GENE FOR TRYPSIN-LIKE SERINE PROTEASE, A PROTEIN ENCODED THEREBY AND USE THEREOF
20220313797 · 2022-10-06
Assignee
Inventors
- Haiying LIANG (Zhanjiang, CN)
- Junjun HE (Zhanjiang, CN)
- Chenghao SHEN (Zhanjiang, CN)
- Xiaochen FANG (Zhanjiang, CN)
- Jinzhao LU (Zhanjiang, CN)
Cpc classification
International classification
Abstract
Provided is a gene for trypsin-like serine protease, a protein encoded thereby and use thereof. The nucleotide sequence of the gene for trypsin-like serine protease is set forth in SEQ ID No. 1, the amino acid sequence of the protein encoded by the gene for trypsin-like serine protease is set forth in SEQ ID No. 2. The protein encoded by the gene provided by the present disclosure is capable of inhibiting P. aeruginosa, A. hydrophila, V. parahaemolyticus and V. harveyi.
Claims
1. A gene encoding a trypsin-like serine protease, wherein the gene has a nucleotide sequence set forth in SEQ ID No. 1.
2. A protein encoded by the gene for trypsin-like serine protease of claim 1, wherein the protein has an amino acid sequence set forth in SEQ ID No. 2.
3. A method for inhibiting a microorganism, comprising administering a protein having the amino acid sequence set forth in SEQ ID No. 2 to a subject in need thereof.
4. The method according to claim 3, wherein the microorganism is one or more selected from P. aeruginosa, A. hydrophila, V. parahaemolyticus and V. harveyi.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
DETAILED DESCRIPTION OF THE EMBODIMENTS
[0028] The present disclosure provides a gene for trypsin-like serine protease, and the nucleotide sequence of the gene for trypsin-like serine protease is set forth in SEQ ID No. 1, specifically shown as follows:
TABLE-US-00001 ACATGGGCTAATAAATGGATCGTGACAGCCGCCCACTGTATCGTGCGTTT TCCCGAGAAATTCCACGAATTGTTCCACCCCTCTAAGGTCACCCTTATTA TTGGTACAGAGCAGTGTAGCGGATATGACGGCCAAATCGTGGACATCGAG TCATATGTTGTGCATCCTAGATTTGCAGAAAGGGCTCCATACGACCATGA TATAGCTTTGATAGAACTTCGTCAAGATTTAAACTTTACAGAACGTGTAC AACCAATATGTCTCAAGCAGCCGGATTACGTGAATACTGCTTTCCTTCAT CGCAAAGTCGGGCGTAAGGCAGGGAGGGTTGTAGGGTGTGGTCAATTGTA TGAAAATGTAGATGCTATACCCACGGAGCTACATGACGTTTTCGTACCAA CAGTGACTAGGGAGAAATGTATGGAGGCGGACATAGGGCGAGGAAATTTC ACTGACACTATGTTCTGCGCAGGGTATGACAGGGCTTTATTCGGAGATGC TTGTTATGGTGATAGTGGTGGCTCTTTGGCGATGAATGACTCCCCATTTG ACCCCTGGGTCCTTGTGGGCGTGGTGTCATGGGGAGTTGGGTGTGACCGA CAAGGACATTATGGATACTATACAAATATAGCTCACTTTTATAACTGGAT ACAAAATGTCACAAATGTTTTAAATAATTAGGATTGAAACAATAAAGAGA TATAGATCTTAATTTATACTATTGAGACACAATTAAAAAAAGTTTAACCC TAAAAAAAAAAAAAAAAAAAAAAAAAAA.
[0029] The underline represents the open reading frame ORF of the gene for trypsin-like serine protease.
[0030] The present disclosure also provides the protein encoded by the gene for trypsin-like serine protease described in the above technical solution, the protein is short for PmTLS, which is the trypsin-like serine protease of P.f. martensii, and the amino acid sequence of the protein is as set forth in SEQ ID No. 2, which is shown in detail as follows:
TABLE-US-00002 MEADIGRGNFTDTMFCAGYDRALFGDACYGDSGGSLAMNDSPFDPWVLVG VVSWGVGCDRQGHYGYYTNIAHFYNWIQNVTNVLNN.
[0031] The present disclosure further provides the use of the protein described in above technical solutions in preparation of microorganisms in the manufacture of a medicament for inhibiting a microorganism. In the present disclosure, the microorganism is preferably one or more selected from the group consisting of P. aeruginosa, A. hydrophila, V. parahaemolyticus, and V. harveyi.
[0032] The technical solutions provided by the present disclosure will be described in detail below in conjunction with the embodiments. However, these embodiments should not be understood as limiting the protection scope of the present disclosure.
EXAMPLE 1
[0033] a) Molecular Screening for Immune Effect of P.f. martensii
[0034] All amino acid sequences with previously verified antimicrobial activity were obtained from online antimicrobial peptide database (APD3, http://aps.unmc.edu/AP/main.php), PubMed (https://www .ncbi.nlm.nih.gov/pubmed/) and the National Center for Biotechnology Information (NCBI) database (https://www.ncbi.nlm.nih.gov/). Subsequently, a local reference AMP database was constructed, and an alignment search was conducted based on the genome data of P.f. martensii. The gene sequence with highest alignment rate was collected, and then the online Blast in the NCBI database was used for analysis, and the type of the collected immune effector of the PmTLS gene was predicted.
b) Design of Related Primer for PmTLS Gene
[0035] Specific primers for TLS gene were designed using Primer Premier 5.0. The 5′-terminal and 3′-terminal specific primers were designed according to the principle of RACE amplification, and full-length of cDNA of the gene was obtained by alignment and splicing. The primer sequence is as follows.
TABLE-US-00003 TABLE 1 Primers Sequence Primer Sequence (5′-3′) number Use PmTLS-3′-inner TATGGAGGCGGACATAGGGCG SEQ ID 3′-RACE No. 3 PmTLS-3′-outer CATCGCAAAGTCGGGCGTAAG SEQ ID 3′-RACE No. 4 PmTLS-5′-inner TGTCCGCCTCCATACATTTCTCC SEQ ID 5′-RACE No. 5 PmTLS-5′-outer ATGACACCACGCCCACAAGG SEQ ID 5′-RACE No. 6 M13-F CGCCAGGGTTTTCCCAGTCACGAC SEQ ID Colony PCR No. 7 detection M13-R GAGCGGATAACAATTTCACACAGG SEQ ID Colony PCR No. 8 detection PmTLS-RT-F AGAAATGTATGGAGGCGGAC SEQ ID Fluorescence No. 9 quantification PmTLS-RT-R ACCATAACAAGCATCTCCGAAT SEQ ID Fluorescence No. 10 quantification GAPDH-F GCAGATGGTGCCGAGTATGT SEQ ID Reference No. 11 gene GAPDH-R CGTTGATTATCTTGGCGAGTG SEQ ID Reference No. 12 gene
[0036] Total RNA Extraction
[0037] A whole tissue sample of P.f. martensii was obtained, Trizol was added and each tissue was ground, total RNA was extracted according to the principle of Trizol method.
[0038] RNA integrity and quality were detected using 1% agarose gel electrophoresis.
[0039] Concentration and purity of the total RNA were measured by using a micro-nucleic acid quantifier.
[0040] The obtained total RNA was stored in an ultra-low temperature refrigerator at −80° C. for later use.
[0041] Synthesis of the First Strand of cDNA
[0042] The required template was prepared according to the operation instruction of the Reverse Transcriptase M-MLV kit. The specific procedures are as follows.
[0043] Binding RNA to the primers: the PCR procedure is 70° C., 10 min, and placement on ice for 2 to 3 min. The sample system is as follows:
TABLE-US-00004 TABLE 2 sample system Reagent Dose Total RNA 1 ng-1 μg Oligo (dT) (50 uM) 1 μL RNase-free water Make up to 8 μL
[0044] (2) Adding the following reagents to the above RNA system:
TABLE-US-00005 TABLE 3 Reagents Reagent Dose 5 × M-MLV Buffer 2.0 μL dNTP Mixture ( 10 mM) 0.5 μL RNase Inhibitor 0.25 μL RTase M-MLV(RNase H-) 0.25-1 μL RNase-free water Make up to 12 μL
[0045] (3) Centrifuging and mixing for a few seconds, and performing PCR. The procedure is: 42° C., 60 min; 70° C., 15 min.
[0046] 5. Cloning of Intermediate Fragment
[0047] Obtain target fragment through high-fidelity enzyme amplification of PrimeSTARHS. The PCR reaction system is as follows.
TABLE-US-00006 TABLE 4 PCR reaction system Reagent Volume PrimeSTARHS 5 μL Template 0.4 μL Upstream primer 0.4 μL Downstream primer 0.4 μL ddH.sub.2O 3.8 μL Total 10 μL
[0048] A three-step method was used for amplification. The PCR reaction procedure is as follows:
TABLE-US-00007 94° C. 5 min 98° C. 15 s Tm value 30 s {close oversize brace} 35 Cycles 72° C. 1-3 min 72° C. 10 min
[0049] (2) Gel Detection and Recovery of Target Fragments
[0050] 1 μL of PCR product was aspirated and detected by using 1% agarose electrophoresis, the target fragments were amplified, and the PCR product was recovered according to the instructions of the PCR product recovery kit (Gene JET Gel Extraction Kit).
[0051] (3) Ligation of Target Fragments
[0052] The purified PCR product was ligated to the pMD-19T Vector (
TABLE-US-00008 TABLE 5 System Reagent dose Solution I 5 μL Destination segment 4.5 μL pMD19-T Vector 0.5 μL Total 10 μL
[0053] The ligation procedure: Ligation was carried out at 16° C. for about 16 hours.
[0054] (4) Transformation
[0055] DH5α competent cells were removed from an ultra-low temperature refrigerator, placed on ice till slight solution, and then the ligation product was added to a vial containing 100 μL DH5α competent cells and gently blown for homogeneity. The vial was placed on ice for 30 min and heat shocked at 42° C. for 60-90 s, then was placed on ice and stood for 2-3 minutes. Then 890 μL of LB liquid medium which was preheated at 37° C. in advance was added and incubated under vibration at 37° C., 200 rpm for 1 h, then 4000 rpm for 2 minutes. The supernatant was discarded, leaving about 100 μL. The suspended cells were gently blown and smeared on the LA (Amp+) solid plate. Finally, the cells was incubated upright for half an hour at 37° C., then incubated inverted overnight.
[0056] (5) Colony PCR Detection
[0057] A single colony was picked and inoculated in LA (containing Amp+) liquid medium, incubated under vibration at 37° C., 220 rpm for about 6 hours. M13 universal primers were used to identify positive clones, and the positive colonies detected by 1% agarose gel electrophoresis were sent to Guangzhou Shenggong for sequencing. The specific system and procedures are as follows:
TABLE-US-00009 TABLE 6 System Premix Taq 5.0 μL Primer M13-F(10 μM) 0.4 μL Primer M13-R(10 μM) 0.4 μL Bacteria culture solution DNA 0.4 μL ddH.sub.2O 3.8 μL Total 10 μL
TABLE-US-00010 TABLE 7 Procedure 94° C. 5 min 94° C. 30 s 54° C. 30 s {close oversize brace} 30 cycles 72° C. 2 min 72° C. 10
[0058] 6. 3′- and 5′-Terminal RACE Amplification
[0059] The 3′- and 5′-RACE cDNA template was prepared by referring to the instructions for SMART™ RACE cDNA Amptification kit. Nested PCR was performed for amplification by binding 3′- and 5′- specific primers to universal primers (NUP and UPM).
[0060] The first round of RACE response
TABLE-US-00011 TABLE 8 System Reagent Volume PrimeSTAR HS 5 μL 3′/5′cDNA template 0.4 μL UPM primer 0.4 μL Outer specific primer 0.4 μL ddH.sub.2O 3.8 μL Total 10 μL
[0061] PCR reaction procedure:
TABLE-US-00012 94° C. 5 min 98° C. 15 s Tm 30 s {close oversize brace} 30 Cycles 72° C. 3 min 72° C. 10 min
[0062] (2) Second Round of RACE Response
TABLE-US-00013 TABLE 9 System Reagent volume Premix Taq 5 μL 3′/5′cDNA template 0.4 μL NUP primer 0.4 μL Inner specific primer 0.4 μL ddH.sub.2O 3.8 μL Total 10 μL
[0063] PCR reaction procedure:
TABLE-US-00014 94° C. 5 min 94° C. 30 s Tm 30 s {close oversize brace} 35 Cycles 72° C. 2 min 72° C. 1 min
[0064] (3) PCR gel cutting recovery/product purification: ligation, transformation and colony PCR detection may be referred to steps (2)-(5) in the above section 5.
[0065] 7. Bioinformatics Analysis
[0066] NCBI blastx was used for sequence homology and similarity analysis, DNAMAN 6.0 software was used sequence search, splicing and alignment, ExPASy was used for online prediction of its theoretical molecular weight (MW) and isoelectric point (pI), Signa1P 4.0 Server was used for signal peptide sequence prediction, TMHMM Server v. 2.0 was used to analyze the transmembrane domain of the sequence, MEGA 6 software was used to construct a phylogenetic tree by using a NJ method, SoftBerry Psite was used to predict the functional site of its deduced amino acid sequence, and SOPMA was used to predict the secondary structure of the protein.
[0067] 8. Tissue Expression and Temporal Expression Analysis after PAMPs Stimulation
[0068] 8.1 Shellfish Treatment and Sample Collection
[0069] Tissue quantification: Ten vigorous P.f. martensii with the same size, were selected and the tissues of gonads, gills, mantle membrane, hemolymph, adductor muscle and hepatopancreas were collected.
[0070] (2) PAMPs stimulation: 320 healthy P.f. martensii kept for 1 week and randomly divided into 4 groups: LPS stimulation group (experimental group), PGN stimulation group (experimental group), PolyI:C stimulation group (experimental group)), and PBS group (control group), with 80 shells in each group. A method of adductor muscle injection was used, each P.f. martensii in the experimental group was injected with 100 μL of LPS, PGN, PolyI:C (10 μg/mL), and 100 μL of PBS was injected in the control group. At 0, 3, 6, 12, 24, 48, 72, 96 h after injection, 10 shellfishes were randomly selected from each group and whole tissues were taken out for later use. The hemolymph is centrifuged at 4° C., 800× g for 15 minutes, and the supernatant discarded, and 1 mL Trizol was added and gently shaken to mix the suspension uniformly. Total RNA was extracted and reverse transcribed into cDNA for the following quantitative analysis (Note: PBS was sterilized, LPS, PGN, PolyI:C were prepared using sterilized PBS. No bait was fed, and no death occurred during the experiment).
[0071] 8.2 Primer Design
[0072] The primers used in the fluorescence quantitative PCR reaction are shown in Table 1.
[0073] 8.3 Extraction of Total RNA
[0074] The method for extraction of total RNA is the same as that in steps of (1)-(4) in section 3.
[0075] 8.4 Preparation of Fluorescence Quantitative cDNA Template
[0076] Operation was followed according to the instructions of Reverse Transcriptase M-MLV (RNase H).
[0077] RNA was bound to the primers: The PCR procedure was 70° C., 10 min, and placement on ice for 2 to 3 min. The sample addition system is as follows:
TABLE-US-00015 TABLE 10 Sampling system Reagent volume Total RNA 1 ng-1 μg Random Primers(25 uM) 1 μL RNase-free water Make up to 8 μL
[0078] (3) The following reagents were added to the above RNA system:
TABLE-US-00016 TABLE 11 Reagents Reagent dose 5 × M-MLV Buffer 2.0 μL dNTP Mixture(10 mM) 0.5 μL RNase Inhibitor 0.25 μL RTase M-MLV(RNase H-) 0.25-1 μL RNase-free water Make up to 12 μL
[0079] (3) Centrifugation and mixing was performed for a few seconds, and PC was performed. The procedure was 42° C., 60 min; 70° C., 15 min, the obtained first strand of cDNA was stored at −20° C.
[0080] 8.5 Fluorescence Quantitative PCR
[0081] The reverse transcription cDNA in section 8.4 was used as the template, and GAPDH was selected as the internal reference gene. Sample wells were set based on 3 experimental replicates. Real-time fluorescence quantitative PCR was performed according to the following reaction system and reaction conditions:
TABLE-US-00017 TABLE 12 Reaction system Forward Primer 0.5 μL Reverse Primer 0.5 μL Template 0.5 μL SYBR Premix ExTaqTM 5 μL dd H.sub.2O 3.5 μL Total 10 μL
[0082] Reaction procedure:
TABLE-US-00018 95° C. 2 min 95° C. 15 s 60° C. 60 s {close oversize brace} 40 cycles 72° C. 30 s 95° C. 10 s 65° C. 60 s {close oversize brace} Melt Curve 97° C. 1 s 37° C. Cool 30 s
[0083] 8.6 Statistics and Analysis
[0084] The fluorescence quantitation data was analyzed using a 2-z,900 .sup.ct method. The test results were all expressed as mean±standard deviation, and SPSS17.0 software was used to perform one-way ANOVA, and Duncan's multiple range test was used to test the significance of differences in the mean values.
[0085] 9. Preparation of Recombinant Protein
[0086] 9.1 Gene Synthesis
[0087] Gene synthesis was performed according to the existing target gene sequence, which was used as a template for subsequent subcloning, and the introduced restriction sites were NcoI and HindIII.
[0088] 9.2 Construction of Prokaryotic Expression Vector
[0089] Amplification of recombinant PmTLS ORF. The PCR system was: 10 μL of Premix Ex of Taq, 0.5 μL synthesis template, Forward Primer and Reverse Primer 0.4 μL for each, the system was made up to 20 μL by using ddH.sub.2O. The procedure was: denaturation at 94° C. for 5 min; 98° C. for 10 s, 55° C. for 30 s, 72° C. for 60 s, 30 cycles. The reaction products were detected by gel electrophoresis.
[0090] See section 5 for cloning and sequencing of PmTLS and PmKuPI.
[0091] Extraction of plasmid may be referred to the instructions of the Easy Pure Plasmid Mini Prep Kit (Silica Gel Membrane Spin Column Plasmid DNA Mini Extraction Kit).
[0092] Double digestion of the empty plasmid pET-28a(+) and the extracted recombinant plasmid with MluI, XhoI and HindIII endonucleases was performed. The system was: 5.0 μL of 10× FD Buffer, M1uI endonuclease 3.0 μL, 20 μL of plasmid, and ddH.sub.2O to make up the system to 50 pt. Mix lightly and keep at 37° C. for 2 h.
[0093] The purification of gel cutting may be refer to step (2) in section 2.2.5.
[0094] The recovered product purified by restriction digestion was ligated to the pET-28a(+) vector through the action of T4 ligase to construct the recombinant expression plasmid pET28a-PmTLS. System for ligation was as follows: recovered digested and purified product: 6 μL, pET-28a (+): 2 μL, 10× Buffer T4: 1 μL, T4 ligase: 1 μL, total volume of the system: 10 μL. The reaction mixture was mixed gently and allowed to react overnight at 16° C.
[0095] Transformation of the ligation product, screening of positive clones, and the sequencing may be referred to the steps (4) to (5) in Section 5.
[0096] Plasmid extraction may be referred to step (3) in Section 9.2 to obtain the pET28a-PmTLS recombinant plasmid, which was stored at −20° C. for later use.
[0097] 9.3 Induced Expression of Recombinant Fusion Protein
[0098] Transform and Screening of Positive Clones
[0099] Competent cell BL21 (DE3) was taken out of the ultra-low temperature refrigerator and thawed in ice firstly. 100 ng of plasmid DNA was added to the BL21 (DE3) strain and mixed gently. The test tube was placed on ice and incubated for 30 minutes, and the tube heated at 42° C. for 90 seconds without shaking. The test tube was placed on ice for 3 minutes, and 100 μL of room-temperature LB medium was added. The tube was shaken and incubated at 200 rpm at 37° C. for 60 minutes, the resulting mixture was spread on an LB agar plate containing 50 μg/mL of kanamycin, and the plate was inverted and incubated at 37° C. overnight. Positive clones were screened and sequenced.
[0100] Best induction conditions selected the for small-scale culture
[0101] Three well-separated single colonies were picked and each inoculate into 4 mL LB medium containing 50 μg/mL kanamycin, and the cells was incubated on a shaker at 37° C. with 200 rpm shaking. When the OD600 value reached 0.6-0.8, IPTG was added to two of the three tubes till a final concentration of 0.5 mM of IPTG. Then the IPTG was induced at 15° C. for 16 h and at 37° C. for 4 h, and third test tube was used as a negative control.
[0102] Preparation and detection of recombinant protein and
[0103] a). The cell pellets were harvested from 450 μL of culture and lysed for 1 minute with a sonicator.
[0104] b). Whole cell lysate: 50 μL of 5× loading buffer was mixed with 100 μL of cell lysate and used as a sample of whole cell lysate, and the sample was heated at 100° C. for 10 min, and then centrifuged at 15,000 rpm for 5 min.
[0105] c) Supernatant and debris of cell lysate: the remaining 200 μL of cell lysate was centrifuged at 15,000 rpm for 10 minutes, the supernatant and cell debris of the cell lysate were collected and 90 μL of 5× loading buffers were mixed with 180 μL of supernatant respectively, and used as a sample. The Supernatant of cell lysate. All pellets were re-suspended in 150 μL of 5× loading buffer and used as the sample of cell lysate debris. The samples were heated at 100° C. for 10 minutes and centrifuged at 15,000 rpm for 5 minutes before sample loading.
[0106] d) The expression and solubility of the protein were measured through SDS-PAGE and Western blot, and fusion protein was finally expressed through induction in a large amount.
[0107] 9.4 Separation and Purification of Fusion Protein
[0108] Ultrasonic Disruption of Bacteria
[0109] The collected bacteria cells were dissolved in Buffer (50 mM Tris, 150 mM NaCl, 5% glycerol, pH 8.0) and ultrasonically disrupted in an ice bath for 30 minutes at power 350 W (with ultrasound for 4 and pause for 6 s as one cycle).
[0110] After sonication, centrifugation was performed for 20 min at 12,000 rpm, 4° C., the supernatant was discarded. The precipitates were disrupted and dissolved in Buffer, ultrasonically disrupted in an ice bath for 30 min at a power 350 W (with ultrasound for 4 s and pause for 6 s as one cycle).
[0111] After sonication, centrifugation was performed for 20 min at 12,000 rpm, 4° C., and the supernatant was collected for the next step of purification.
[0112] Nickel Agarose Affinity Chromatography
[0113] 5 mL of Ni-NTA was taken and the column was washed and equilibrated with Binding buffer of 5 volumes of the column bed at a flow rate of 5 mL/min.
[0114] The filler and the sample were loaded on the column after being incubated for 1 hour and the eluate was collected.
[0115] The column was washed with Binding buffer 5 volumes of the column bed at a flow rate 5 m L/min.
[0116] The impurities were washed off with Washing buffer at a flow rate of 5 mL/min, and the eluate was collected.
[0117] Elution was carried out with Elution buffer at a flow rate 2 mL/min, and the eluate was collected.
[0118] Samples were collected for SDS-PAGE detection.
[0119] SDS-PAGE Detection of Purified Protein
[0120] Preparation of 12% SDS-PAGE: Tris-Gly electrophoresis buffer was used and electrophoresis was conducted for 20 min in stacking gel at 80 V and for 60 min in separating gel at 120 V. After the completion of the gel electrophoresis, the gel was stained with Coomassie blue for 20 min and then decolorized overnight.
[0121] Western Blot Detection
[0122] Gel preparation: preparation of polyacrylamide gel: 5% for stacking gel and 12% for separating gel.
[0123] Sample preparation: sample loading.
[0124] Electrophoresis: stacking gel, 80 V, 30 min; separating gel 120 V, 60 min.
[0125] Membrane transfer: wet transfer, 250 mA, 90 min.
[0126] Blocking: 5% skimmed milk powder was used and conducted at 37° C. for 2 hours on slow shaking.
[0127] Incubation of the primary antibody: the primary antibody was rabbit anti-his-tag available from the antibody company of Sangon Biotech, NO.: D110002, 1:500 dilution, 37° C.; the primary antibody was slowly shaken for 60 min.
[0128] Incubation of secondary antibody: goat anti-rabbit secondary antibody, available from the antibody company of Sangon Biotech, NO.: D110058, 1: 8000 dilution, 37° C.; the secondary antibody was slowly shaken 60 min.
[0129] Color development: developed with TMB.
[0130] Renaturing of Inclusion Body Protein
[0131] The purified target protein was renatured by dialysis, and finally replaced with a soluble buffer (PBS, 10% glycerol, 1 ML-arginine, pH 7.4), and the purity of the purified protein before renaturation (precipitation) and after renaturation (dissolution) was detected and compared by SDS-PAGE and Western blot.
[0132] Testing of Antibacterial Activity of the Purified Protein
[0133] The antibacterial activity of the purified protein against Escherichia coli, Micrococcus luteus, A. hydrophila, P. aeruginosa, V. parahaemolyticus, V. harveyi, Bacillus subtilis and Staphylococcus aureus was tested. First, each species of bacteria was cultured in 2216E liquid medium to a logarithmic growth phase. Then the bacteria were centrifuged (3,000× g, 10min), washed 3 times with phosphate buffered saline (1× PBS), and then resuspended in PBS. Second, a 96- well microtiter plate was used to mix 50 μL of purified protein (200 μg/mL) with 10 μL of each bacterial suspension, and the mixture was incubated at room temperature for 2 hours. PBS was used as a negative control. Then 140 μL of medium was added to each mixed well, incubated in a constant temperature incubator at 37° C., and a microplate reader (EnSpire, PerkinElmer) was used to measure the OD600 value at hour 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 and 12 after adding purified protein and PBS. Three experiments were performed in parallel for each sample.
[0134] j) Observation of Morphological Changes of the Bacteria after Being Effected by the Purified Protein with Transmission Electron Microscope
[0135] 200 μL of bacteria in the exponential growth phase was treated with 200 μL of purified protein at 37° C. for 2 hours. PBS was used instead as a control. Then mixture of the purified protein and the bacterial was precipitated through centrifugation for 10 min at room temperature at 3000 rpm and washed with PBS washed 3 times to remove impurities. Then the bacterial precipitates were immobilized overnight with 200 μL of 3% glutaraldehyde. After this treatment, 200 μL of 2% sodium phosphotungstate aqueous solution was added to the bacterial suspension, and the resulting suspension was dripped on the copper mesh. Residual water was removed with filter paper. After 5 minutes, the sample was air-dried and observed with JEM-1400 (Japan Electronics Corporation) microscope under standard operating conditions.
[0136] 12. Results
[0137] 12.1 Gene Cloning of PmTLS
[0138] A PmTLS gene (SEQ ID No. 1) with a full length of 778 bp was obtained by a RACE cloning technique, which contains 420 bp of the 5′UTR, 97 bp of 3′UTR, 261 bp of ORF frame and encodes 86 amino acids (of SEQ ID No. 2).
[0139] 12.2 Analysis of Physical and Chemical Properties of PmTLS
[0140] The molecular weight of PmTLS protease is 9.5 KDa and the theoretical isoelectric point is 4.22. It is predicted that its hydrophilic. It is found that the highest continuous hydrophobicity occurs at positions 51 and 52, with an index of 2.011 and the highest hydrophilicity at position 63, with an index of −2.156, and the total average hydrophilicity coefficient is −0.172, which indicating it is a hydrophilic protein. The total number of negatively charged residues (Asp+Glu) is 9 and the total number of positively charged residues (Arg+Lys) is 3. Therefore, the overall PmTLS protease is negatively charged. The prediction of transmembrane structure reveals that it has no transmembrane domain. The secondary structure predicted by SOPMA software shows that random coils account for 39.53% of the whole, a-helical structure for 29.07%, extended chain for 22.09%, and β-turn angle for 9.30%. SMART analysis results show that PmTLSThe amino acid sequence forms a Trypsin domain at positions 1-77 (
[0141] 12.3 Homology Analysis of PmTLS
[0142] Through DNAMAN, the amino acid sequence of PmTLS was compared with the corresponding amino acids of other invertebrates. It was found that there was highest similarity between PmTLS and Pacific oyster (Crassostrea gigas), reaching 69.77%, and the similarity between species reached 41.42% (
[0143] MEGA 6 was used to construct a phylogenetic tree. In the phylogenetic tree classification of PmTLS, it was found that invertebrates clustered into a large branch, and vertebrates clustered into a large branch, and the P.f. martensii had the closest relationship with the Pacific oyster (
[0144] 12.4 Tissue Quantitative Analysis of PmTLS Gene mRNA
[0145] Real-time PCR was use to detected the expression mode of gene mRNA of PmTLS protease in 6 tissues such as hemocytes of the Pinctada martensi. The results showed that PmTLS protease gene had the highest expression level (p<0.01) in hemocytes, followed by the gonads; the expression level in the mantle and adductor muscle was the lowest, with almost no expression (
[0146] 12.5 Analysis of Temporal Expression of mRNA for PmTLS Gene in Hemocytes after PAMPs Stimulation
[0147] LPS (lipopolysaccharide), PGN (peptidoglycan) and PolyI:C (polyinosinic acid) and other pathogen-related molecular patterns (PAMPs) was selected to activate the innate immune response of P.f. martensii. Real-time PCR detected the temporal changes of mRNA for PmTLS in the hemolymph of P.f. martensii at different times. The results showed that, when compared with the control group, after LPS stimulation, PmTLS gene expression increased at 3 h, then remained normal at 24 h, suddenly increased to the maximum at 48 h (P<0.05), and decreased slightly at 72 h and was close to the normal level at 96 h (
[0148] 12.6 Expression of PmTLS Recombinant Protein
[0149] Construction of PmTLS Prokaryotic Expression Vector
[0150] According to the existing full-length cDNA sequence of the PmTLS gene, the open reading frame ORF was predicted and analyzed to obtain the ORF sequence that needed to be recombined. Histidine gene sequence was designed and added to the recombination ORF sequence, and gene synthesis was followed, and then prokaryotic expression primers were designed. After PCR amplification, the PmTLS gene fragment had a length of about 290 bp, then the PmTLS gene was ligated to the MD19-T vector, transformed, and a single colony was selected. The colonies of positive clones were identified by colony PCR, and the biogenic plasmid extraction kit was used to extract the plasmid and digested with MluI endonuclease. And PmTLS was ligated to the pET-28a(+) vector, transformed, and positive clones were identified by colony PCR. The gene fragments of PmTLS after M1uI digestion had a length of about 900 bp. Subsequently, the plasmids with positive clone results were extracted, and the plasmids obtained by extraction were the recombinant plasmids of pET28-PmTLS. The estimated molecular weights of the recombinant proteins were 10.32 KDa. The results for colony PCR identification, MluI digestion identification (
[0151] Induced Expression of PmTLS Recombinant Protein (rPmTLS)
[0152] The recombinant expression vector pET28-PmTLS was transformed into E. coli, with 0.5 mM of IPTG, induced at 15° C. for 16 h and 37° C. for 4 h, respectively, wherein a negative control without IPTG induction was used. It can be seen from
[0153] In order to obtain a large amount of fusion protein, expression strain of pET28-PmTLS was cultured at an expression level of 1 L, and induced at 0.5 mM IPTG at 37° C. for 4 h. The results showed that a clear and single band appeared at about 10 KDa, indicating that rPmTLS with higher purity was successfully obtained, and there was no change in the molecular weight of the recombinant protein before and after renaturation, indicating that higher purity was obtained after renaturation (
[0154] 12.7 Determination of Antibacterial Activity of rPmTLS
[0155] In the inhibition experiment of bacterial liquid growth curve, a total of 8 types of bacteria were determined. Among them, 3 were Gram-positive bacteria, 5 were Gram-negative bacteria, and rPmTLS protein significantly inhibited the growth of 4 Gram-negative bacteria (P<0.05), which are P. aeruginosa, A. hydrophila, V. parahaemolyticus, and V. harveyi (
[0156] 12.8 Antibacterial Mechanism of rPmTLS
[0157] In order to understand the antibacterial mechanism of the TLS of P.f. martensii, a rPmTLS solution was reacted with P. aeruginosa, A. hydrophila and V. parahaemolyticus for 2 h, and the mesh was dripped and microscope was performed under a transmission electron microscope. The results are shown in
[0158] Described above are merely the preferred embodiments of the present disclosure. It should be pointed out that for those of ordinary skill in the art, several improvements and modifications can be made without departing from the principle of the present disclosure, and these improvements and modifications should also be regarded as the protection scope of the present disclosure.