLPFLMVHHWHIPLLLLDNLQKLKGWVRIDFNIGKIVQVSD A0A2T1LWM6 (SEQIDNO:89) MDNLFNSSADSSSLSKGWLRSIQGSSLKTLGTLLLLLLMLPFNLALTLTALVWSWVW PFRKRVIASNPKTVMISGGKMTKALQLARSFYMAGHRVILVETHKYWLVGHRYSW AVDRFYTIPDPKQDTEGYLQGLLDIAQKEQVDLYVPVCSPVASYYDALAKELLAQQ CDVFHEDAKTVQQLDDKYQFAQAATNLGLTVPKSFKITHPQQVLDFDFSKETHPYII KSIPYDSVNRLNLTKLPCASRQDTEMFVNSLPISETKPWVMQEFITGQEYCVHSTVK NGELRVYCCCESSAFQVNYEAVDIPEIKQWVTQFVQGMKLTGQMSFDFIRTPTGEVY AIECNPRTHSAITLFYNHPDLAKAYLDPEPFSEPLEPLASARPTYWTYHEFWRLVTHL SSLQEVAYRLGILFKGKDAIFSWNDPLPFLMVHGWQIPLLLLKSLRQGKDWIRIDFNI GKLVQMGGD K9XU47 (SEQIDNO:90) MTQIFFVSGRGSAVLQNLGTLVLLLFLLPFNLIAVAFSAVINIFSGSKQRLTKTDVPKR ILITGAKMTKALQLARSFHQRGHEVYLVETHKYWLSGHRFSRAVKGFFTVPTPEKEP DAYCQRLLEIVQQKNIDVFIPVSSPIASYYDSLAKKILEPDCEAIHFDPEITAMLDDKY AFCTKAKELGLSAPKVFCFTSPQQVIDFDFESDGSQYIVKSIPYDSVRRLDLTKLPFEG MESYLRSLPISSEKPWVMQEFIRGQEYCFHATVRKGKIRLHCCSQSSPFQVNYEQVD NPAIYQWVEKFVRELNLTGQICFDMIQTPDGTVYPIECNPRLHSAITMFHDHPGVAD AYLLDGEQAITPLPDSKPTYWTYHELWRLLQVRSLSELQAWWHKVSRGTDAILQGD DPLPFLMLHNWQIPLLLLDNLRRLKGWIRIDFNIGKLVELEGD A0A2Z6D2K3 (SEQIDNO:91) MTQSISLSLPESTTPSTGIKVKIVALFKTLGTLTLLLIALPENVLIVLISLLWGIVRVPF TKNVVATHPQTILVSGAKMTKALQLARSFHADGHRVILIEGHKYWLSGHRFSKAVS RFYTVPAPQSDPEGYIQALIEIVKKEKVDVYVPVCSPVASYYDSLAKPALSEYCEVFH FDADITKMLDDKFAFTEKARSLGLSVPKSFKITDPQQVINFDFSQETRKYILKSINYDS VRRLNLTKLPCDTPEQTAAFVKSLPISPETPWIMQEFIPGKEFCTHSTVRDGELRLHCC CHSSAFQINYENVENPQIQAWIQHFVKSLRLTGQVSFDFIQAEDGQVYAIECNPRTHS AITMFYNHPGVAEAYFGKTPLAAPLEPLPSSKPTYWTYHEIWRLTGVRSWKQLQTRL NILLRGTDAIYCLDDPIPFLTLHHWQIPLLLLQNLQQLKAWVKIDFNIGKLVELGGD A0A5P8W9G9 (SEQIDNO:92) MAQSISLSVPKSTTPSTGVSIKIVALFKTLGTLTLLLIALPINAFIVLLSLLWGILFTKK PAVAAHPQNILVSGGKMTKALQLARSFHAAGHRVILIEGHKYWLSGHRFSNAVSRF YTVPAPQDDPQGYTQALLEIVKQEKIDIYVPVCSPVASYYDSLAKPALSEYCEVFHFD ADITKMLDDKFAFTDQARSLGLSVPKSFKITDPEQVINFDFSKETRKYILKSISYDSVR RLNLTKLPCDTPEETAAFVNSLPISPEKPWIMQEFIPGKELCTHSTVRDGELRLHCCSD SSAFQINYENVENPQIREWVQHFVKSLGLTGQVSFDFIQAEDGTAYAIECNPRTHSAI TMFYNHPGVAEAYFGKTPLAAPLEPLADSKPTYWVYHEIWRLTGIRSGKQLQTWFA RLVRGTDAIYKIDDPLPFLTLHHWQIALLLLQNLQQLKGWVKIDFNIGKLVELGGD A0A1S6LXZ0 (SEQIDNO:93) MRKHIFVVFQNLGTLVLLAIAFPLNCIVVLTSLLWSFIKQPFNKSIVVNPNSKNILIAG ARMTKTLQLARSFHAAGHRVIIIDIEKYWLSGNKYSNSVAGFYTVPDPSKDLEGYVE TLHAIANTEKIDFFIPVAIFSVIHYDQGKPPLPDCVEFFHFDADVTKILDDKFAFAETA RSFGLSVPKSFKITDPEQVLNFDFSQEKRKYILKSIPYDQVRRLNLTKLPCDTKSETAA FVKSLPISEENPWIMQEFIPGKEYCTHTTARDGESRMYCCCESSAFQVNYENVDQREI MQWASHFTKELGKTGQLSFDFIQAEDGTVYAIECNPRTHSAITMFYNHPGVADAYL GKEPLAESLQPLPDSKPTYWLYHEVWRLNEIRSFKQLQTWVRNIRRGKEAIFEVSDPL PFLMVHHWQIPLLILDNLRRLKGWIRIDFNMGELIE A0A1Z4LFB5 (SEQIDNO:94) MAQSISVSSSPAIPSFPSETKIAVIIQNLLTLALLLLALPINAAIVLVTLLWHTISRPFQQP ATKAANPKNILISGGKMTKALQLARSCAAAGHRVILIETHKYWLSGHRFSQAVDKFY TVPAPQENPERYTQALIDIIKQENIDVYIPVTSPLGSYYDSLAKPLLSEYCEVFHFDIDI TEKLDDKFAFAETARSLGLSVPKSFKITSAEQVLNFDFSQESRKYILKSIPYDSVRRLD LTKLPCATPEETAAFVRSLPISPDKPWIMQEFIPGKEFCTHSTVRDGELRLHCCCESSA FQVNYENVENSQIREWVRHFVKELKLTGQVSFDFIQAEDGRVYAIECNPRTHSAITTF YDHPQVAQAYLDNEPMAETLQPLPSSKPTYWTYHEVWRLTGIRSFTQLKKWIANIW RGTDAIYKPDDPLPFLMVHHWQIPLLLLKNLRQIKGWTRIDFNIGKLVELGGD A0A4D9CF37 (SEQIDNO:95) MTQSISVASVGQTTQSVTLGLRISALFKNLATLALLLLVLPINAAIVLVSLLLGSQSQA IATEPKNILISGGKMTKALQLARSFHAAGHRVVLVETHKYWLTGHRFSKAVSRFYTL PTPQSDPEAYTQALLDIVQKESINVYVPVCSPVSSYYDSLAKPVLSKYCEVFHCDAD VTQMLDDKYAFAEKARSLGLSVPKSFKITDPKQVINFDFSQEKRKYILKSIPYDSVRR LDLTKLPCESPEATADFVNSLPISSQKPWIMQEFIPGKEFCTHSTVRNGELRMHCCCE SSAFQVNYENVDHPQILEWVRHFVKALGITGQVSFDFIEAQDGTIYAIECNPRTHSAIT MFYNHPDVANAYLSEIPQVEPIQPLINSKPTYWTYHEIWRLTGIRSFSQLQTWVKNFF GGKDAIYSLSDPLPFLTVHHWQIPLLLLQNLQQLKGWIRIDFNIGKLVEFGGD A0A1B2CWF7 (SEQIDNO:96) MAQSIPFDSASPTPQVSWGVRISALWKTVGTLLLLFLALPVNASIVLISLLWGIFSKPF EKRVVAAAPKNILISGGKMTKALQLARSFHAAGHRVVLVESHKYWLTGHQFSNAVS VFYTVSPPEKDPEGYTQQLLDIVKKERIDVYVPVCSPVASYYDSLVKPALSQHCEVF HCDAEITQMLDDKYAFSEKARSFGLSVPKSFKITNPEQVINFDFSQEKRKYILKSIPYD SVRRLNLTKLPCDTPEETAAFVRSLPISPEKPWIMQEFIPGKEFCTHSTVRNGELRLHC CCESSAFQVNYENVNNPQILEWVKHFIKEMGITGQVSFDFIQTEDGTVYAIECNPRTH SAITMFYNHPGVADAYLGKIPLPEPLQPLADSKPTYWLYHEIWRLTGIRSLSQFWTW LKNLMRGKDAIYQLNDPLPFLTVPHWQITLLLLQNLRQLRGWVKIDFNIGKLVELGG D A0A0C1N3Z4 (SEQIDNO:97) MTQSISFSSPVPATPPFCVKTRFIALFQNLGALTLLLLALPINVAIVLISLIWSFLSRLFS TQETTVAGAKNILISGGKMTKALQLARFFSAAGHRVVLIETHKYWLSGHRFSNAVSR FYTTPTPQDEPEEYIQTLVDIVKRENIDVYVPVTSPVASYYDSLAKPALSPYCEVLHF DADVTKMLDDKFAFSEKARALGLSVPKSFKITNPEQVLNFDFSQETRKYILKSLPYDS VRRLDLTKLPCNTPEETAAFVKSLPISLEKPWIMQEFIPGKEFCTHSTVRNGDLKLHC CSESSAFQVNYENVKNPKIQEWVRHFVKGLGLTGQVSFDFIQADDGKVYAIECNPRT HSAITMFYNHPQVADAYLGTEPLAEPLAPVPNSKPTYWLYHEVWRLTGIRSFAQLQS WIRNILRGTDAIYELHDPLPFLMVHHWQIALLLLNNLRQLKGWTKIDFNIGKLVELG GD A0A2L2N6B5 (SEQIDNO:98) MRKHIFVVFQNLGTLVLLALAFPLNSIVVLTSLLWNFLKQPFSKSIVVNPNSKNILIAG ARMTKTLQLARSFHAAGHRVIIIDIEKFWSSGNKYSNSVAGFYTVPDPSKDLEGYVE TLHAIAKTEKIDFFIPVAIFSVIHYDRGKPPLPDFCEFFHFDADVTKSLDDKFAFAETA RSFGLSVPKSFKITNPEQVLNFDFSQEKRKYILKSIPYDQIRRLNLTKLPCDTQSETAAF VKSLPISEENPWIMQEFIPGKEYCTHTTARDGESRMYCCCESSAFQVNYENVDRLEIM EWASHFTKQLGKTGQLSFDFIQAEDGTVYAIECNPRTHSAITMFYNHPGVADAYLGK NPLAESLQPLGDSKPTYWLYHEVWRLNEIRSFKQLQTWLRNIRRGKEAMFEVSDPLP FLMVHHWQIPLLILDNLRRLKGWIRIDFNMGELIE A0A1Z4Q915 (SEQIDNO:99) MVELQFIKARIFAVFRNLGTLALLAIAFPFNCIVVLAALLWNFFTRPFQKQVVLSENP KNILIGGGRMTKTLQLARSFHAAGHRVILVDIHKYWLSGHRFSKAVAGYYTVPEPQK DLEGYTQALRAIAKKENIDFFIPVAIFAVSYFDPQNKPVLAGCCEIFHEDGEVTKMLD DKFAFAEKARSFGLSVPKSFKITAPEQVLNFDFSQEKNKYILKSIPYDSVRRLNMTKL PCDTTEQTAAFVKSLPISEENPWIMQEFIPGQEYCTHSSLRNGELRLHCCCESSAFQV NYENVDKPEIMQWVSHFVKELGLTGEASFDIIQAVDGTVYPIECNPRTHSAITMFYN HPGVADAYLGKEPLAEPLQPLPDSKPTHWLYHEVWRLTGIRSLKQLQTWVRNILRG KDAIFEVHDPLPFLMVHHWQIPLLLLDNLRRLKGWIRIDFNLGELIE A0A2Z5VN68 (SEQIDNO:100) MHFNCGAEKLMAQSISLSLPKSTTPSTGVRIKIVALFKTLGTLTLLLIALPINAFIVLLS LLWSIPFTKKPAVAAHPQNILVSGGKMTKALQLARSFHAAGHRVILVEGHKYWLSG HRFSKAVSRFYTVPAPQDDPEGYTQALLEIVKQEKIDIYVPVCSPIASYYDSLAKPALS EYCEVFHFDADITKMLDDKFAFTDQARSLGLSVPKSFKITDPEQVINFDFSKETRKYIL KSISYDSVRRLNLTKLPCDTPEETAAFVNSLPISPEKPWIMQEFIPGKELCTHSTVRDG ELRLHCCSDSSAFQINYENVENPQIREWVQHFVKSLGLTGQVSFDFIQAEDGTAYAIE CNPRTHSAITMFYNHPSVAEAYFGKTPLAAPLEPLADSKPTYWVYHEIWRLTGIRSG KQLQTWFTRLVRGTDAIYKIDDPLPFLTLHHWQIALLLLQNLQQLKGWVKIDFNIGK LVELGGD A0A1Z4UKN2 (SEQIDNO:101) MFPINLTLVITAFLTNLITLPFQKKITYENPKNILLTGGKMTKSLQLARSFHRAGHKVF MVETHKYWLSGHQYSKAVKKFLTVPAPEKDPEGYCQSLLDIVKREKIDVFIPVSSPV ASYYDSLAKPILSPYCEVFHFDTEMTKTLDDKFSLCEQARVLGLTAPKVFLITSPGEII NFDFSQEQNPYIIKSIQYDSVTRLDMTKFPFEGMKEYVKKLPISKERPWVMQEFIKGQ EYCTHSTVRDGEIRLHCCSKSSPFQVNYEQVDNPEIFQWVQKFVKELNLTGQISFDF MQTEDGKVYPIECNPRTHTAITMFYDHPGLADAYLEPGKNQPHIEPLPTSKPTYWLY HELWRITGIRSFNDLTNWLNKVIKGKDAMLDKDDPLPFLMVHHWQIVLLLLQNMV KLKGWVRIDFNIGKLVEIGGD A0A5Q0GJK5 (SEQIDNO:102) MAQSLPLSSAPATPSLPSQTKIAAIIQNICTLALLLLALPINATIVFISLLVFRPQKVKA ANPQTILISGGKMTKALQLARSFHAAGHRVVLVETHKYWLTGHRFSQAVDKFYTVP APQDNPQAYIQALVDIVKQENIDVYIPVTSPVGSYYDSLAKPELSHYCEVFHFDADIT QMLDDKFALTQKARSLGLSVPKSFKITSPEQVINFDFSGETRKYILKSIPYDSVRRLDL TKLPCATPEETAAFVRSLPITPEKPWIMQEFIPGKEFCTHSTVRNGELRLHCCCESSAF QVNYENVNNPQITEWVQHFVKELKLTGQISFDFIQAEDGTVYAIECNPRTHSAITTFY DHPQVAEAYLSQAPTTETIQPLTTSKPTYWTYHEVWRLTGIRSFTQLQRWLGNIWRG TDAIYQPDDPLPFLMVHHWQIPLLLLNNLRRLKGWTRIDFNIGKLVELGGD A0ZIV3 (SEQIDNO:103) MAQSISLSLGNSPTSSTGVWVKLVALFKTLGTLTLLLIALPFNALIVLISLLWGFVRSP FRQKAVVAEHPQTILVSGAKMTKALQLARCFHAAGHRVILIEGHKYWLSGHRFSKA VSGFYTVPAPQLDPEAYIQALVDIVEKEQVDVYVPVCSPVASYYDSLAKPALSEYCE VFHFDADVTKMLDDKFAFTAQARSLGLSVPKSFKITDTQQVINFDFSQETHKYILKNI AYDSVRRLNLTKLPCDTPEETAAFVNSLPISEENPWIMQEFIPGKELCTHSTVRDGEL RLHCCSDSSAFQINYENVENTQIREWVQHFVKSLALTGQISFDFIQAESGTVYAIECNP RTHSAITMFYNHPGVAEAYLGKTTLDAPLEPLTNSKPTYWIYHEIWRLTGIRSWKQL QTAVNTLLRGTDAIFQLNDPVPFLTLHHWQIPLLLLKNLQQLKGWVKIDFNIGKLVE LDGD A0A3S1ANM2 (SEQIDNO:104) MIIHMAQSISLSSPAKTHAPGISASSLKTLGTLTLLLLALPLNASLVLVALLLKSLRPQ NFTTEKPKNILISGGKMTKALQLARSFHNAGHRVILLEAHKYWLTGHRFSSAVNKFY TVEAPEKDPEGYIQSLVDIVEKENIDVYVPVCSPVASYYDSLAKKALPQCEVIHCDAE MTQMLDDKHAFAQTAQSFGLSVPKSFKITDPEQVINFDFSQEKRKYILKSIPYDSVRR LDLTRLPCDTPEATAAFVRSLPISSEKPWIMQEFIPGKEYCTHSTVRNGVITLHCCCES SAFQVNYENVDNPKIFEWVSRFVKELGITGQVSFDFIEAEDGNIYAIECNPRTHSAITM FYNHPGVADAYLGTGNNLAEPIQPKFTSKPTYWTYHEIWRLFNTRSWSDFVYRFKII KHGKDAIFSWQDPLPFLMNPHWQIFLLLIQNLQKNRGWIRIDFNIGKLVELGGD MysC-158 (SEQIDNO:113) MSLSAPPSRSKIRSTLKTLGTLVLLLLALPLNAAIVLVALLRNLITRPRKRATAANPKT VLISGGKMTKALQLARSFHRAGHRVILVETHKYWLTGHRFSNAVDRFYTVPAPQDD PEGYAQALLDIVQKENVDVYVPVCSPVASYYDALAKETLSPHCEVFHFDADTVKML DDKYQFAEMARSLGLSVPESHRITSPEQVLDFDFSQSEGRKYILKSIAYDSVRRLDLT KLPCPTPEETAAFVRSLPISPDNPWIMQEFIEGQEYCTHSTVRDGRLRLHCCCESSAFQ VNYEHVDNPEIQEWVQRFVKALNLTGQVSFDFIQTDDDGRVYAIECNPRTHSAITMF YNHPGVAEAYLDPDPDLAEPIQPLPSSRPTYWLYHELWRLLTHPRSLQDLRERLKTIF RGKDAIFDWDDPLPFLMVHHWQIPLLLLKNLRQGKDWVRIDFNIGKLVELGGD MysC-175 (SEQIDNO:114) MVVAENPKNILITGGKMTKALQLARSFHAAGHRVFLVETHKYWLSGHRFSNAVDRF YTVPAPQKDPEGYVQGLLDIVKQENIDVFIPVSSPVASYYDSLAKPVLSPYCEVFHFD AEITKMLDNKFTFSEKARSLGLSAPKSFLITDPEQVLNFDFAADQGSQYILKSIPYDSV HRLDMTKLPCDKEEMAEYVKSLPISEENPWIMQEFITGQEYCTHSTVRDGKIRLHCC SKYPTLFTASSAFQVNYEHVDNPAILQWVTRFVKELNLTGQISFDFIQAEDDGTVYPI ECNPRTHSAITMFYNHLPGVVADAYLKDSPDEEEPIQPLPDSKPTYWLYHELWRLTEI RSWSQLQAWINNILKGTDAIFQVNDPLPFLMVHHWQIPLLLLNNLRKLKGWVRIDEN IGKLVELGGD MysC-225 (SEQIDNO:115) MVVAENPKNILITGGKMTKALQLARSFHAAGHRVFLVETHKYWLSGHRFSNAVDRF YTVPAPQKDPEGYIQALLDIVKQENIDVFVPVSSPVASYYDSLAKPVLSPYCEVFHFD ADITKMLDDKFTFSEKARSLGLSAPKSFLITDPEQVLNFDFASDQGSQYILKSIPYDSV HRLDMTKLPCDSKEEMAAYVKSLPISEENPWIMQEFITGQEYCTHSTVRDGKIRLHC CSKYPTLFTASSAFQVNYEHVDNPKILQWVTRFVKELNLTGQISFDFIEAEDDGTVYA IECNPRTHSAITMFYNHLPGVVADAYLGKSPSAEEPIQPLPDSKPTYWLYHEVWRLTE IRSWSQLQTWINNILRGKDAIFQVNDPLPFLMVHHWQIPLLLLNNLRKLKGWVRIDF NIGKLVELGGD MysC-230 (SEQIDNO:116) MVVAENPKNILLTGGKMTKALQLARSFHAAGHRVILVETHKYWLSGHRFSNAVDRF YTVPAPQKDPEGYTQALLAIAKQENIDVYVPVCSPVASYYDSLAKPVLSGCCEVFHF DADVTKMLDDKFAFSEKARSLGLSVPKSFLITDPEQVLNFDFSNEQKRKYILKSIPYD SVHRLDMTKLPCDSKEEMAAYVKSLPISEENPWIMQEFIPGKEYCTHSTVRNGELRL HCCCEYPTLFTASSAFQVNYENVDNPKILQWVSHFVKELKLTGQISFDFIEAEDDGTV YAIECNPRTHSAITMFYNHLPGVVADAYLGKEPLEEPLQPLPDSKPTYWLYHEVWRL TEIRSFSQLQTWIKNILRGKDAIFSVNDPLPFLMVHHWQIPLLLLNNLRRLKGWIRIDF NIGKLVELGGD
[0155] In some embodiments, the one or more biosynthetic enzymes comprise a dimethyl-4-deoxygadusol synthase (MysA), or a homolog thereof. Exemplary MysA enzymes for use in the present invention include, but are not limited to, the amino acid sequence of any one of SEQ ID NOs: 105-111, or an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of any one of SEQ ID NOs: 105-111:
TABLE-US-00004 A0A2K8WSM2 (SEQIDNO:105) MGNGALAENLKEDDKTVIWRPHEEKYRTSEWYTGSGQITTADEGLSFEVTAVYQLK SEVKVVKDIFAISNHTLANIYRPRSRCIAVVDQTVAELYGEKIEGYFQAQEIPLELMVI RAWESDKTPETVHRILAFLGKDGCDVSRNEPVLVIGGGVLSDVAGLACALQHRRTP YIMIGTTIIAAIDAGPSPRTCTNGTQFKNSIGVYHPPVLTLVDRQFFSTLDMGHIRNGM AEIIKMAVTDDKELFELLEQYGQELIKTRFATIDASEELEKIADLIIYKALYAYMKHEG TNMFETYQDRPHAYGHTWSPRFEPAVKLMHGHAVTIGMAFGATLAQELGWLSQEE CQRIINLSSKLGLSVFHPILEDVQIMVDGQKNMRRKRGDGGLWAPLPTTIGACDYVQ EVEPELLNQAVVAHKKYCSQLPHEGAGEQMYLSDLGLE A0AOD5ACA9 (SEQIDNO:106) MSNLQAQVVAGDRSFRVEGYERIEYDLIYVDGVFAIENTELADSYRPYGRALMVVD EAVHDIYGDRISAYFDHHEIALTVVPVHIAETAKSLETFERIVGEFDAFGLVRTEPVLV VGGGLTTDVAGFACASYRRNTPYIRIPTTLIGLIDASVSIKVAVNYGKHKNRLGAYH ASQKVLLDFSFLGTLPEDQVRNGMAELIKISVVGNLEIFEMLEQYGPELLRTRFGHLD GTAELRSVADKLTYSAIATMLELEAPNLHEIDLDRVIAFGHTWSPTLELTPPAPFFHG HAINIDMALSTTVAEQRGHLSTADRDRVLGVMSSIGLALDSPYLTPELLSEATASILK TRDGILRAAVPDPIGTCRFLNDLDAAELADVLTLHKKICLDFPRAGEGLDMFTAPTP A0A0K1S781 (SEQIDNO:107) MAGIKATFTSTDCAFHIQGYEKIDFSLLYVNGAFKIGNPEIAESYAPFRRCLMVIDQT VYGLYRQQIDQYFAHYQIDLTVFQVSIKEPEKTLRTFEKIVDAFADFGLVRKEPVLVV GGGLTTDVAGFACSAYRRKTNYIRVPTSLIGLIDASVAIKVAVNHGKLKNRLGAYHA SQKVILDFSFLGTLPIDQIRNGMAELIKIAVVGNQEIFELLEEHGAALLHSRFGYLNGT PELQAVGHRLTYKAIQAMLELEVPNLHELDLDRVIAYGHTWSPTLELTPEPPMLHGH SVNIDMAFTATIAQLRGYISVEDRNRILGLMSRLGLAIDSPYLTPELLWKATEAITRTR DGLQRAAAPRPIGQCVFMNDLTRSELDKALAVHRAIAQNYPRQGNGEDMYVRLEP ALEGAGV A0A0P4UW20 (SEQIDNO:108) MSSVQAKVEVTDQSFHLEGYEKIEFNLDLIEGLFEVGNSGLADNYRTLGRCLAVVDH NVDRLYGDQLRSYFEYYEIDLTVFAIEITEPTKTIDTFLKITDAFCDFNLKRKEPVLVIG GGLVLDVAGFACSAYRRSTNYIRVPSTLIGLIDAGVAIKVAVNHGKLKNRLGAYHPP KQVILDFSFLKTLPVDQIRNGMAELVKIAVVSNEEVENLLEQHGEELLYNHFGFVGN DAELKQIGHRVNYESIKTMLELEAPNLHELMLDRVIAYGHTWSPTLELAPQIPLLHG HAVNIDMAISATIAEKRGYISALDRDRILGLMSRLGLALDHPLMEIDLMWKATQSIM LTRDGFLRAAMPRPIGTCYFVNDLTREELESAIADHKRLCADYPRAGAGIDAYVGSS ELIGSAN A0A1Q8JXW2 (SEQIDNO:109) MSNPQAVLSATDTEFRVESWERIEFTLSYVDGVFAPHNTELADLYRPWGRCLMVIDE TVHEHYGDPIRSYFDHHDIAVTLVPLTIAETAKSLRTLERIVDAYADFGLLRTEPVLV VGGGLTTDVTGFACASYKRGTPYVRIPTTLIGLIDASVAMKVAVNHGRHKNRLGAF HASQQVLLDFSFLATLPEAQVRNGVAEMIKIATVANAGLFDLLEKYGDDLLATRFGH REGTPELRQIAHRCTYDAIHTMLELEHRNLHELDLDRVIAFGHTWSPTLELAPPTPML HGHAIAIDMAFSATLAARRGDITTGERDRIHRLFSGLGLSVDSTYLTEQLLIDATASIM QTRAGKLRAALPRPIGTCHFANDIEHTELIETLAAHKAVVAGLPTSVEGVEMWSSAK TELTTAPNTEART A0A347Q3N8 (SEQIDNO:110) MTTNLTATVTATENDERVRAVEERDYLLTYVDGAFSPESSRIADHHRAHGRCLMIV DANVHRLHGDRIRAYFEHHGIALTALPLAIDETQKSLRTVERIVDAFGEFGLIRKEPV LVVGGGLLTDVAGFACAVFRRSTDYVRVPTSLIGLIDASVAIKVAVNHGRTKNRLGA FHASKEVVLDFSFLGTLPTEQVRNGMAELVKIAVVANAEVFRLLEKYGEDLLHTAFG TVDGTPQLRETARKVTHEAIGTMLALEAPNLRELDLDRAIAFGHTWSPALELAPETP YLHGHAISVDMALSCTIAERRGYLATSERDRIFWLLSKVGLSLDSPHLTPELLRAATE SIVQTRDGLQRAAMPRPIGTCCFVNDLTESELLDGLAAHRELVARYPRGGAGEDVRV TRSGAA A0A6J4VHE9 (SEQIDNO:111) MSTVQAKFEATETAFHVEGYEKIDFSLVFVNGAFDTKNRELADSYRNFGRCLAVVD ANVNRLYGSQICEYFKYYNIDLNLFPVTISEPTKNLDTFQSIVDAFADFGLVRKEPVLI VGGGLVTDVAGFACAAYRRSTNYIRIPTTLISLVDAGIAIKVAVNHGKLKNRLGAYH APKKVMLDFSFLRTLPTPEVRNGMAELVKIAVVSNVEVFELLCEYGADLLTTHFGFD GGTPLLKEVAHRINYESIKTMLALETPNLHELDLDRVIAYGHTWSPTLELAPSVPLLH GHAVNIDMALSATIAEKRGYITVEERDRILGLMSQLGLALDHPLLDIDLLWSATQSIT LTRDGLQRAAMPRPIGKCFFVNDLTREELDAALAEHKHACAQYPRAGAGVDAYVG SYQQQNLIEGIANV
[0156] In some embodiments, the one or more biosynthetic enzymes comprise an O-methyltransferase (MysB), or a homolog thereof. Exemplary MysB enzymes for use in the present invention include, but are not limited to, the amino acid sequence of SEQ ID NO: 112, or an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 112:
TABLE-US-00005 A0A1Z4LFB8 (SEQIDNO:112) MSTTIAKPTARPVTPVGILAKKLEAIVQKINQRTDLPADLVDNITQAWQLAAGLDPY LEEYTTSESSALTALAEKTSTEAWQEHFSEGTTVRPLEQEMLSGHVEGQTLKMFVH MTKAKRVLEIGMFTGYSALAMAEALPPDGVLVACEVDPFAAEVGQAAFDKSPDGK KIRVELGPALETLNKLVEAGESFDMVFIDADKKEYITYFQTLLDTNLLAPSGFICVDN TLLQGEVYLPTQQRTANGEAIAQFNRAVALDPRVEQVILPLRDGLTIIRRTA
[0157] In some embodiments, the one or more biosynthetic enzymes comprise a non-ribosomal peptide synthetase (NRPS)-like enzyme (MysE), or a homolog thereof. In certain embodiments, the one or more biosynthetic enzymes comprises an enzyme with an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence of a MysE enzyme, or a homolog thereof.
[0158] Compounds of varying structures can be produced using the methods of the present invention. In some embodiments, the compound is a palythine analog. In certain embodiments, the compound has UV-modulating activity. For example, the compounds of the present invention may absorb UV wavelengths between 310 nm and 362 nm. In certain embodiments, the compound is a compound of Formula (I), or a salt thereof:
##STR00004##
[0159] In the compounds of Formula (I) described herein, each of R.sub.1, R.sub.2, R.sub.3, and R.sub.4 may independently be selected from the group consisting of OR.sup.a, (NH)R.sup.b, and N(R.sup.b).sub.2, wherein each instance of R.sup.a is independently hydrogen or optionally substituted C.sub.1-6 alkyl and each instance of R.sup.b is independently hydrogen or optionally substituted C.sub.1-6 alkyl. In some embodiments, R.sub.1 is OR.sup.a, wherein R.sup.a is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sub.1 is OCH.sub.3. In some embodiments, R.sub.2 is NH.sub.2. In certain embodiments, R.sub.3 is OH. In some embodiments, R.sub.4 is OH. In some embodiments, R.sub.1 is OCH.sub.3, R.sub.2 is NH.sub.2, R.sub.3 is OH, and R.sub.4 is OH.
[0160] The compounds of Formula (I) described herein also include a moiety R.sub.5. R.sub.5 may be any natural or non-natural amino acid, or a derivative thereof. In certain embodiments, R.sub.5 is threonine. In certain embodiments, R.sub.5 is serine. In certain embodiments, R.sub.5 is isoleucine. In certain embodiments, R.sub.5 is methionine. In certain embodiments, R.sub.5 is valine. In some embodiments, R.sub.1 is OCH.sub.3, R.sub.2 is NH.sub.2, R.sub.3 is OH, R.sub.4 is OH, and R.sub.5 is threonine. In some embodiments, R.sub.1 is OCH.sub.3, R.sub.2 is NH.sub.2, R.sub.3 is OH, R.sub.4 is OH, and R.sub.5 is serine. In some embodiments, R.sub.1 is OCH.sub.3, R.sub.2 is NH.sub.2, R.sub.3 is OH, R.sub.4 is OH, and R.sub.5 is isoleucine. In some embodiments, R.sub.1 is OCH.sub.3, R.sub.2 is NH.sub.2, R.sub.3 is OH, R.sub.4 is OH, and R.sub.5 is methionine. In some embodiments, R.sub.1 is OCH.sub.3, R.sub.2 is NH.sub.2, R.sub.3 is OH, R.sub.4 is OH, and R.sub.5 is valine.
[0161] In some embodiments, the compound of Formula (I) is of the formula:
##STR00005##
or a salt thereof.
In certain embodiments, the compound of Formula (I) is not
##STR00006##
In certain embodiments, the compound of Formula (I) is not
##STR00007##
In certain embodiments, the compound of Formula (I) is not
##STR00008##
In certain embodiments, the compound of Formula (I) is not
##STR00009##
In certain embodiments, the compound of Formula (I) is not
##STR00010##
In certain embodiments, the compound of Formula (I) is not
##STR00011##
In certain embodiments, the compound of Formula (I) is not
##STR00012##
In certain embodiments, the compound of Formula (I) is not
##STR00013##
In certain embodiments, the compound of Formula (I) is not
##STR00014##
In certain embodiments, the compound of Formula (I) is not
##STR00015##
[0162] In some embodiments, the compound produced by the methods described herein is of the formula:
##STR00016##
or a salt thereof.
[0163] In certain embodiments, the compound of Formula (I) is a compound delineated herein, including in any of the figures herein. In certain embodiments, the compound of Formula (I) is a compound of any of
[0164] The methods disclosed herein may further comprise providing a substrate of one of the MAA biosynthetic enzymes to the recombinant microorganism. In some embodiments, the substrate is a compound of Formula (II), or a salt thereof:
##STR00017##
[0165] In the compounds of Formula (II) described herein, each of R.sub.1, R.sub.2, R.sub.3, and R.sub.4 may independently be selected from the group consisting of OR.sup.a, (NH)R.sup.b, and N(R.sup.b).sub.2, wherein each instance of R.sup.a is independently hydrogen or optionally substituted C.sub.1-6 alkyl and each instance of R.sup.b is independently hydrogen or optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sub.1 is OH. In certain embodiments, R.sub.1 is OCH.sub.3. In some embodiments, R.sub.2 is OH. In certain embodiments, R.sup.2 is NH.sub.2. In some embodiments, R.sub.2 is (NH)R.sup.b, wherein R.sup.b is optionally substituted alkyl. In certain embodiments, R.sub.2 is NHCH.sub.2CO.sub.2H. In some embodiments, R.sub.3 is OH. In some embodiments, R.sub.4 is OH. In some embodiments, R.sub.1 is OCH.sub.3, R.sub.2 is (NH)R.sup.b, R.sub.3 is OH, and R.sub.4 is OH. In some embodiments, R.sub.1 is OCH.sub.3, R.sub.2 is NH.sub.2, R.sub.3 is OH, and R.sub.4 is OH. In some embodiments, R.sub.1 is OH, R.sub.2 is OH, R.sub.3 is OH, and R.sub.4 is OH. In some embodiments, R.sub.1 is OCH.sub.3, R.sub.2 is OH, R.sub.3 is OH, and R.sub.4 is OH.
[0166] The compounds of Formula (II) described herein also include a moiety Y. Y may be O or NR.sub.5, wherein R.sub.5 is optionally substituted C.sub.1-6 alkyl, optionally substituted C.sub.1-6 alkenyl, or an amino acid (e.g., any natural or non-natural amino acid, or a derivative thereof). In certain embodiments, Y is O. In some embodiments, Y is NR.sub.5. In certain embodiments, Y is NR.sub.5 and R.sub.5 is threonine. In certain embodiments, Y is NR.sub.5 and R.sub.5 is serine. In certain embodiments, Y is NR.sub.5 and R.sub.5 is isoleucine. In certain embodiments, Y is NR.sub.5 and R.sub.5 is methionine. In certain embodiments, Y is NR.sub.5 and R.sub.5 is valine.
[0167] In some embodiments, the substrate is a compound of the formula:
##STR00018## ##STR00019##
or a salt thereof. In certain embodiments, the substrate is not a compound of the formula
##STR00020##
In certain embodiments, the substrate is not a compound of the formula
##STR00021##
In certain embodiments, the substrate is not a compound of the formula
##STR00022##
In certain embodiments, the substrate is not a compound of the formula
##STR00023##
In certain embodiments, the substrate is not a compound of the formula
##STR00024##
In certain embodiments, the substrate is not a compound of the formula
##STR00025##
In certain embodiments, the substrate is not a compound of the formula
##STR00026##
In certain embodiments, the substrate is not a compound of the formula
##STR00027##
In certain embodiments, the substrate is not a compound of the formula
##STR00028##
In certain embodiments, the substrate is not a compound of the formula
##STR00029##
In certain embodiments, the substrate is not a compound of the formula
##STR00030##
In certain embodiments, the substrate is not a compound of the formula
##STR00031##
In certain embodiments, the substrate is not a compound of the formula
##STR00032##
[0168] In certain embodiments, the substrate is a compound delineated herein, including in any of the figures herein. In certain embodiments, the substrate is a compound of any of
[0169] In some embodiments, the methods described herein further comprise producing a glycosylated MAA. In certain embodiments, the one or more MAA biosynthetic enzymes encoded by the microorganism further comprise a glycosyltransferase (GlyT), or a homolog thereof.
[0170] Any suitable microorganism that can be genetically manipulated (e.g., genomically engineered, or transformed with a suitable vector to express a heterologous gene) may be used in the methods of the present invention. For example, the recombinant microorganism may be a species of bacteria or yeast. In some embodiments, the recombinant microorganism is a species of cyanobacteria. In some embodiments, the recombinant microorganism is a species of bacteria from the human microbiome (e.g., including, but not limited to, any of the species listed herein). In certain embodiments, the recombinant microorganism is E. coli.
[0171] The present disclosure also encompasses recombinant microorganisms for use in performing the methods of the present invention. For instance, in one aspect the present disclosure includes recombinant microorganisms comprising a heterologous nucleic acid encoding one or more MAA biosynthetic enzymes, wherein the one or more MAA biosynthetic enzymes comprise a phytanoyl-CoA dioxygenase (MysH), or a homolog thereof. In another aspect, the present disclosure provides methods of producing a compound, comprising culturing such a recombinant microorganism under conditions suitable for production of the compound and isolating the compound from the recombinant microorganism.
Compositions
[0172] In one aspect, the present disclosure provides compositions comprising a compound produced by the methods of the present invention (e.g., a compound of Formula (I), or a salt thereof). In some embodiments, the composition optionally comprises one or more suitable excipients. In certain embodiments, the compositions described herein comprise a compound of Formula (I), or a salt thereof, and an excipient.
[0173] In certain embodiments, the compound described herein is provided in an effective amount in the composition. In certain embodiments, the effective amount is a therapeutically effective amount. In certain embodiments, the effective amount is a prophylactically effective amount. In certain embodiments, the compound is provided in an amount effective for preventing sunburn in a subject. In certain embodiments, the compound is provided in an amount effective for preventing cancer (e.g., skin cancer) in the subject. In certain embodiments, the compound is provided in an amount effective for treating or preventing a chronic inflammatory disease or condition in a subject in need thereof. In certain embodiments, the effective amount is an amount effective for reducing symptoms (e.g., symptoms of sunburn) by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%.
[0174] Compositions described herein can be prepared by any method known in the art. In general, such preparatory methods include bringing the compound described herein (i.e., the active ingredient) into association with a carrier or excipient, and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping, and/or packaging the product into a desired single- or multi-dose unit, or into a formulation for topical administration.
[0175] Relative amounts of the active ingredient, the excipient, and/or any additional ingredients in a composition described herein will vary. The composition may comprise between 0.1% and 100% (w/w) active ingredient.
[0176] Excipients used in the manufacture of the provided compositions include inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and perfuming agents may also be present in the composition.
[0177] Exemplary diluents include calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, and mixtures thereof.
[0178] Exemplary granulating and/or dispersing agents include potato starch, corn starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose, and wood products, natural sponge, cation-exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross-linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (Veegum), sodium lauryl sulfate, quaternary ammonium compounds, and mixtures thereof.
[0179] Exemplary surface active agents and/or emulsifiers include natural emulsifiers (e.g., acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g., bentonite (aluminum silicate) and Veegum (magnesium aluminum silicate)), long chain amino acid derivatives, high molecular weight alcohols (e.g., stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g., carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvinyl polymer), carrageenan, cellulosic derivatives (e.g., carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g., polyoxyethylene sorbitan monolaurate (Tween 20), polyoxyethylene sorbitan (Tween 60), polyoxyethylene sorbitan monooleate (Tween 80), sorbitan monopalmitate (Span 40), sorbitan monostearate (Span 60), sorbitan tristearate (Span 65), glyceryl monooleate, sorbitan monooleate (Span 80), polyoxyethylene esters (e.g., polyoxyethylene monostearate (Myrj 45), polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and Solutol), sucrose fatty acid esters, polyethylene glycol fatty acid esters (e.g., Cremophor), polyoxyethylene ethers, (e.g., polyoxyethylene lauryl ether (Brij 30)), poly(vinyl-pyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, Pluronic F-68, poloxamer P-188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, and/or mixtures thereof.
[0180] Exemplary binding agents include starch (e.g., cornstarch and starch paste), gelatin, sugars (e.g., sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol, etc.), natural and synthetic gums (e.g., acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks, carboxymethylcellulose, methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum), and larch arabogalactan), alginates, polyethylene oxide, polyethylene glycol, inorganic calcium salts, silicic acid, polymethacrylates, waxes, water, alcohol, and/or mixtures thereof.
[0181] Exemplary preservatives include antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, antiprotozoan preservatives, alcohol preservatives, acidic preservatives, and other preservatives. In certain embodiments, the preservative is an antioxidant. In other embodiments, the preservative is a chelating agent.
[0182] Exemplary antioxidants include alpha tocopherol, ascorbic acid, ascorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and sodium sulfite.
[0183] Exemplary chelating agents include ethylenediaminetetraacetic acid (EDTA) and salts and hydrates thereof (e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like), citric acid and salts and hydrates thereof (e.g., citric acid monohydrate), fumaric acid and salts and hydrates thereof, malic acid and salts and hydrates thereof, phosphoric acid and salts and hydrates thereof, and tartaric acid and salts and hydrates thereof. Exemplary antimicrobial preservatives include benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and thimerosal.
[0184] Exemplary antifungal preservatives include butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and sorbic acid.
[0185] Exemplary alcohol preservatives include ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and phenylethyl alcohol.
[0186] Exemplary acidic preservatives include vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and phytic acid.
[0187] Other preservatives include tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, Glydant Plus, Phenonip, methylparaben, Germall 115, Germaben II, Neolone, Kathon, and Euxyl.
[0188] Exemplary buffering agents include citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, D-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free water, isotonic saline, Ringer's solution, ethyl alcohol, and mixtures thereof.
[0189] Exemplary lubricating agents include magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, and mixtures thereof.
[0190] Exemplary natural oils include almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauba, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury, sea buckthorn, sesame, shea butter, silicone, soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut, and wheat germ oils. Exemplary synthetic oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and mixtures thereof.
[0191] Dosage forms for topical and/or transdermal administration of a compound produced by the methods described herein may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants, and/or patches. Generally, the active ingredient is admixed under sterile conditions with an acceptable carrier or excipient and/or any needed preservatives and/or buffers as can be required. In some embodiments, the composition for topical administration is formulated as a sunscreen. In certain embodiments, the composition for topical administration is formulated as a cosmetic.
[0192] Formulations suitable for topical administration include, but are not limited to, liquid and/or semi-liquid preparations such as liniments, lotions, oil-in-water and/or water-in-oil emulsions such as creams, ointments, and/or pastes, and/or solutions and/or suspensions. Topically administrable formulations may, for example, comprise from about 1% to about 10% (w/w) active ingredient, although the concentration of the active ingredient can be as high as the solubility limit of the active ingredient in the solvent. Formulations for topical administration may further comprise one or more of the additional ingredients described herein.
[0193] The compositions described herein may also comprise one or more additional active ingredients (e.g., additional compounds with UV-modulating, anti-inflammatory, and/or anti-oxidative activity). In certain embodiments, a composition described herein including a compound described herein and an additional active ingredient shows a synergistic effect (e.g., improved prevention of sunburn in a subject) that is absent in a composition including either the compound or the additional active ingredient, but not both.
[0194] Thus, in one aspect, the present disclosure contemplates compositions comprising a compound produced by any of the methods of the present invention and optionally an excipient. In some embodiments, the composition is for topical administration. In certain embodiments, the composition is formulated as a sunscreen. In certain embodiments, the composition is formulated as a cosmetic (e.g., make-up, concealer, a moisturizer, etc.). In another aspect, the present disclosure provides methods of making a composition as described herein, comprising culturing a recombinant microorganism under conditions suitable for production of a compound, as described herein, and isolating the compound from the recombinant microorganism, wherein the recombinant microorganism comprises a heterologous nucleic acid encoding one or more MAA biosynthetic enzymes, wherein the one or more MAA biosynthetic enzymes comprise a phytanoyl-CoA dioxygenase (MysH), or a homolog thereof, and adding the compound to one or more excipients to produce the composition.
Methods of Prevention and Treatment
[0195] In another aspect, the present disclosure includes methods of administering a compound (e.g., any of the compounds disclosed herein). In some embodiments, a method of administering a compound comprises applying any of the compositions disclosed herein to a subject. In certain embodiments, the composition is applied on the skin of a subject in need thereof. In some embodiments, the method is a method preventing sunburn in a subject in need thereof.
[0196] In certain embodiments, the method is a method of preventing cancer in a subject in need thereof (e.g., skin cancers such as melanoma, basal cell carcinoma, or squamous cell carcinoma as described herein). MAAs and related compounds have utility as anti-cancer agents through their antioxidant and anti-proliferative activities (Mar. Drugs 2017, 15(10), 326). For example, the compounds of the present disclosure have UV-modulating activity and may prevent DNA damage in skin cells caused by UV radiation from the sun when applied to the skin in any of the compositions disclosed herein.
[0197] In certain embodiments, the method is a method of preventing or treating a chronic inflammatory disease in a subject in need thereof. For example, compounds of the present disclosure have anti-oxidative and anti-inflammatory activities and may prevent or alleviate symptoms of an inflammatory disease when applied to the skin in any of the compositions disclosed herein.
Compounds
[0198] In another aspect, the present disclosure provides compounds produced by the methods of the present invention. In some embodiments, the present disclosure provides compounds produced by culturing a recombinant microorganism under conditions suitable for production of the compound and isolating the compound from the recombinant microorganism. In certain embodiments, the recombinant microorganism comprises a heterologous nucleic acid encoding one or more MAA biosynthetic enzymes, wherein the one or more MAA biosynthetic enzymes comprise a phytanoyl-CoA dioxygenase (MysH), or a homolog thereof. In some embodiments, the heterologous nucleic acid encodes additional MAA biosynthetic enzymes (e.g., MysA, MysB, MysC, MysD, and/or MysE, or homologs or variants thereof).
[0199] In some embodiments, the compound is a compound of Formula (I), or a salt thereof:
##STR00033##
[0200] In the compounds of Formula (I) described herein, each of R.sub.1, R.sub.2, R.sub.3, and R.sub.4 may independently be selected from the group consisting of OR.sup.a, (NH)R.sup.b, and N(R.sup.b).sub.2, wherein each instance of R.sup.a is independently hydrogen or optionally substituted C.sub.1-6 alkyl and each instance of R.sup.b is independently hydrogen or optionally substituted C.sub.1-6 alkyl. In some embodiments, R.sub.1 is OR.sup.a, wherein R.sup.a is optionally substituted C.sub.1-6 alkyl. In certain embodiments, R.sub.1 is OCH.sub.3. In some embodiments, R.sub.2 is NH.sub.2. In certain embodiments, R.sub.3 is OH. In some embodiments, R.sub.4 is OH.
[0201] The compounds of Formula (I) described herein also include a moiety R.sub.5. R.sub.5 may be any natural or non-natural amino acid, or a derivative thereof. In certain embodiments, R.sub.5 is threonine. In certain embodiments, R.sub.5 is serine. In certain embodiments, R.sub.5 is isoleucine. In certain embodiments, R.sub.5 is methionine. In certain embodiments, R.sub.5 is valine.
[0202] In some embodiments, the compound of Formula (I) is of the formula:
##STR00034##
or a salt thereof. In certain embodiments, the compound of Formula (I) is not
##STR00035##
In certain embodiments, the compound of Formula (I) is not
##STR00036##
In certain embodiments, the compound of Formula (I) is not
##STR00037##
In certain embodiments, the compound of Formula (I) is not
##STR00038##
In certain embodiments, the compound of Formula (I) is not
##STR00039##
In certain embodiments, the compound of Formula (I) is not
##STR00040##
In certain embodiments, the compound of Formula (I) is not
##STR00041##
In certain embodiments, the compound of Formula (I) is not
##STR00042##
In certain embodiments, the compound of Formula (I) is not
##STR00043##
In certain embodiments, the compound of Formula (I) is not
##STR00044##
In some embodiments the compound produced by the methods of the present disclosure is of the formula:
##STR00045##
or a salt thereof.
[0203] In certain embodiments, the compound of Formula (I) is a compound delineated herein, including in any of the figures herein. In certain embodiments, the compound of Formula (I) is a compound of any of
[0204] In some embodiments, a compound of the present invention, or a salt thereof, is provided in a composition (e.g., in any of the forms disclosed herein). In some embodiments, the composition is for topical administration. In certain embodiments, the composition is formulated as a sunscreen. In certain embodiments, the composition is formulated as a cosmetic.
[0205] In one aspect, the present disclosure provides methods of administering the compounds of the present invention comprising applying any of the compositions disclosed herein to a subject. In some embodiments, the composition is applied on the skin of a subject. In certain embodiments, the composition is applied on the skin of a subject in need thereof as a method of preventing sunburn (e.g., when the composition is formulated as a sunscreen). In certain embodiments, the composition is applied on the skin of a subject in need thereof as a method of preventing cancer. In certain embodiments, the composition is applied on the skin of a subject in need thereof as a method of treating or preventing a chronic inflammatory disease.
EXAMPLES
[0206] Mycosporine-like amino acids (MAAs) are a family of natural, thermally and photochemically stable UV protectants (
[0207] Recently, several initial biosynthetic steps of MAAs have been elucidated through biochemical and genetic studies. Their biosynthesis starts from the production of 4-deoxygudasol (4-DG) from sedoheptulose 7-phosphate, an intermediate of the pentose phosphate pathway, by a dimethyl 4-degadusol synthase (DDGS; MysA) and an O-methyltransferase (O-MT; MysB) (
[0208] The heterologous production of serial MAA analogs, including palythines, in E. coli is described herein. Sequence similarity network (SSN) and genome neighborhood network (GNN) analyses of known MAA biosynthetic enzymes were used to identify a putative mysD-containing BGC in the genome of Nostoc linckia NIES-25 that is adjacent to a short-chain dehydrogenase/reductase (SDR) gene and a nonheme iron(II)- and 2-oxoglutarate-dependent (Fe/2OG) oxygenase gene MysH..sup.30 Heterologous expression of multiple refactored MAA BGCs in E. coli produced MAA analogs and demonstrated the direct conversion of disubstituted MAAs into palythines by the Fe/2OG enzyme MysH. Furthermore, biochemical characterization of its recombinant MysD supported its role in the formation of porphyra-334, shinorine, and other MAA analogs. Such enzymes are useful for the development of next-generation sunscreens via synthetic biology and biocatalysis approaches.
Example 1: Distribution of MAA BGCs in Microbial Genomes
[0209] Genome mining has become a powerful approach for the discovery of new natural products and enzymology,.sup.31 supported by the exponential growth of genomic sequence data. To probe the distribution of MAA BGCs, MysC (Ava_3856) from A. variabilis ATCC 29413 was first used as the query to mine its homologs in the UniRef50 database that includes all proteins with at least 50% sequence identity to and 80% overlap with the longest sequence in the family..sup.27,32 This analysis revealed that MysC belongs to the protein family #02655 (ATP_Grasp_3, PF02655) in the Pfam database,.sup.33 which includes 8,435 ATP grasp enzyme homologs (October 2020). Subsequent SSN analysis of this family identified 22 distinct clusters with a sequence identity of >35P (
TABLE-US-00006 TABLE 1 Accession numbers for MysC homologs shown in FIG. 2A. Uniprot ID Gene Name Species Phylum A0A0Q2QHP0 AO501_14480 Mycobacterium gordonae Actinobacteria A0A3S0TU06 EKK34_29475 Mycobacterium sp. Actinobacteria A0A5A7SAT3 FOY51_14930 Rhodococcus sp. C1-24 Actinobacteria A0A0G4HZ53 Cvel_9647 Chromera velia CCMP2878 Chromerida R1G4T9 EMIHUDRAFT_52960 Emiliania huxleyi Haptista A0A433W0B3 DSM107010_29350 Chroococcidiopsis cubana Cyanobacteria SAG 39.79 A0A139WZN8 WA1_05090 Scytonema hofmannii PCC Cyanobacteria 7110 A0A2Z5X784 mysC Nostoc verrucosum Cyanobacteria A0A1Z4GTP3 NIES2100_06370 Calothrix sp. NIES-2100 Cyanobacteria A0A1Q4RU46 NIES2101_15200 Calothrix sp. HK-06 Cyanobacteria A0A0C2R3C6 SD80_01670 Scytonema tolypothrichoides Cyanobacteria VB-61278 A0A2R5FKA4 NIES4072_28690 Nostoc commune NIES-4072 Cyanobacteria A0A0M0SH70 AMR41_24200 Hapalosiphon sp. MRB220 Cyanobacteria A0A2T1F866 C7B80_31420 Cyanosarcina cf. burmensis Cyanobacteria CCALA 770 A0A367QNV7 A6S26_15830 Nostoc sp. ATCC 43529 Cyanobacteria A0A2N6JWS5 CEN44_24325 Fischerella muscicola Cyanobacteria CCMEE 5323 B4VP63 MC7420_4633 Coleofasciculus Cyanobacteria chthonoplastes PCC 7420 K9QUQ5 Nos7524_3368 Nostoc sp. PCC 7524 Cyanobacteria A0A0S3U2V2 LEP3755_23100 Leptolyngbya sp. NIES-3755 Cyanobacteria K9TVZ3 Chro_0780 Chroococcidiopsis thermalis Cyanobacteria PCC 7203 A0A2N6MZD6 CEN39_11340 Fischerella thermalis Cyanobacteria CCMEE 5201 A0A218PXL8 NIES3585_03720 Nodularia sp. NIES-3585 Cyanobacteria A0A1Z4HW63 NIES2107_59490 Nostoc carneum NIES-2107 Cyanobacteria A0A1Z4LYV8 NIES267_58470 Calothrix parasitica NIES- Cyanobacteria 267 A0A654SJH1 apha_01438 Chrysosporum ovalisporum Cyanobacteria A0A2C6VZE1 VF13_24910 Nostoc linckia z16 Cyanobacteria A0A2T1EQS1 C7B70_02210 Chlorogloea sp. CCALA 695 Cyanobacteria A0A1E5QWM1 A5482_11085 Cyanobacterium sp. IPPAS Cyanobacteria B-1200 A0A2I8ACV8 CLI64_23890 Nostoc sp. CENA543 Cyanobacteria A0A2D3HK59 mylE Nostoc flagelliforme Cyanobacteria A0A367QJH7 A6V25_22315 Nostoc sp. ATCC 53789 Cyanobacteria A0A2S6VI18 B1A85_06375 Chroococcidiopsis sp. TS- Cyanobacteria 821 K9X913 Glo7428_0523 Gloeocapsa sp. PCC 7428 Cyanobacteria A0A1Y0RL91 BZZ01_16725 Nostocales cyanobacterium Cyanobacteria HT-58-2 A0A2P8QMI8 C7Y66_19855 Chroococcidiopsis sp. Cyanobacteria CCALA 051 A0A6B3P645 F6K60_05300 Okeania sp. SIO1F9 Cyanobacteria A0A6B3MZW3 F6J89_01825 Symploca sp. SIO1C4 Cyanobacteria A0A2K8WS68 AA637_12615 Cyanobacterium sp. HL-69 Cyanobacteria A0A4Q9JE38 B4U84_12935 Westiellopsis prolifica IICB1 Cyanobacteria Q3M6C5 Ava_3856 Anabaena variabilis ATCC Cyanobacteria 29413 A0A252E4S5 BV372_13530 Nostoc sp. T09 Cyanobacteria A0A367RKS4 A6770_15820 Nostoc minutum NIES-26 Cyanobacteria A0A1E2WNZ8 A4S05_34795 Nostoc sp. KVJ20 Cyanobacteria A0A1B2CWG9 UCFS15_00407 Heteroscytonema crispum Cyanobacteria UCFS15 A0A1U7HY56 NIES1031_04760 Chroogloeocystis siderophila Cyanobacteria 5.2 s.c.1 A0A1L9QXK4 BI308_00105 Roseofilum reptotaenium Cyanobacteria AO1-A A0A2L2NR98 NLP_2817 Nostoc sp. Lobaria Cyanobacteria pulmonaria (5183) cyanobiont A0A2H2XFD9 NIES4071_48500 Calothrix sp. NIES-4071 Cyanobacteria A0A533NZW2 EBE86_16905 Hormoscilla sp. GUM202 Cyanobacteria A0A367RVN3 A6769_04950 Nostoc punctiforme NIES- Cyanobacteria 2108 A0A1Z4TPY4 NIES4106_37630 Fischerella sp. NIES-4106 Cyanobacteria A0A6B3MAD2 F6K58_17255 Symploca sp. SIO2E9 Cyanobacteria A0A1Z4IH51 NIES2111_57410 Nostoc sp. NIES-2111 Cyanobacteria A0A1Z4IB36 NIES2111_35850 Nostoc sp. NIES-2111 Cyanobacteria K9VKW1 Osc7112_3784 Oscillatoria nigro-viridis Cyanobacteria PCC 7112 A0A2T1F5R3 C7B77_28500 Chamaesiphon polymorphus Cyanobacteria CCALA 037 K9W0D3 Cri9333_2377 Crinalium epipsammum PCC Cyanobacteria 9333 A0A1Z4SWP6 NIES4105_48440 Calothrix sp. NIES-4105 Cyanobacteria A0A1U7I932 FACHB389_18875 Nostoc calcicola FACHB- Cyanobacteria 389 A0A1W5CLX0 AN489_06955 Anabaena sp. 39858 Cyanobacteria A0A328IAQ4 C6Y22_26065 Hapalosiphonaceae Cyanobacteria cyanobacterium JJU2 A0A533NF66 EBE85_21135 Hormoscilla sp. GUM007 Cyanobacteria A0A479ZZ55 SR1949_29190 Sphaerospermopsis Cyanobacteria reniformis A0A357A498 DD761_02610 Cyanobacteria bacterium Cyanobacteria UBA11691 A0A1Z4QDW0 NIES4074_07940 Cylindrospermum sp. NIES- Cyanobacteria 4074 K9R4C7 Riv7116_0136 Rivularia sp. PCC 7116 Cyanobacteria A0A3S0ZZ73 PCC6912_44900 Chlorogloeopsis fritschii Cyanobacteria PCC 6912 A0A3C0NJT8 DCP31_40620 Cyanobacteria bacterium Cyanobacteria UBA8543 B2J6X7 Npun_R5598 Nostoc punctiforme PCC Cyanobacteria 73102 A0A0C1NCV3 DA73_0218765 Tolypothrix bouteillei Cyanobacteria VB521301 A0A1Z4S904 NIES4103_38540 Nostoc sp. NIES-4103 Cyanobacteria A0A2K8SZ63 COO91_06032 Nostoc flagelliforme Cyanobacteria CCNUN1 A0A3N6PGG7 D5R40_05450 Okeania hirsuta Cyanobacteria A0A0C2QMV0 SD80_01695 Scytonema tolypothrichoides Cyanobacteria VB-61278 Q3M6C5 Ava_3856 Trichormus variabilis strain Cyanobacteria ATCC 29413 A0A1Z4ND62 NIES3974_02980 Calothrix sp. NIES-3974 Cyanobacteria A0A0D8ZR72 UH38_14315 Aliterella atlantica Cyanobacteria CENA595 A0A2T1LWM6 C7H19_13915 Aphanothece hegewaldii Cyanobacteria CCALA 016 K9XU47 Sta7437_1637 Stanieria cyanosphaera PCC Cyanobacteria 7437 A0A2Z6D2K3 NIES2109_59170 Nostoc sp. HK-01 Cyanobacteria A0A5P8W9G9 GXM_06696 Nostoc sphaeroides Cyanobacteria CCNUC1 A0A1S6LXZ0 mylE Nostoc commune var. Cyanobacteria flagelliforme QSY 1 A0A1Z4LFB5 NIES25_64150 Nostoc linckia NIES-25 Cyanobacteria A0A4D9CF37 BLD44_013555 Mastigocladus laminosus Cyanobacteria UU774 A0A1B2CWF7 mysC Heteroscytonema crispum Cyanobacteria UCFS10 A0A0C1N3Z4 DA73_0239150 Tolypothrix bouteillei Cyanobacteria VB521301 A0A2L2N6B5 NPM_2790 Nostoc sp. Peltigera Cyanobacteria membranacea cyanobiont N6 A0A1Z4Q915 NIES4073_76020 Scytonema sp. NIES-4073 Cyanobacteria A0A2Z5VN68 mysC Nostoc commune KU002 Cyanobacteria A0A1Z4UKN2 NIES73_09950 Sphaerospermopsis Cyanobacteria kisseleviana NIES-73 A0A5Q0GJK5 EH233_17470 Anabaena sp. YBS01 Cyanobacteria A0ZIV3 NSP_23010 Nodularia spumigena Cyanobacteria CCY9414 A0A3S1ANM2 DSM106972_036000 Calothrix desertica PCC Cyanobacteria 7102
[0210] Next, GNN analysis of the MysC cluster was performed to identify enzymes with high co-occurrence frequency within ten open reading frames upstream or downstream of MysC (
Example 2: Heterologous Expression of Refactored MAA BGCs from Nostoc linkia NIES-25 in E. coli
[0211] Based on the results of the above bioinformatics studies, new MAA biosynthetic enzymes were characterized. Specifically, a putative 9.6-kb MAA BGC was selected from a 1.78-Mb plasmid (GenBank: AP018223.1) in Nostoc linkia NIES-25, which encodes MysA-D (NIES25_64130 to NIES25_64160), a phytanoyl-CoA dioxygenase (MysH, NIES25_64110), an MFS transporter (NIES25_64120), and a SDR (NIES25_64170) (
TABLE-US-00007 TABLE 2 Bioinformatic analysis of MAA gene cluster from Nostoc linkia NIES-25. Protein Gene name accession Size.sup.1 Homolog, origin ID/SI.sup.2 Predicted function NIES25_64110 BAY79923.1 267 WP_190955827.1, 98/99 Phytanoyl-CoA Nostoc dioxygenase NIES25_64120 BAY79924.1 485 WP_190955828.1, 94/97 Major facilitator Nostoc transporter NIES25_64130 BAY79925.1 410 RCJ25793.1, 98/99 Sedoheptulose 7- Nostoc sp. phosphate cyclase ATCC 43529 NIES25_64140 BAY79926.1 278 WP_190955830.1, 95/97 Class I SAM- Nostoc dependent methyltransferase NIES25_64150 BAY79927.1 464 WP_190955831.1, 97/98 ATP-grasp ligase Nostoc NIES25_64160 BAY79928.1 368 WP_190955832.1, 93/96 D-alanine-D-alanine Nostoc ligase NIES25_64170 BAY79929.1 257 RCJ25797.1, 98/98 short-chain Nostoc sp. dehydrogenase/ ATCC 43529 reductase Note: .sup.1amino acid; .sup.2identities/similarities (%).
[0212] To further characterize MAA biosynthesis in N. linkia NIES-25, multiple refactored BGCs were designed for heterologous expression in E. coli BL21-Gold (DE3) (
[0213] The successful production of disubstituted MAAs by expressing mysA-D from N. linkia NIES-25 in E. coli prompted characterization of the functions of two other biosynthetic genes in the cluster. Co-expression of sdr on pACYCDuet-1 (
TABLE-US-00008 TABLE 3 Comparison of .sup.1H and .sup.13C NMR chemical shifts of palythine-Thr determined in the current work and a recent report..sup.50
[0214] Current known palythines include palythine, palythine-Ser, palythine-Thr and their derivatives produced by corals, cyanobacteria, and other organisms (
Example 3: Biochemical Characterization of Recombinant MysD
[0215] The current and previous heterologous expression studies supported the function of MysD in the biosynthesis of disubstituted MAAs (
[0216] Recent advances in bioinformatics and synthetic biology tools have unleashed the potential of all organisms for the discovery of new natural products and new enzymology for a variety of applications..sup.47 In the search for new MAA analogs, a group of Fe(II)/2OG enzymes that are frequently co-occurred with the known MAA biosynthetic enzymes was identified. Refactoring such an MAA BGC from N. linkia NIES-25 for the heterologous expression in E. coli interrogated the catalytic functions of MysA, MysB, MysC, MysD, MysH, and one SDR for the biosynthesis of MAA analogs. The direct conversion of disubstituted MAAs into corresponding palythines by MysH filled a critical gap in the biosynthetic understanding of many MAA analogs produced by a variety of prokaryotic and eukaryotic organisms. Furthermore, this work provided the first biochemical insights into the substrate preference of MysD.
Experimental Procedures
[0217] General Experimental Procedures. Molecular biology reagents and chemicals were purchased from Thermo Scientific, NEB, Fisher Scientific or Sigma-Aldrich. GeneJET Plasmid Miniprep Kit and GeneJETGel Extraction Kit (Thermo Scientific) were used for plasmid preparation and DNA purification, respectively. E. coli DH5 (Agilent) was used for routine cloning studies and E. coli BL21-gold(DE3) (Agilent) was used for protein expression and heterologous production. The cyanobacterial strain Nostoc linkia NIES-25 was obtained from National Institute for Environmental Studies, Japan. DNA sequencing was performed with GENEWIZ or Eurofins. A Shimadzu Prominence UHPLC system (Kyoto, Japan) coupled with a PDA detector was used for HPLC analysis. NMR spectra were recorded in D.sub.2O on a Bruker 600 MHz spectrometer located in the AMRIS facility at the University of Florida, Gainesville, FL, USA. Spectroscopy data were collected using Topspin 3.5 software. HRMS data were generated on a Thermo Fisher Q Exactive Focus mass spectrometer equipped with an electrospray probe on Universal Ion Max API source.
[0218] Bioinformatics Analysis. The SSN of ATP-grasp ligases (ATP_Grasp_3, PF02655) was generated by EFI-Enzyme Similarity Tool (efi.igb.illinois.edu) with 35% cut-off threshold..sup.30 The identified MysC containing cluster (585 homologs) was further re-analyzed with 45% cut-off threshold. The resultant MysC-containing cluster was submitted for GNN analysis (efi.igb.illinois.edu) with a neighborhood size set at 10 and a co-occurrence lower limit set at 10%. All the SSNs and GNN were visualized in Cytoscape..sup.48 The amino acid sequences of mined MysH homologs were aligned by ClustalW algorithm..sup.49
[0219] Construction of Refactored BGCs. The MAA biosynthetic genes were amplified from isolated genomic DNA of Nostoc linkia NIES-25. The mysAB together were amplified and cloned into pETDuet-1 NcoI/PstI sites to give pETDuet-1-mysAB. The mysC or mysCD were then cloned into the KpnI/XhoI site of pETDuet-1-mysAB to give pETDuet-1-mysABC and pETDuet-1-mysABCD. The sdr was cloned into the NdeI/XhoI site of pACYCDuet-1, and the mysH was cloned into the NcoI/PstI site of pACYCDuet-1 or pACYCDuet-1-sdr. The mysC was then cloned into the KpnI/XhoI site of pACYCDuet-1 or pACYCDuet-1-mysH. All oligonucleotide primers (Table 4) used were ordered from Sigma-Aldrich. The resultant constructs were transformed or co-transformed into E. coli BL21-gold(DE3). After appropriate antibiotics selection, positive clones were used for fermentation.
TABLE-US-00009 TABLE4 PrimersusedtoconstructrefactoredBGCsandexpressMysD. Primer Sequence(5-3) MysA-NcoI-F CATGCCATGGTGAGCATTGTTCAAACAA(SEQIDNO:117) MysB-PstI-R CATGCTGCAGTCACGCAGTTCTGCGGATA(SEQIDNO:118) MysC-KpnI-F CGTCGGTACCATGGCACAATCTATTTCCG(SEQIDNO:119) MysC-XhoI-R CAGACTCGAGCTAATCCCCACCCAATTCCA(SEQIDNO:120) MysD-NdeI-F CATGCATATGCCAGTACTTCGTATC(SEQIDNO:121) MysD-XhoI-R CATGCTCGAGCTAAATCATTTGTGAAAGCT(SEQIDNO:122) MysH-NcoI-F TAATAAGGAGATATACCATGGTGAAGGTAGACACACA(SEQ IDNO:123) MysH-PstI-R GCAAGCTTGTCGACCTGCAGTCGATGTACTTGAACTCTAG (SEQIDNO:124) SDR-NdeI-F TAAGAAGGAGATATACATATGGCTTCTCTAGAAAATCA (SEQIDNO:125) SDR-XhoI-R GTTTCTTTACCAGACTCGAGCTAAGTGCGCCGATTAACTA (SEQIDNO:126)
[0220] Fermentation, Extraction, and Isolation. To characterize MAA production in its native producer, Nostoc linkia NIES-25 was cultured in 300 mL BG-11 medium (Sigma-Aldrich) at 26 C. The culture was air bubbled and received a lighting cycle of 16 h/8 h (light/dark) with the illumination of 2000-2500 lux. After 21 days, the cells were pelleted down by centrifugation (4500 rpm, 15 min). The cyanobacterial cell pellet was lysed by sonication in ice-cold methanol (10 s pulse and 20 s rest, 2 min pulse in total). After centrifugation (4500 rpm, 30 min), the clear supernatants of lysates were collected and evaporated under reduced pressure. The dried extracts were resuspended in water (1 mL) for HPLC and LC-HRMS analysis. Following the same procedure, the expensed culture medium was lyophilized and re-dissolved in water (1 mL) for HPLC and LC-MS analysis.
[0221] To characterize the heterologous expression of the MAA BGC from Nostoc linkia NIES-25, E. coli strains carrying refactored gene clusters were cultured in 250 mL in Luria-Bertani broth supplemented with 50 g/mL ampicillin and/or chloramphenicol (37 C., 225 rpm).
[0222] When the cell culture OD.sub.600 reached 0.5, IPTG (final concentration 0.1 mM) was added to the culture to induce gene expression (18 C., 180 rpm, 20 h). The cells were harvested by centrifugation (4500 rpm, 10 min), and collected cell pellets were extracted twice by 1 mL methanol. The methanolic extracts were dried in the speed vacuum concentrator and resuspended in water (300 L) for HPLC and LC-MS analysis.
[0223] For the large-scale production of palythine-Thr, E. coli expressing mysAB2CDH was cultured in 81 L Luria-Bertani broth using the same expression conditions as described above. After expression, the cells were harvested by centrifugation (6000 rpm, 20 min), and lysed by sonication in 230 mL ice-cold methanol (10 s pulse and 20 s rest, 8 min pulse in total). The cell lysates were centrifuged (4500 rpm, 10 min) and the clear supernatants were evaporated under reduced pressure. The dried methanolic extracts were resuspended in 1 mL water and were first purified on an Agilent Zorbax SB-C18 column (9.4250 mm, 5 m) using 0.1% formic acid in water and 2% methanol as mobile phases. Corresponding fractions were collected (maximal absorption at 320 nm), combined, evaporated to remove organic solvents, and then lyophilized. The residues were resuspended in water (200 L) and further purified on a Phenomenex Luna C8 column (4.6250 mm, 5 m) using the same mobile phases above. Palythine-Thr fractions were collected, combined, evaporated to remove organic solvents, and lyophilized. About 1 mg of palythine-Thr was purified for NMR analysis.
[0224] Palythine-Thr: white solid; .sup.1H NMR (600 MHz, D.sub.2O) 4.32 (m, 1H), 4.08 (d, J=4.6 Hz, 1H), 3.69 (s, 3H), 3.58 (s, 2H), 2.97 (d, J=17.1 Hz, 1H), 2.93 (d, J=17.5 Hz, 1H), 2.77 (dd, J=17.5, 1.3 Hz, 1H), 2.71 (dd, J=17.1, 1.4 Hz, 1H), 1.26 (d, J=6.5 Hz, 3H); .sup.13C NMR (151 MHz, D.sub.2O) 177.90, 163.8, 163.8, 127.7, 74.2, 70.9, 70.2, 67.4, 62.0, 38.6, 36.6, 22.2.
[0225] MysD Expression and Purification. The mysD gene was amplified from the isolated genomic DNA of Nostoc linkia NIES-25 and inserted into the NdeI/XhoI sites of pET28b, and the resultant construct pET28b-mysD was transformed into E. coli BL21-gold(DE3) for the expression of recombinant N-His.sub.6-tagged MysD. Protein expression was carried out in 500 mL Luria-Bertani broth supplemented with 50 g/mL kanamycin (37 C., 225 rpm).
[0226] When the cell culture OD.sub.600 reached 0.5, IPTG (final concentration 0.1 mM) was added to the culture to induce gene expression (18 C., 180 rpm, 20 h). The cells were harvested by centrifugation (6000 rpm, 20 min), and collected cell pellets were resuspended in the lysis buffer (25 mM Tris-Cl, pH 8.0, 100 mM NaCl, 1 mM -mercaptoethanol and 10 mM imidazole) and lysed by sonication on ice (10 s pulse and 20 s rest, 1 min in total).
[0227] Following centrifugation (15000 rpm, 4 C., 30 min), recombinant MysD was purified by the HisTrap Ni-NTA affinity column (GE Healthcare). N-His.sub.6-tagged MysD was eluted using a 0-100% B gradient in 15 min at the flow rate of 2 mL/min, using A buffer (25 mM Tris-Cl, pH 8.0, 250 mM NaCl, 1 mM -mercaptoethanol and 30 mM imidazole) and B buffer (25 mM Tris-Cl, pH 8.0, 250 mM NaCl, 1 mM -mercaptoethanol and 300 mM imidazole). Fractions with recombinant MysD were collected, concentrated, and buffer-exchanged into storage buffer (50 mM Tris-Cl, pH 8.0, 10% glycerol). The purity of the recombinant protein was analyzed on SDS-PAGE and the concentration was determined by NanoDrop.
[0228] MysD Reaction. MG was purified from extracts of E. coli expressing MysAB2C by HPLC and used as the substrate for the MysD reactions. The quality of MG was calculated based on its reported extinction coefficient (28,100 M.sup.1cm.sup.1). The initial MysD reactions included MG (50 M),
[0229] HPLC and LC-MS Analysis. Samples were analyzed on a Shimadzu Prominence UHPLC system (Kyoto, Japan) coupled with a PDA detector. The compounds were separated on a Phenomenex Luna C8 column (4.6250 mm, 5 m) using the following HPLC program: 2% B for 15 min, 2-90% B gradient in 2 min, 90% B for 2 min, 90-2% in 2 min, and re-equilibration in 2% B for 6 min. The A phase was 0.1 M triethylammonium acetate pH 7.0 and the B phase was methanol. The flow rate was set at 0.5 mL/min. In the quantitative analysis of relative activity of MysD with different amino acid substrates, water containing 0.1% formic acid was used as phase A to fully separate MG with MG-Ala. LC-HRMS and HRMS/MS experiments were conducted on Thermo Scientific Q Exactive Focus mass spectrometer with Dionex Ultimate RSLC 3000 uHPLC system, equipped with H-ESI II probe on Ion Max API Source. Methanol (B)/Water (A) containing 0.1% formic acid were used as mobile phases, and the same LC program was used as in the HPLC analysis. The eluents from the first 3 min were diverted to waste by a diverting valve. MS1 signals were acquired under the Full MS positive ion mode covering a mass range of m/z 150-2000, with resolution at 35,000 and AGC target at 1e6. Fragmentation was obtained with the Parallel Reaction Monitoring (PRM) mode using an inclusion list of calculated parental ions. The AGC target was set at 5e4 for MS2. Precursor ions were selected in the quadrapole typically with an isolation width of 3.0 m/z and fragmented in the HCD cell at a collision energy (CE) of 30. For some ions, the isolation width was 2.0 m/z and step-wise CE of 15, 20, and 25 were used.
Example 4: MysD Accepts Additional Substrates L-Ile, L-Met, and L-Val to Produce New MAA Analogs
[0230] Previously, different bioinformatic approaches were taken to assess the distribution of the MAA biosynthesis, and a putative gene cluster was identified from Nostoc linckia NIES-25 that encodes a short-chain dehydrogenase/reductase (SDR) and a nonheme iron(II)- and 2-oxoglutarate-dependent oxygenase (MysH) as potential new biosynthetic enzymes. Heterologous expression of refactored gene clusters in E. coli produced two known biosynthetic intermediates, 4-deoxygadusol (4-DG) and mycosporine-glycine (MG), and three disubstituted MAA analogs, porphyra-334, shinorine, and mycosporine-glycine-alanine. Importantly, the disubstituted MAAs were converted into palythines by MysH in E. coli. Furthermore, biochemical characterization revealed the substrate preference of recombinant MysD, an ATP-grasp ligase, in the formation of disubstituted MAAs. This study advances the biosynthetic understanding of an important family of natural UV photoprotectants and opens new opportunities to the development of next-generation sunscreens.
[0231] The use of two ATP-grasp ligases MysC and MysD and MysH has now been further expanded to generate a library of mono- and di-substituted MAA analogs and palythines. In addition, a glycosyltransferase was identified that could contribute to the synthesis of glycosylated MAA analogs.
[0232] Previously, it was demonstrated that the recombinant MysD of Nostoc linckia NIES-25 accepts six natural amino acids (l-Thr, l-Ser, l-Cys, l-Ala, l-Arg, and l-Gly) as its substrates to synthesize MAA analogs. It was recently found that three other natural amino acids are also utilized in the MysD reaction, including l-Ile, l-Met, and l-Val (
Example 5: MysH Cleaves the Glycine Side Chain of MG In Vivo
[0233] It was previously reported that MysH from Nostoc linckia NIES-25 converts disubstituted MAAs into palythine-Thr, palythine-Ser, and palythine-Ala when expressed in E. coli, indicating the substrate flexibility of MysH. MysH was coexpressed with MysA, MysB, and MysC, all from Nostoc linckia NIES-25 in E. coli. MysA, MysB, and MysC together produce MG. Interestingly, in addition to the reduced amount of MG, a novel metabolite with a retention time of 7.05 min was observed (
Example 6: Biochemical Characterization of MysH
[0234] To further characterize the catalytic properties of MysH, the recombinant MysH of Nostoc linckia NIES-25 was prepared with a C-terminal His.sub.6-tag in E. coli after a single Ni-NTA affinity purification (
[0235] The optimal MysH reaction conditions were determined to be 50 mM HEPES, pH 7.5, 0.5 uM MysH, 1 mM -KG, 1 mM ascorbate, 10 uM Fe(NH.sub.4).sub.2(SO.sub.4).sub.2, and 8 g/mL catalase. Steady-state kinetic studies were performed with 20 to 1000 uM porphyra-334, and the reactions were carried out at room temperature for 30 min. The reactions followed Michaelis-Menten kinetics (
Example 7: One-Pot Reaction with MysD and MysH Produce 12 Palythines
[0236] Given the notable substrate flexibility of MysD and MysH, their one-pot reactions to produce palythines were examined next. The optimal conditions were first determined. Temperatures ranging from 20 to 37 C. showed a minimal effect on the reaction turnover. The optimal pH was determined to be 8.0, while the optimal molar ratio of MysD to MysH was determined to be 1:3. The following conditions were then used for the MysD and MysH coupled reaction: 50 mM HEPES, pH 8.0, 10 mM MgCl.sub.2, 40 uM MG, 5 mM amino acid, 5 mM ATP, 0.5 uM MysD, 1.5 uM MysH, 1 mM 20G, 1 mM ascorbate, 10 uM Fe(NH.sub.4).sub.2(SO.sub.4).sub.2, and 8 g/mL catalase. All twenty natural amino acids were screened in the overnight reaction at room temperature. In the one-pot reaction, MysD still accepted l-Thr, l-Ser, l-Cys, l-Ala, l-Arg, and l-Gly as its substrates, and MysH then converted the disubstituted MAA analogs into corresponding palythines (
Example 8: MysC Accepts L-Ala as its Substrate
[0237] Natural MAAs are dominant with a C3-glycine, but some analogs carry a different C3 moiety, including alanine, serine, glutamic acid, glutamicol, lysine, ornithine, GABA, etc. (doi: 10.3390/antiox4030603; doi: 10.1128/AEM.01632-16; doi: 10.3390/md17060356). To further characterize the catalytic properties of MysC from Nostoc linckia NIES-25, its recombinant protein was prepared with an N-terminal His.sub.6-tag from E. coli after a single Ni-NTA affinity purification (
Example 9: Ancestral Construction of MysC
[0238] Compared with MysD, the substrate scope of MysC is more stringent. As the ancestral MysC homologs may possess a broader substrate scope, the ancestral sequences of MysC homologs using the webserver FireProt.sup.ASR (doi: 10.1093/bib/bbaa337). Four computed ancestor MysC homologs (Table 5) were synthesized and heterologously expressed in E. coli. They can be used to synthesize new MAA analogs.
TABLE-US-00010 TABLE5 SequencesofMysCancestors MysChomolog Sequence MysC-158 MSLSAPPSRSKIRSTLKTLGTLVLLLLALPLNAAIVLV (computedancestor) ALLRNLITRPRKRATAANPKTVLISGGKMTKALQLAR SFHRAGHRVILVETHKYWLTGHRFSNAVDRFYTVPA PQDDPEGYAQALLDIVQKENVDVYVPVCSPVASYYD ALAKETLSPHCEVFHFDADTVKMLDDKYQFAEMAR SLGLSVPESHRITSPEQVLDFDFSQSEGRKYILKSIAYD SVRRLDLTKLPCPTPEETAAFVRSLPISPDNPWIMQEFI EGQEYCTHSTVRDGRLRLHCCCESSAFQVNYEHVDN PEIQEWVQRFVKALNLTGQVSFDFIQTDDDGRVYAIE CNPRTHSAITMFYNHPGVAEAYLDPDPDLAEPIQPLP SSRPTYWLYHELWRLLTHPRSLQDLRERLKTIFRGKD AIFDWDDPLPFLMVHHWQIPLLLLKNLRQGKDWVRI DFNIGKLVELGGD(SEQIDNO:113) MysC-175 MVVAENPKNILITGGKMTKALQLARSFHAAGHRVFL (computedancestor) VETHKYWLSGHRFSNAVDRFYTVPAPQKDPEGYVQ GLLDIVKQENIDVFIPVSSPVASYYDSLAKPVLSPYCE VFHFDAEITKMLDNKFTFSEKARSLGLSAPKSFLITDP EQVLNFDFAADQGSQYILKSIPYDSVHRLDMTKLPCD KEEMAEYVKSLPISEENPWIMQEFITGQEYCTHSTVR DGKIRLHCCSKYPTLFTASSAFQVNYEHVDNPAILQW VTRFVKELNLTGQISFDFIQAEDDGTVYPIECNPRTHS AITMFYNHLPGVVADAYLKDSPDEEEPIQPLPDSKPT YWLYHELWRLTEIRSWSQLQAWINNILKGTDAIFQV NDPLPFLMVHHWQIPLLLLNNLRKLKGWVRIDFNIG KLVELGGD(SEQIDNO:114) MysC-225 MVVAENPKNILITGGKMTKALQLARSFHAAGHRVFL (computedancestor) VETHKYWLSGHRFSNAVDRFYTVPAPQKDPEGYIQA LLDIVKQENIDVFVPVSSPVASYYDSLAKPVLSPYCE VFHFDADITKMLDDKFTFSEKARSLGLSAPKSFLITDP EQVLNFDFASDQGSQYILKSIPYDSVHRLDMTKLPCD SKEEMAAYVKSLPISEENPWIMQEFITGQEYCTHSTV RDGKIRLHCCSKYPTLFTASSAFQVNYEHVDNPKILQ WVTRFVKELNLTGQISFDFIEAEDDGTVYAIECNPRT HSAITMFYNHLPGVVADAYLGKSPSAEEPIQPLPDSK PTYWLYHEVWRLTEIRSWSQLQTWINNILRGKDAIFQ VNDPLPFLMVHHWQIPLLLLNNLRKLKGWVRIDFNI GKLVELGGD(SEQIDNO:115) MysC-230 MVVAENPKNILLTGGKMTKALQLARSFHAAGHRVIL (computedancestor) VETHKYWLSGHRFSNAVDRFYTVPAPQKDPEGYTQ ALLAIAKQENIDVYVPVCSPVASYYDSLAKPVLSGCC EVFHFDADVTKMLDDKFAFSEKARSLGLSVPKSFLIT DPEQVLNFDFSNEQKRKYILKSIPYDSVHRLDMTKLP CDSKEEMAAYVKSLPISEENPWIMQEFIPGKEYCTHS TVRNGELRLHCCCEYPTLFTASSAFQVNYENVDNPKI LQWVSHFVKELKLTGQISFDFIEAEDDGTVYAIECNP RTHSAITMFYNHLPGVVADAYLGKEPLEEPLQPLPDS KPTYWLYHEVWRLTEIRSFSQLQTWIKNILRGKDAIF SVNDPLPFLMVHHWQIPLLLLNNLRRLKGWIRIDFNI GKLVELGGD(SEQIDNO:116)
Example 10: Co-Expression of a Glycosyltransferase with MysABCD
[0239] In the previous studies, the frequent occurrence of glycosyltransferase (GlyT) genes in the MAA BGCs was observed (1000 co-occurrence frequency). Many glycosylated MAA analogs have been reported, but the corresponding GlyTs remain uncharacterized. Here, the GlyT gene from Aphanothece hegewaldii CCALA 016 (Genbank accession: WP_106457502.1) was synthesized and cloned into the expression vector pET28a. The glyT gene sits in the same operon as mysH in Aphanothece hegewaldii MAA BGC (
Methods
[0240] General experimental procedures. Molecular biology reagents and chemicals were purchased from Thermo Scientific, NEB, Fisher Scientific or Sigma-Aldrich. GeneJET Plasmid Miniprep Kit and GeneJETGel Extraction Kit (Thermo Scientific) were used for plasmid preparation and DNA purification, respectively. E. coli DH5 (Agilent) was used for routine cloning studies and E. coli BL21-gold(DE3) (Agilent) was used for protein expression and heterologous production. DNA sequencing was performed with GENEWIZ or Eurofins. A Shimadzu Prominence UHPLC system (Kyoto, Japan) coupled with a PDA detector was used for HPLC analysis. HRMS data were generated on a Thermo Fisher Q Exactive Focus mass spectrometer equipped with an electrospray probe on Universal Ion Max API source.
[0241] Protein expression and purification. The mysD and mysC gene were amplified from the isolated genomic DNA of Nostoc linckia NIES-25 and inserted into the NdeI/XhoI sites of pET28b, and the resultant constructs pET28b-mysD or pET28b-mysC were transformed into E. coli BL21-gold(DE3) for the expression of the recombinant protein. The mysC ancestor genes were codon optimized and synthesized with Twist Bioscience for expression in E. coli. The genes were inserted into NdeI/XhoI sites of pET28a, and the resultant construct pET28a-mysC was transformed into E. coli BL21-gold(DE3) for the expression of a recombinant protein. The mysH gene was amplified from the isolated genomic DNA of Nostoc linckia NIES-25 and inserted into the NcoI/XhoI sites of pET28b, and the resultant construct pET28b-mysH was transformed into E. coli BL21-gold(DE3) for the expression of the recombinant protein with a C-His.sub.6 tag.
[0242] Protein expression was carried out in 500 mL Luria-Bertani broth supplemented with 50 g/mL kanamycin (37 C., 225 rpm). When the cell culture OD.sub.600 reached 0.5, IPTG (final concentration 0.1 mM) was added to the culture to induce protein expression (18 C., 180 rpm, 20 h). The cells were harvested by centrifugation (6000 rpm, 20 min), and collected cell pellets were resuspended in the lysis buffer (25 mM Tris-Cl, pH 8.0, 100 mM NaCl, 1 mM -mercaptoethanol and 10 mM imidazole) and lysed by sonication on ice (10 s pulse and 20 s rest, 1 min in total). Following centrifugation (15000 rpm, 4 C., 30 min), recombinant N-His.sub.6-tagged MysD, N-His.sub.6-tagged MysC or C-His.sub.6-tagged MysH were purified by the HisTrap Ni-NTA affinity column (GE Healthcare). Recombinant proteins were eluted using a 0-100% B gradient in 15 min at the flow rate of 2 mL/min, using A buffer (25 mM Tris-Cl, pH 8.0, 250 mM NaCl, 1 mM -mercaptoethanol and 30 mM imidazole) and B buffer (25 mM Tris-Cl, pH 8.0, 250 mM NaCl, 1 mM -mercaptoethanol and 300 mM imidazole). Fractions with recombinant proteins were collected, concentrated, and buffer-exchanged into storage buffer (50 mM Tris-Cl, pH 8.0, 10% glycerol). The purity of the recombinant proteins was analyzed on SDS-PAGE, and the concentration was determined by NanoDrop.
[0243] In vitro enzymatic reactions. 4-DG, MG, and porphyra-334 were purified from extracts of E. coli expressing MysAB, MysAB2C or MysAB2CD by HPLC and used as the substrate for the enzymatic reactions. The quality of MG was calculated based on its extinction coefficient (28,100 M.sup.1cm.sup.1). The detailed reaction condition are discussed above. All reactions were quenched by heat inactivation at 95 C. for 10 min. After centrifugation at 20,000g for 15 min, the clear supernatants were collected for LC-HRMS analysis.
[0244] HPLC and LC-HRMS analysis. Samples were analyzed on a Shimadzu Prominence UHPLC system (Kyoto, Japan) coupled with a PDA detector. Unless stated elsewhere, the following HPLC procedure was performed. The compounds were separated on a Phenomenex Luna C8 column (4.6250 mm, 5 m) using the following HPLC program: 2% B for 15 min, 2-90% B gradient in 2 min, 90% B in 2 min, 90-2% in 2 min, and re-equilibration in 2% B for 6 min. The A phase was water with 0.1 M triethylamine acetate (TEAA) at pH 7 and the B phase was methanol. The flow rate was set at 0.5 mL/min. LC-HRMS and HRMS/MS experiments were conducted on a Thermo Scientific Q Exactive Focus mass spectrometer with a Dionex Ultimate RSLC 3000 uHPLC system, equipped with the H-ESI II probe on an Ion Max API Source. Methanol (B)/water (A) containing 0.1% formic acid were used as mobile phases. The eluents from the first 3 min were diverted to waste by a diverting valve. MS1 signals were acquired under the Full MS positive ion mode, covering a mass range of m/z 150-2000, with resolution at 35 000 and AGC target at 110.sup.6.
[0245] Bioinformatic analysis of MysC. Protein sequences from 595 cyanobacteria genomes were obtained by protein BLAST search against the NCBI non-redundant protein database (E-value<1e-5) using query sequences for Nostoc linckia NIES-25 MysC (accession: WP_096541779.1). After filtering sequence length to obtain proteins with 350-550 amino acids, 464 MysD homologs were retrieved. After removing redundant protein at 95% identity, 163 MysC homologs were aligned in Mega Align using the Clustalw, and the phylogenic tree was computed with 1000 bootstraps. The MysC homolog sequences were submitted for ancestral construction using Fireprot.sup.ASR (loschmidt.chemi.muni.cz/fireprotasr/).
REFERENCES
[0246] 1. Rogers, H. W.; Weinstock, M. A.; Feldman, S. R.; Coldiron, B. M., Incidence estimate of nonmelanoma skin cancer (keratinocyte carcinomas) in the U.S. population, 2012. JAMA Dermatol. 2015, 151 (10), 1081-1086. [0247] 2. Siegel, R. L.; Miller, K. D.; Fuchs, H. E.; Jemal, A., Cancer statistics, 2021. CA: Cancer J. Clin. 2021, 71 (1), 7-33. [0248] 3. Moan, J.; Grigalavicius, M.; Baturaite, Z.; Dahlback, A.; Juzeniene, A., The relationship between UV exposure and incidence of skin cancer. Photodermatol. Photoimmunol. Photomed. 2015, 31 (1), 26-35. [0249] 4. Armstrong, B. K.; Kricker, A., How much melanoma is caused by sun exposure. Melanoma Res. 1993, 3 (6), 395-401. [0250] 5. Holick, M. F., Biological effects of sunlight, ultraviolet radiation, visible light, infrared radiation and vitamin D for health. Anticancer Res. 2016, 36 (3), 1345-1356. [0251] 6. Ghiasvand, R.; Weiderpass, E.; Green, A. C.; Lund, E.; Veierod, M. B., Sunscreen use and subsequent melanoma risk: A population-based cohort study. J. Clin. Oncol. 2016, 34 (33), 3976-3983. [0252] 7. Latha, M. S.; Martis, J.; Shobha, V.; Sham Shinde, R.; Bangera, S.; Krishnankutty, B.; Bellary, S.; Varughese, S.; Rao, P.; Naveen Kumar, B. R., Sunscreening agents: a review. J. Clin. Aesthet. Dermatol. 2013, 6 (1), 16-26. [0253] 8. Krause, M.; Klit, A.; Jensen, M. B.; Soeborg, T.; Frederiksen, H.; Schlumpf, M.; Lichtensteiger, W.; Skakkebaek, N. E.; Drzewiecki, K. T., Sunscreens: are they beneficial for health? An overview of endocrine disrupting properties of UV-filters. Int. J Androl. 2012, 35 (3), 424-436. [0254] 9. Ruszkiewicz, J. A.; Pinkas, A.; Ferrer, B.; Peres, T. V.; Tsatsakis, A.; Aschner, M., Neurotoxic effect of active ingredients in sunscreen products, a contemporary review. Toxicol. Rep. 2017, 4, 245-259. [0255] 10. Matta, M. K.; Zusterzeel, R.; Pilli, N. R.; Patel, V.; Volpe, D. A.; Florian, J.; Oh, L.; Bashaw, E.; Zineh, I.; Sanabria, C.; Kemp, S.; Godfrey, A.; Adah, S.; Coelho, S.; Wang, J.; Furlong, L. A.; Ganley, C.; Michele, T.; Strauss, D. G., Effect of sunscreen application under maximal use conditions on plasma concentration of sunscreen active ingredients a randomized clinical trial. JAMA 2019, 321 (21), 2082-2091. [0256] 11. Schneider, S. L.; Lim, H. W., Review of environmental effects of oxybenzone and other sunscreen active ingredients. J. Am. Acad. Dermatol. 2019, 80 (1), 266-271. [0257] 12. Pandika, M., Looking to nature for new sunscreens. ACS Cent. Sci. 2018, 4 (7), 788-790. [0258] 13. Saewan, N.; Jimtaisong, A., Natural products as photoprotection. J. Cosmet. Dermatol. 2015, 14 (1), 47-63. [0259] 14. Kageyama, H.; Waditee-Sirisattha, R., Antioxidative, anti-inflammatory, and anti-aging properties of mycosporine-like amino acids: Molecular and cellular mechanisms in the protection of skin-aging. Mar. Drugs 2019, 17 (4), 222. doi: 10.3390/md17040222. [0260] 15. Losantos, R.; Funes-Ardoiz, I.; Aguilera, J.; Herrera-Ceballos, E.; Garcia-Iriepa, C.; Campos, P. J.; Sampedro, D., Rational design and synthesis of efficient sunscreens to boost the solar protection factor. Angew. Chem. Int. Ed. Engl. 2017, 56 (10), 2632-2635. [0261] 16. Carreto, J. I.; Carignan, M. O., Mycosporine-like amino acids: Relevant secondary metabolites. Chemical and ecological aspects. Mar. Drugs 2011, 9 (3), 387-446. [0262] 17. M. Bandaranayake, W., Mycosporines: are they nature's sunscreens? Nat. Prod. Rep. 1998, 15 (2), 159-172. [0263] 18. Sinha, R. P.; Singh, S. P.; Hader, D. P., Database on mycosporines and mycosporine-like amino acids (MAAs) in fungi, cyanobacteria, macroalgae, phytoplankton and animals. J. Photochem. Photobiol. B 2007, 89 (1), 29-35. [0264] 19. Kicklighter, C. E.; Kamio, M.; Nguyen, L.; Germann, M. W.; Derby, C. D., Mycosporine-like amino acids are multifunctional molecules in sea hares and their marine community. Proc Natl Acad Sci USA 2011, 108 (28), 11494-11499. [0265] 20. Nazifi, E.; Wada, N.; Yamaba, M.; Asano, T.; Nishiuchi, T.; Matsugo, S.; Sakamoto, T., Glycosylated porphyra-334 and palythine-threonine from the terrestrial cyanobacterium Nostoc commune. Mar. Drugs 2013, 11 (9), 3124-3154. [0266] 21. D'Agostino, P. M.; Javalkote, V. S.; Mazmouz, R.; Pickford, R.; Puranik, P. R.; Neilan, B. A., Comparative profiling and discovery of novel glycosylated mycosporine-like amino acids in two strains of the cyanobacterium Scytonema cf crispum. Appl. Environ. Microbiol. 2016, 82 (19), 5951-5959. [0267] 22. Akio, F.; Takeshi, M.; Isami, T.; Isao, S., The crystal and molecular structure of palythine trihydrate. Bull. Chem. Soc. Jpn. 1980, 53 (2), 319-323. [0268] 23. Daisuke, U.; Chuji, K.; Akio, W.; Yoshimasa, H., Crystal and molecule structure of palythiene possessing a novel 360 nm chromophore. Chem. Lett. 1980, 9 (6), 755-756. [0269] 24. Klisch, M.; Richter, P.; Puchta, R.; Hader, D.-P.; Bauer, W., The stereostructure of porphyra-334: An experimental and calculational NMR investigation. Evidence for an efficient proton sponge. Helv. Chim. Acta 2007, 90 (3), 488-511. [0270] 25. White, J. D.; Cammack, J. H.; Sakuma, K.; Rewcastle, G. W.; Widener, R. K., Transformations of quinic acid. Asymmetric synthesis and absolute configuration of mycosporin I and mycosporin-gly. J. Org. Chem. 1995, 60 (12), 3600-3611. [0271] 26. Yang, G.; Cozad, M. A.; Holland, D. A.; Zhang, Y.; Luesch, H.; Ding, Y., Photosynthetic production of sunscreen shinorine using an engineered cyanobacterium. ACS Synth. Biol. 2018, 7 (2), 664-671. [0272] 27. Balskus, E. P.; Walsh, C. T., The genetic and molecular basis for sunscreen biosynthesis in cyanobacteria. Science 2010, 329 (5999), 1653-1656. [0273] 28. Pope, M. A.; Spence, E.; Seralvo, V.; Gacesa, R.; Heidelberger, S.; Weston, A. J.; Dunlap, W. C.; Shick, J. M.; Long, P. F., O-Methyltransferase is shared between the pentose phosphate and shikimate pathways and is essential for mycosporine-like amino acid biosynthesis in Anabaena variabilis ATCC 29413. Chembiochem 2015, 16 (2), 320-327. [0274] 29. Gao, Q.; Garcia-Pichel, F., An ATP-grasp ligase involved in the last biosynthetic step of the iminomycosporine shinorine in Nostoc punctiforme ATCC 29133. J. Bacteriol. 2011, 193 (21), 5923-5928. [0275] 30. Zallot, R.; Oberg, N.; Gerlt, J. A., The EFI web resource for genomic enzymology tools: Leveraging protein, genome, and metagenome databases to discover novel enzymes and metabolic pathways. Biochemistry 2019, 58 (41), 4169-4182. [0276] 31. Challis, G. L., Genome mining for novel natural product discovery. J. Med. Chem. 2008, 51 (9), 2618-2628. [0277] 32. Suzek, B. E.; Wang, Y.; Huang, H.; McGarvey, P. B.; Wu, C. H.; UniProt, C., UniRef clusters: a comprehensive and scalable alternative for improving sequence similarity searches. Bioinformatics 2015, 31 (6), 926-932. [0278] 33. El-Gebali, S.; Mistry, J.; Bateman, A.; Eddy, S. R.; Luciani, A.; Potter, S. C.; Qureshi, M.; Richardson, L. J.; Salazar, G. A.; Smart, A.; Sonnhammer, E. L. L.; Hirsh, L.; Paladin, L.; Piovesan, D.; Tosatto, S. C. E.; Finn, R. D., The Pfam protein families database in 2019. Nucleic Acids Res. 2019, 47 (D1), D427-D432. [0279] 34. Franke, I.; Resch, A.; Dassler, T.; Maier, T.; Bock, A., YfiK from Escherichia coli promotes export of O-acetylserine and cysteine. J. Bacteriol. 2003, 185 (4), 1161-1166. [0280] 35. Miyamoto, K. T.; Komatsu, M.; Ikeda, H., Discovery of gene cluster for mycosporine-like amino acid biosynthesis from Actinomycetales microorganisms and production of a novel mycosporine-like amino acid by heterologous expression. Appl. Environ. Microbiol. 2014, 80 (16), 5028-5036. [0281] 36. Hu, C.; Voller, G.; Sussmuth, R.; Dittmann, E.; Kehr, J. C., Functional assessment of mycosporine-like amino acids in Microcystis aeruginosa strain PCC 7806. Environ. Microbiol. 2015, 17 (5), 1548-1559. [0282] 37. D'Agostino, P. M.; Woodhouse, J. N.; Liew, H. T.; Sehnal, L.; Pickford, R.; Wong, H. L.; Burns, B. P.; Neilan, B. A., Bioinformatic, phylogenetic and chemical analysis of the UV-absorbing compounds scytonemin and mycosporine-like amino acids from the microbial mat communities of Shark Bay, Australia. Environ. Microbiol. 2019, 21 (2), 702-715. [0283] 38. Hegg, E. L.; Que, L., Jr., The 2-His-1-carboxylate facial triadan emerging structural motif in mononuclear non-heme iron(II) enzymes. Eur. J. Biochem. 1997, 250 (3), 625-629. [0284] 39. Mihalik, S. J.; Morrell, J. C.; Kim, D.; Sacksteder, K. A.; Watkins, P. A.; Gould, S. J., Identification of PAHX, a Refsum disease gene. Nat. Genet. 1997, 17 (2), 185-189. [0285] 40. Islam, M. S.; Leissing, T. M.; Chowdhury, R.; Hopkinson, R. J.; Schofield, C. J., 2-Oxoglutarate-dependent oxygenases. Annu. Rev. Biochem. 2018, 87, 585-620. [0286] 41. Kavanagh, K. L.; Jornvall, H.; Persson, B.; Oppermann, U., Medium- and short-chain dehydrogenase/reductase gene and protein families: the SDR superfamily: functional and structural diversity within a family of metabolic and regulatory enzymes. Cell Mol. Life Sci. 2008, 65 (24), 3895-3906. [0287] 42. Carignan, M. O.; Cardozo, K. H.; Oliveira-Silva, D.; Colepicolo, P.; Carreto, J. I., Palythine-threonine, a major novel mycosporine-like amino acid (MAA) isolated from the hermatypic coral Pocillopora capitata. J. Photochem. Photobiol. B 2009, 94 (3), 191-200. [0288] 43. Orfanoudaki, M.; Hartmann, A.; Ngoc, H. N.; Gelbrich, T.; West, J.; Karsten, U.; Ganzera, M., Mycosporine-like amino acids, brominated and sulphated phenols: Suitable chemotaxonomic markers for the reassessment of classification of Bostrychia calliptera (Ceramiales, Rhodophyta). Phytochemistry 2020, 174, 112344. doi: 10.1016/j.phytochem.2020. [0289] 44. Geraldes, V.; Jacinavicius, F. R.; Genuario, D. B.; Pinto, E., Identification and distribution of mycosporine-like amino acids in Brazilian cyanobacteria using ultrahigh-performance liquid chromatography with diode array detection coupled to quadrupole time-of-flight mass spectrometry. Rapid Commun. Mass Spectrom. 2020, 34 Suppl 3, e8634. doi: 10.1002/rem.8634. [0290] 45. Pederick, J. L.; Thompson, A. P.; Bell, S. G.; Bruning, J. B., D-Alanine-D-alanine ligase as a model for the activation of ATP-grasp enzymes by monovalent cations. J. Biol. Chem. 2020, 295 (23), 7894-7904. [0291] 46. Lessard, I. A.; Healy, V. L.; Park, I. S.; Walsh, C. T., Determinants for differential effects on D-Ala-D-lactate vs D-Ala-D-Ala formation by the VanA ligase from vancomycin-resistant enterococci. Biochemistry 1999, 38 (42), 14006-14022. [0292] 47. Harvey, A. L.; Edrada-Ebel, R.; Quinn, R. J., The re-emergence of natural products for drug discovery in the genomics era. Nat. Rev. Drug Discov. 2015, 14 (2), 111-129. [0293] 48. Shannon, P.; Markiel, A.; Ozier, O.; Baliga, N. S.; Wang, J. T.; Ramage, D.; Amin, N.; Schwikowski, B.; Ideker, T., Cytoscape: a software environment for integrated models of biomolecular interaction networks. Genome Res 2003, 13 (11), 2498-2504. [0294] 49. Thompson, J. D.; Higgins, D. G.; Gibson, T. J., Clustal-WImproving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res. 1994, 22 (22), 4673-4680. [0295] 50. Orfanoudaki, M.; Hartmann, A.; Ngoc, H. N.; Gelbrich, T.; West, J.; Karsten, U.; Ganzera, M., Mycosporine-like amino acids, brominated and sulphated phenols: Suitable chemotaxonomic markers for the reassessment of classification of Bostrychia calliptera (Ceramiales, Rhodophyta). Phytochemistry 2020, 174, 112344.
INCORPORATION BY REFERENCE
[0296] The present application refers to various issued patent, published patent applications, scientific journal articles, and other publications, all of which are incorporated herein by reference. The details of one or more embodiments of the invention are set forth herein. Other features, objects, and advantages of the invention will be apparent from the Detailed Description, the Figures, the Examples, and the Claims.
EQUIVALENTS AND SCOPE
[0297] In the articles such as a, an, and the may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Embodiments or descriptions that include or between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
[0298] Furthermore, the disclosure encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claims that is dependent on the same base claim. Where elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements and/or features, certain embodiments of the disclosure or aspects of the disclosure consist, or consist essentially of, such elements and/or features. For purposes of simplicity, those embodiments have not been specifically set forth in haec verba herein. It is also noted that the terms comprising and containing are intended to be open and permits the inclusion of additional elements or steps. Where ranges are given, endpoints are included. Furthermore, unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or sub-range within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
[0299] This application refers to various issued patents, published patent applications, journal articles, and other publications, all of which are incorporated herein by reference. If there is a conflict between any of the incorporated references and the instant specification, the specification shall control. In addition, any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the embodiments. Because such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the invention can be excluded from any embodiment, for any reason, whether or not related to the existence of prior art.
[0300] Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation many equivalents to the specific embodiments described herein. The scope of the present embodiments described herein is not intended to be limited to the above Description, but rather is as set forth in the appended embodiments. Those of ordinary skill in the art will appreciate that various changes and modifications to this description may be made without departing from the spirit or scope of the present invention, as defined in the following claims.