PEPTIDES AND NANOPARTICLES FOR INTRACELLULAR DELIVERY OF MOLECULES

20220313825 · 2022-10-06

    Inventors

    Cpc classification

    International classification

    Abstract

    The present application is directed to cargo delivery complexes for intracellular delivery of a cargo molecule comprising: a first peptide comprising a cell-penetrating peptide (CPP), a second peptide comprising a cell-penetrating peptide, and a cargo molecule. The second peptide comprises a polyethylene glycol (PEG) moiety linked to the second CPP, and the first peptide does not have a PEG moiety. The present application is also directed to a cargo delivery complex comprising a CPP and a cargo molecule wherein the CPP is a retro-inverso peptide. The present application is also directed to a cargo delivery complex comprising a CPP and a cargo molecule wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS and YIGSR. Methods of making and using the cargo delivery complexes are also disclosed.

    Claims

    1. A cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety.

    2. The cargo delivery complex of claim 1, wherein the first and the second cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.

    3. The cargo delivery complex of claim 1 or claim 2, wherein the first and the second cell-penetrating peptides are selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.

    4. The cargo delivery complex of any one of claims 1-3, wherein the first and/or the second cell-penetrating peptide is a VEPEP-3 peptide.

    5. The cargo delivery complex of claim 4, wherein the VEPEP-3 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, and 76.

    6. The cargo delivery complex of any one of claims 1-5, wherein the first and/or the second cell-penetrating peptide is a VEPEP-6 peptide.

    7. The cargo delivery complex of claim 6, wherein the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40 and 77.

    8. The cargo delivery complex of any one of claims 1-7, wherein the first and/or the second cell-penetrating peptide is a VEPEP-9 peptide.

    9. The cargo delivery complex of claim 8, wherein the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52 and 78.

    10. The cargo delivery complex of any one of claims 1-9, wherein the first and/or the second cell-penetrating peptide is an ADGN-100 peptide.

    11. The cargo delivery complex of claim 10, wherein the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79 and 80.

    12. The cargo delivery complex of any one of claims 1-11, wherein the first and the second cell-penetrating peptide are the same.

    13. The cargo delivery complex of any one of claims 1-12, wherein the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    14. The cargo delivery complex of claim 13, wherein the cargo molecule is a nucleic acid.

    15. The cargo delivery complex of claim 14, wherein the nucleic acid is selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof

    16. The cargo delivery complex of claim 15, wherein the nucleic acid comprises an mRNA.

    17. The cargo delivery complex of claim 15 or claim 16, wherein the nucleic acid comprises an RNAi.

    18. The cargo delivery complex of claim 16 or claim 17, wherein the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition.

    19. The cargo delivery complex of any one of claims 14-18, wherein the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1.

    20. The cargo delivery complex of any one of claims 14-19, wherein the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm.

    21. The cargo delivery complex of any one of claims 1-20, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1.

    22. The cargo delivery complex of any one of claims 1-21, wherein the PEG moiety is a linear PEG.

    23. The cargo delivery complex of any one of claims 1-21, wherein the PEG moiety is a branched PEG.

    24. The cargo delivery complex of any one of claims 1-23, wherein molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa.

    25. The cargo delivery complex of any one of claims 1-24, wherein the PEG moiety consist of about one to ten ethylene glycol units.

    26. The cargo delivery complex of any one of claims 1-25, wherein the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide.

    27. The cargo delivery complex of any one of claims 1-25, wherein the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    28. The cargo delivery complex of any one of claims 1-27, wherein the first and/or second peptide further comprises one or more moieties selected from the group consisting of an acetyl group, a stearyl group, a fatty acid, a cholesterol, a nuclear localization signal, a nuclear export signal, an antibody or antibody fragment thereof, a peptide, a polysaccharide, and a targeting sequence, wherein the one or more moieties are covalently linked to the N-terminus of the first or the second cell-penetrating peptide, or the PEG moiety.

    29. The cargo delivery complex of claim 28, wherein the one or more moieties is covalently linked to the N-terminus of the first cell-penetrating peptide, the second cell-penetrating peptide or the PEG moiety via a linker.

    30. The cargo delivery complex of claim 28, wherein the one or more moiety comprises a targeting sequence.

    31. The cargo delivery complex of claim 30, wherein the targeting sequence is selected from the group consisting of GY, YV, VS, SK, GYV, YVS, VSK, GYVS, YVSK, YI, IG, GS, SR, YIG, IGS, GSR, YIGS, and IGSR.

    32. The cargo delivery complex of claim 31, wherein the targeting sequence is selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR.

    33. The cargo delivery complex of any one of claims 30-32, wherein the targeting sequence is covalently linked to the first or the second cell-penetrating peptide via a linker.

    34. The cargo delivery complex of any one of claims 28-33, wherein the one or more moiety comprises an acetyl group and/or a stearyl group.

    35. The cargo delivery complex of any one of claims 1-34, wherein the first and/or second peptide further comprises one or more moieties selected from the group consisting of a cysteamide, a cysteine, a thiol, an amide, a nitrilotriacetic acid optionally substituted, a carboxyl, a linear or ramified C.sub.1-C.sub.6 alkyl optionally substituted, a primary or secondary amine, an osidic derivative, a lipid, a phospholipid, a fatty acid, a cholesterol, a nuclear localization signal, nuclear export signal, an antibody, a polysaccharide and a targeting sequence, wherein the one or more moieties are covalently linked to the C-terminus of the first cell-penetrating peptide, the second cell-penetrating peptide or the PEG moiety.

    36. The cargo delivery complex of claim 35, wherein the one or more moieties is covalently linked to the C-terminus of the first cell-penetrating peptide, the second cell-penetrating peptide or the PEG moiety via a linker.

    37. The cargo delivery complex of any one of claims 1-36, wherein the first and/or second cell-penetrating peptide is a retro-inverso peptide.

    38. A cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides, and wherein the cell-penetrating peptide is a retro-inverso peptide.

    39. The cargo delivery complex of claim 37 or claim 38, wherein the retro-inverso peptide comprises a sequence of SEQ ID NO: 85 or 86.

    40. A cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR.

    41. The cargo delivery complex of claim 40, wherein the cell-penetrating peptide is selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.

    42. The cargo delivery complex of claim 40 or 41, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker.

    43. The cargo delivery complex of claim 42, wherein the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group.

    44. The cargo delivery complex of any one of claims 38-43, wherein the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex and a protein complex.

    45. The cargo delivery complex of claim 44, wherein the cargo molecule comprises a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    46. The cargo delivery complex of claim 45, wherein the cargo molecule comprises an mRNA.

    47. The cargo delivery of claim 45 or claim 46, wherein the cargo molecule comprises an RNAi.

    48. The cargo delivery complex of any one of claims 38-47, wherein the cargo molecule does not comprise a virus.

    49. A nanoparticle comprising a core comprising the cargo delivery complex of any one of claims 1-48.

    50. The nanoparticle of claim 49, wherein the core is coated by a shell comprising a peripheral cell-penetrating peptide.

    51. The nanoparticle of claim 50, wherein the peripheral cell-penetrating peptide is selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.

    52. A pharmaceutical composition comprising the cargo delivery complex of any one of claims 1-48 or the nanoparticle of any one of claims 49-51, and a pharmaceutically acceptable carrier.

    53. A method of preparing the cargo delivery complex of any one of claims 1-37, comprising a) combining the first peptide and the second peptide, thereby forming a peptide mixture; b) combining the peptide mixture with the cargo, thereby forming the cargo delivery complex.

    54. A method of preparing the cargo delivery complex of any one of claims 38-48, comprising combining the peptide with the cargo molecule, thereby forming the cargo delivery complex.

    55. The method of claim 53 or 54, wherein the peptide or the peptide mixture and the cargo molecule are combined at a molar ratio from about 1:1 to about 100:1, respectively.

    56. The method of any one of claims 53-55, comprising mixing a first solution comprising the cargo molecule with a second solution comprising the peptide or peptide mixture to form a third solution, wherein the third solution comprises or is adjusted to comprise i) about 0-5% sucrose, ii) about 0-5% glucose, iii) about 0-50% DMEM, iv) about 0-80 mM NaCl, or v) about 0-20% PBS, and wherein the third solution is incubated to allow formation of the cargo delivery complex.

    57. The method of claim 56, wherein the first solution comprises the cargo in sterile water and/or wherein the second solution comprises the peptide or peptide mixture in sterile water.

    58. The method of claim 56 or claim 57, wherein the third solution is adjusted to comprise i) about 0-5% sucrose, ii) about 0-5% glucose, iii) about 0-50% DMEM, iv) about 0-80 mM NaCl, or v) about 0-20% PBS after incubating to form the cargo delivery complex.

    59. The method of any one of claims 53-58, wherein the method further comprises a filtration process, wherein the cargo delivery complex is filtered through a pore-sized membrane.

    60. The method of claim 59, wherein the pore has a diameter of at least about 0.1 μm.

    61. A method of delivering one or more cargo into a cell, comprising contacting the cell with the cargo delivery complex of any one of claims 1-48 or the nanoparticle of any one of claims 49-51, wherein the cargo delivery complex comprises one or more cargo.

    62. A method of delivering one or more cargo into a tissue or organ of an individual, comprising administering into the individual an effective amount of the cargo delivery complex of any one of claims 1-48, the nanoparticle of any one of claims 49-51, or the pharmaceutical composition of claim 52, wherein the tissue or organ is selected from the group consisting of liver, lung, kidney, brain, intestine, spleen, heart, muscle, and lymph node.

    63. A method of treating a disease or condition in an individual, comprising administering into the individual an effective amount of the cargo delivery complex of any one of claims 1-48, the nanoparticle of any one of claims 49-51, or the pharmaceutical composition of claim 52.

    64. The method of claim 63, wherein the disease or condition is associated with a pathological cell in an organ or tissue selected from the group consisting of liver, lung, kidney, brain, intestine, spleen, heart, muscle, and lymph node.

    65. The method of claim 63 or 64, wherein the disease or condition is selected from the group consisting of cancer, diabetes, autoimmune diseases, hematological diseases, cardiac diseases, vascular diseases, inflammatory diseases, fibrotic diseases, viral infectious diseases, hereditary diseases, ocular diseases, liver diseases, lung diseases, muscle diseases, protein deficiency diseases, lysosomal storage diseases, neurological diseases, kidney diseases, aging and degenerative diseases, and diseases characterized by cholesterol level abnormality.

    66. The method of any one of claims 62-65, wherein the cargo delivery complex is administered intravenously or intramuscularly.

    67. The method of any one of claims 62-66, wherein the individual is a human.

    68. A kit comprising the cargo delivery complex of any one of claims 1-48, the nanoparticle of any one of claims 49-51, or the pharmaceutical composition of claim 52.

    Description

    BRIEF DESCRIPTION OF THE FIGURES

    [0018] FIGS. 1A-1C show luciferase expression in 293T cells treated with ADGN-peptide/mRNA complexes. 293T cells cultured in 48 well plates were transfected with ADGN-peptide nanoparticles. ADGN-100, ADGN-106, ADGN-100RI, ADGN-106RI, ADGN-100 Stearyl, ADGN-Hydro1, ADGN-Hydro2, ADGN-Hydro3, ADGN-Hydro4, ADGN-Hydro5, ADGN-Hydro6 and ADGN-peptide/ADGN-100PEG 10% nanoparticles containing 0.25 μg mRNA were formed in sterile water, diluted in sterile water containing 5% Sucrose and filtered with 0.45 μm PES filters. ADGN/nmRNA complexes were incubated for 3 hrs in the presence of either 25% serum or heparan sulfate prior transfection. Luciferase expression was monitored 72 hours post transfection and results were reported as RLU (luminescence):mg of protein.

    [0019] FIGS. 2A-2C show luciferase expression in 293T cells treated with ADGN-peptide/pGL4 plasmid DNA complexes. 293T cells cultured in 48 well plates were transfected with ADGN-peptide nanoparticles. ADGN-100, ADGN-106, ADGN-100RI, ADGN-106R1, ADGN-100 Stearyl, ADGN-Hydro1, ADGN-Hydro2. ADGN-Hydro3, ADGN-Hydro4, ADGN-Hydro5, and ADGN-Hydro6 containing 0.17 μg pGL4 plasmid DNA were formed in sterile water, diluted in sterile water containing 5% Sucrose. ADGN-peptide nanoparticles were evaluated prior (FIG. 2A) and after filtration with 0.45 μm PES filters (FIG. 2B). FIG. 2C impact of peGylated ADGN-100 on the transfection efficiency. pGL4 luc plasmid (0.15 μg) were associated to ADGN-100 solution containing 5 to 50% of ADGN-100-PEG or to ADGN-100PEG. ADGN/pGL4 plasmid DNA complexes were incubated for 3 hrs in the presence of either 25% serum or heparan sulfate prior transfection. Luciferase expression was monitored 72 hours post transfection and results were reported as RLU (luminescence):mg of protein.

    [0020] FIGS. 3A-3C show luciferase expression in A375/Luc cells treated with ADGN-peptide/siRNA complexes. A375/Luc cells cultured in 48 well plates were transfected with ADGN-peptide nanoparticles. ADGN-100, ADGN-106, ADGN-100RI, ADGN-106RI, ADGN-100 Stearyl, ADGN-Hydro1, ADGN-Hydro2, ADGN-Hydro3, ADGN-Hydro4, ADGN-Hydro5, ADGN-Hydro6 and ADGN-peptide/ADGN-100PEG 10% nanoparticles containing 10 nM or 25 nM siRNA were formed in sterile water, diluted in sterile water containing 5% Sucrose and filtered with 0.45 μm PES filters. FIG. 3C impact of peGylated ADGN-100 on the transfection efficiency. siRNA Luc (10 nM and 25 nM) were associated to ADGN-100 solution containing 5 to 50% of ADGN-100-PEG or to ADGN-100PEG. ADGN/siRNA complexes were incubated for 3 hrs in the presence of 25% serum prior transfection. Luciferase expression was monitored 48 hours post transfection and results were reported as RLU (luminescence):mg of protein.

    [0021] FIGS. 4A-4D show the potency of ADGN-peptide variants for in vivo delivery of Luciferase mRNA via intravenous administration in mice. ADGN-peptide/luc mRNA particles containing 5 μg mRNA were formed in sterile water, and then diluted in 5% sucrose. Mice received IV injection of 100 μl ADGN-peptide/mRNA complexes. mRNA LUC expression was monitored by bioluminescence imaging after 12 h, 24 h, 48 h and 72 h. FIG. 4B show bioluminescence imaging at 24 hr in control and treated groups. Semi-quantitative data of luciferase signal in the liver (C) and in the lung (D) were obtained using the manufacturer's software (Living Image; PerkinElmer). Results were then expressed as values relative to day 0.

    [0022] FIGS. 5A-5B show the potency of ADGN-peptide variants for in vivo delivery of Luciferase mRNA via intramuscular administration in mice. ADGN-peptide/luc mRNA particles containing 2.5 μg mRNA were formed in sterile water, and then diluted in 5% sucrose. Mice received IV injection o 25 μl ADGN-peptide/mRNA complexes. mRNA LUC expression was monitored by bioluminescence imaging after 12 h, 24 h and 48 h (A). FIG. 5B show bioluminescence imaging at 24 hr in control and treated groups.

    [0023] FIGS. 6A-6C show the potency of ADGN-peptide variants for in vivo delivery of Luciferase expressing plasmid pGL4 via intravenous administration in mice. ADGN-peptide/pGL4 particles containing 5 μg plasmid DNA were formed in sterile water, and then diluted in 5% sucrose. Mice received IV injection of 100 μl ADGN-peptide/plasmid complexes. pGL4 Luciferase expression was monitored by bioluminescence imaging after 12 h, 24 h, 48 h and 72 h. FIG. 6B shows bioluminescence imaging at 24 hr in control and treated groups. FIG. 6C shows semi-quantitative data of luciferase signal in the liver obtained using the manufacturer's software (Living Image; PerkinElmer). Results were then expressed as values relative to day 0.

    [0024] FIGS. 7A-7B show the potency of ADGN-peptide variants for in vivo delivery of Luciferase expressing plasmid pGL4 via intramuscular administration in mice. ADGN-peptide/pGL4 luc particles containing 2.5 μg plasmid DNA were formed in sterile water, and then diluted in 5% sucrose. Mice received IV injection of 25 μl ADGN-peptide/pGL4 complexes. Luciferase expression was monitored by bioluminescence imaging after 12 h, 24 h and 48 h (A). FIG. 7B show bioluminescence imaging at 24 hr in control and treated groups.

    [0025] FIG. 8 shows the particle sizes and level of aggregation of the ADGN-100 peptide variant/mRNA complexes measured on DLS NanoZS (Malvern Ltd) without filtration or with filtration.

    [0026] FIG. 9 shows the particle sizes and level of aggregation of the ADGN-106 peptide variant-mRNA complexes measured on DLS NanoZS (Malvern Ltd) without filtration or with filtration.

    [0027] FIG. 10 shows the particle sizes and level of aggregation of the ADGN peptide variant/DNA plasmid complexes measured on DLS NanoZS (Malvern Ltd) without filtration or with filtration.

    [0028] FIGS. 11A-11C show the potency of ADGN-peptide variants for in vivo delivery of Luciferase mRNA via intravenous administration in mice.

    DETAILED DESCRIPTION OF THE INVENTION

    [0029] The present application provides complexes and nanoparticles comprising a cell-penetrating peptide (CPP) and one or more mRNAs, wherein the CPP is suitable for delivering into a cell the one or more mRNAs (such as mRNAs encoding a therapeutic product, e.g., a tumor suppressor). The complexes and nanoparticles may comprise a plurality of mRNAs. The mRNAs may include, for example, mRNAs encoding a therapeutic protein (e.g., tumor suppressor, immunomodulator, and the like). In some embodiments, the mRNA encodes a chimeric antigen receptor (CAR). In some embodiments, the complexes and nanoparticles preferentially localize to a target tissue, such as a disease tissue, e.g., a tumor. In some embodiments, the complexes and nanoparticles further comprise an RNAi, such as an RNAi targeting an endogenous gene. In some embodiments, the RNAi targets a disease-associated endogenous gene, e.g., an oncogene. In some embodiments, the RNAi targets an exogenous gene.

    [0030] Thus, the present application in one aspect provides novel cargo delivery complexes and nanoparticles which are described further below in more detail.

    [0031] In another aspect, there are provided methods of delivering an mRNA into a cell using the cell-penetrating peptides. In another aspect, there are provided methods of delivering a complex or nanoparticle comprising an mRNA and a cell-penetrating peptide into a local tissue, organ or cell. In another aspect, there are provided methods of treating a disease or disorder by administering a complex or nanoparticle described herein comprising an mRNA and a cell-penetrating peptide to a subject.

    [0032] Also provided are pharmaceutical compositions comprising a cell-penetrating peptide and one or more mRNAs (for example in the forms of complexes and nanoparticles) and uses thereof for treating diseases.

    Definitions

    [0033] As used herein, the term “retro-inverso peptide” is a peptide made up of D-amino acids in a reversed sequence and, when extended, assumes a side chain topology similar to that of its parent molecule but with inverted amide peptide bonds.

    [0034] As used herein the term “wild type” is a term of the art understood by skilled persons and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms.

    [0035] As used herein the term “variant” should be taken to mean the exhibition of qualities that have a pattern that deviates from what occurs in nature.

    [0036] The terms “non-naturally occurring” or “engineered” are used interchangeably and indicate the involvement of the hand of man. The terms, when referring to nucleic acid molecules or polypeptides mean that the nucleic acid molecule or the polypeptide is at least substantially free from at least one other component with which they are naturally associated in nature and as found in nature.

    [0037] “Complementarity” refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base pairing or other non-traditional types. A percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100% complementary). “Perfectly complementary” means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence. “Substantially complementary” as used herein refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under stringent conditions.

    [0038] As used herein, “expression” refers to the process by which a polynucleotide is transcribed from a DNA template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins. Transcripts and encoded polypeptides may be collectively referred to as “gene product.” If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.

    [0039] The terms “subject,” “individual,” and “patient” are used interchangeably herein to refer to a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed.

    [0040] The terms “therapeutic agent”, “therapeutic capable agent” or “treatment agent” are used interchangeably and refer to a molecule or compound that confers some beneficial effect upon administration to a subject. The beneficial effect includes enablement of diagnostic determinations; amelioration of a disease, symptom, disorder, or pathological condition; reducing or preventing the onset of a disease, symptom, disorder or condition; and generally counteracting a disease, symptom, disorder or pathological condition.

    [0041] As used herein, “treatment” or “treating” refers to an approach for obtaining beneficial or desired results including but not limited to a therapeutic benefit. By therapeutic benefit is meant any therapeutically relevant improvement in or effect on one or more diseases, conditions, or symptoms under treatment.

    [0042] The term “effective amount” or “therapeutically effective amount” refers to the amount of an agent that is sufficient to effect beneficial or desired results. The therapeutically effective amount may vary depending upon one or more of: the subject and disease condition being treated, the weight and age of the subject, the severity of the disease condition, the manner of administration and the like, which can readily be determined by one of ordinary skill in the art. The term also applies to a dose that will provide an image for detection by any one of the imaging methods described herein. The specific dose may vary depending on one or more of: the particular agent chosen, the dosing regimen to be followed, whether it is administered in combination with other compounds, timing of administration, the tissue to be imaged, and the physical delivery system in which it is carried.

    [0043] As used herein, the singular form “a”. “an”, and “the” includes plural references unless indicated otherwise.

    [0044] Reference to “about” a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se. For example, description referring to “about X” includes description of “X.”

    [0045] The compositions and methods of the present invention may comprise, consist of, or consist essentially of the essential elements and limitations of the invention described herein, as well as any additional or optional ingredients, components, or limitations described herein or otherwise useful.

    [0046] Unless otherwise noted, technical terms are used according to conventional usage.

    Complexes and Nanoparticles

    Complexes

    [0047] In some aspects, there are provided cargo delivery complexes comprising cell-penetrating peptides for delivering one or more cargo molecules into a cell.

    Cargo Delivery Complexes Comprising a Peptide Mixture

    [0048] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety. In some embodiments, the first and/or the second cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the first and the second cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-4 peptides, VEPEP-5 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid. In some embodiments, the nucleic acid is selected from the group consisting of an iRNA (such as an siRNA, an miRNA, or a shRNA), a gRNA, an mRNA, a DNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the nucleic acid comprises an mRNA. In some embodiments, the nucleic acid further comprises an RNAi. In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the molar ratio of the cell-penetrating peptide to the cargo molecule (such as the nucleic acid) is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1). In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0049] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1). In some embodiments, the first and/or the second cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP peptide (such as a PEP-1, PEP-2 or PEP-3 peptide), or a VEPEP peptide (such as ADGN-100, VEPEP-3, VEPEP-4, VEPEP-5, VEPEP-6, or VEPEP-9 peptide). In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0050] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the first and/or the second cell-penetrating peptides are selected from VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the first and/or the second cell-penetrating peptide are selected from VEPEP-6 peptides, and ADGN-100 peptides. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid. In some embodiments, the nucleic acid is selected from the group consisting of an iRNA (such as an siRNA, an miRNA, or a shRNA), a gRNA, an mRNA, a DNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the nucleic acid comprises an mRNA. In some embodiments, the nucleic acid further comprises an RNAi. In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the molar ratio of the cell-penetrating peptide to the cargo molecule (such as the nucleic acid) is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1). In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0051] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is/comprises a nucleic acid. In some embodiments, the first and/or the second cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the first and/or the second cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 71-74 and 81. In some embodiments, the first and the second cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-3 peptide. In some embodiments, the VEPEP-3 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-6 peptide. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. IN some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-9 peptide. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the first and/or the second cell-penetrating peptide is an ADGN-100 peptide. In some embodiments, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the first and the second cell-penetrating peptide are the same. In some embodiments, the first and the second cell-penetrating peptide are the different. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0052] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1), and wherein the first and/or the second cell-penetrating peptide is a VEPEP-3 peptide. In some embodiments, the VEPEP-3 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0053] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1), and wherein the first and/or the second cell-penetrating peptide is a VEPEP-6 peptide. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1540, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0054] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1), and wherein the first and/or the second cell-penetrating peptide is a VEPEP-9 peptide. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0055] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1), and wherein the first and/or the second cell-penetrating peptide is a ADGN-100 peptide. In some embodiments, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0056] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1), and wherein the first and/or the second cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the first and/or the second cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 71-74 and 81. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0057] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1), wherein the cargo molecule is or comprises a nucleic acid. In some embodiments, the nucleic acid is selected from the group consisting of an iRNA (such as an siRNA, an miRNA, or a shRNA), a gRNA, an mRNA, a DNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the nucleic acid comprises an mRNA. In some embodiments, the nucleic acid further comprises an RNAi. In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1). In some embodiments, the first and/or the second cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the first and/or the second cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 71-74 and 81. In some embodiments, the first and the second cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-3 peptide. In some embodiments, the VEPEP-3 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-6 peptide. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. IN some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-9 peptide. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the first and/or the second cell-penetrating peptide is an ADGN-100 peptide. In some embodiments, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the first and the second cell-penetrating peptide are the same. In some embodiments, the first and the second cell-penetrating peptide are the different. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0058] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1), wherein the cargo molecule is or comprises a virus. In some embodiments, the first and/or the second cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the first and/or the second cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 71-74 and 81. In some embodiments, the first and the second cell-penetrating peptides are selected from the group consisting of CADY. PEP-1 peptides. PEP-2 peptides. PEP-3 peptides. VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-3 peptide. In some embodiments, the VEPEP-3 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-6 peptide. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. IN some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-9 peptide. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the first and/or the second cell-penetrating peptide is an ADGN-100 peptide. In some embodiments, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the first and the second cell-penetrating peptide are the same. In some embodiments, the first and the second cell-penetrating peptide are the different. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0059] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1), wherein the cargo molecule is or comprises a polypeptide. In some embodiments, the first and/or the second cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the first and/or the second cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 71-74 and 81. In some embodiments, the first and the second cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-3 peptide. In some embodiments, the VEPEP-3 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-6 peptide. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. IN some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-9 peptide. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the first and/or the second cell-penetrating peptide is an ADGN-100 peptide. In some embodiments, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the first and the second cell-penetrating peptide are the same. In some embodiments, the first and the second cell-penetrating peptide are the different. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0060] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1), wherein the cargo molecule is or comprises a protein/nucleic complex. In some embodiments, the first and/or the second cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the first and/or the second cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 71-74 and 81. In some embodiments, the first and the second cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-3 peptide. In some embodiments, the VEPEP-3 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-6 peptide. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. IN some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-9 peptide. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the first and/or the second cell-penetrating peptide is an ADGN-100 peptide. In some embodiments, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the first and the second cell-penetrating peptide are the same. In some embodiments, the first and the second cell-penetrating peptide are the different. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0061] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1), wherein the cargo molecule is or comprises virus like particles. In some embodiments, the first and/or the second cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the first and/or the second cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 71-74 and 81. In some embodiments, the first and the second cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-3 peptide. In some embodiments, the VEPEP-3 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-6 peptide. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. IN some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-9 peptide. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the first and/or the second cell-penetrating peptide is an ADGN-100 peptide. In some embodiments, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the first and the second cell-penetrating peptide are the same. In some embodiments, the first and the second cell-penetrating peptide are the different. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0062] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a first peptide comprising a first cell-penetrating peptide; b) a second peptide comprising a second cell-penetrating peptide; and c) a cargo molecule, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety, wherein the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1), wherein the cargo molecule is or comprises a protein complex. In some embodiments, the first and/or the second cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the first and/or the second cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 71-74 and 81. In some embodiments, the first and the second cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-3 peptide. In some embodiments, the VEPEP-3 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-6 peptide. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. IN some embodiments, the first and/or the second cell-penetrating peptide is a VEPEP-9 peptide. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the first and/or the second cell-penetrating peptide is an ADGN-100 peptide. In some embodiments, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the first and the second cell-penetrating peptide are the same. In some embodiments, the first and the second cell-penetrating peptide are the different. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the PEG moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 50 kDa. In some embodiments, the molecular weight of the PEG moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0063] In some embodiments, the PEG moiety is a linear PEG. In some embodiments, the PEG moiety is a branched PEG.

    [0064] In some embodiments, the first and/or second peptide further comprises one or more moieties selected from the group consisting of an acetyl group, a stearyl group, a fatty acid, a cholesterol, a nuclear localization signal, a nuclear export signal, an antibody or antibody fragment thereof, a peptide, a polysaccharide, and a targeting sequence, wherein the one or more moieties are covalently linked to the N-terminus of the first or the second cell-penetrating peptide, or the PEG moiety. In some embodiments, the one or more moieties is covalently linked to the N-terminus of the first cell-penetrating peptide, the second cell-penetrating peptide or the PEG moiety via a linker. In some embodiments, the one or more moiety comprises an acetyl group and/or a stearyl group. In some embodiments, the one or more moiety comprises a targeting sequence. In some embodiments, the targeting sequence is covalently linked to the first or the second cell-penetrating peptide via a linker. In some embodiments, the targeting sequence is covalently linked to the first or the second cell-penetrating peptide without a linker.

    [0065] In some embodiments, the first and/or second peptide further comprises one or more moieties selected from the group consisting of a cysteamide, a cysteine, a thiol, an amide, a nitrilotriacetic acid optionally substituted, a carboxyl, a linear or ramified C.sub.1-C.sub.6 alkyl optionally substituted, a primary or secondary amine, an osidic derivative, a lipid, a phospholipid, a fatty acid, a cholesterol, a nuclear localization signal, nuclear export signal, an antibody, a polysaccharide and a targeting sequence, wherein the one or more moieties are covalently linked to the C-terminus of the first cell-penetrating peptide, the second cell-penetrating peptide or the PEG moiety. In some embodiments, the one or more moieties is covalently linked to the C-terminus of the first cell-penetrating peptide, the second cell-penetrating peptide or the PEG moiety via a linker. In some embodiments, the one or more moiety comprises an acetyl group and/or a stearyl group. In some embodiments, the one or more moiety comprises a targeting sequence. In some embodiments, the targeting sequence is covalently linked to the first or the second cell-penetrating peptide via a linker. In some embodiments, the targeting sequence is covalently linked to the first or the second cell-penetrating peptide without a linker.

    [0066] In some embodiments, the targeting sequence is selected from the group consisting of GY, YV, VS, SK, GYV, YVS, VSK, GYVS, YVSK, YI, IG, GS, SR, YIG, IGS, GSR, YIGS, and IGSR. In some embodiments, the targeting sequence is selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR.

    [0067] In some embodiments, the linker described herein comprises a polyglycine linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG linker moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG linker moiety is a linear PEG. In some embodiments, the PEG linker moiety is a branched PEG. In some embodiments, the linker comprises a β-Alanine. In some embodiments, the linker comprises at least about two, three, or four glycines, optionally continuous glycines. In some embodiments, the linker further comprises a serine. In some embodiments, the linker comprises a GGGGS or SGGGG sequence. In some embodiments, the linker comprises a Glycine-β-Alanine motif.

    [0068] In some embodiments, the first and/or second cell-penetrating peptide is a retro-inverso peptide. In some embodiments, the retro-inverso peptide comprises a sequence of SEQ ID NO: 85 or 86.

    [0069] In some embodiments, the first and/or second peptide comprises a sequence of SED ID NOs: 1-112.

    Cargo Delivery Complexes Comprising a Retro-Inverso Cell-Penetrating Peptide

    [0070] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is a retro-inverso peptide. In some embodiments, the cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a PEP peptide (such as a PEP-1, PEP-2 or PEP-3 peptide), or a VEPEP peptide (such as ADGN-100, VEPEP-3, VEPEP-4, VEPEP-5, VEPEP-6, or VEPEP-9 peptide). In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex and a protein complex.

    [0071] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is selected from the group consisting of PEP-1 peptides. PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-4 peptides, VEPEP-5 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides, and wherein the cell-penetrating peptide is a retro-inverso peptide. In some embodiments, the cell-penetrating peptide is selected from the group consisting of VEPEP-3 peptides, VEPEP-4 peptides, VEPEP-5 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex and a protein complex. In some embodiments, the cargo molecule does not comprise a virus. In some embodiments, the cargo molecule comprises a nucleic acid selected from the group consisting of an RNAi (such as an siRNA, an miRNA, a shRNA), a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the cargo molecule comprises an mRNA. In some embodiments, the cargo molecule comprises or further comprises an RNAi (such as an siRNA, an miRNA, a shRNA). In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the molar ratio of the cell-penetrating peptide to the cargo molecule (such as the nucleic acid) is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1).

    [0072] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is a retro-inverso peptide, and wherein the cargo molecule does not comprise a virus. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex and a protein complex. In some embodiments, the cargo molecule comprises a nucleic acid. In some embodiments, the nucleic acid is selected from the group consisting of an RNAi (such as an siRNA, an miRNA, a shRNA), a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the cargo molecule comprises an mRNA. In some embodiments, the cargo molecule comprises or further comprises an RNAi (such as an siRNA, an miRNA, a shRNA). In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the molar ratio of the cell-penetrating peptide to the cargo molecule (such as the nucleic acid) is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1). In some embodiments, the cell-penetrating peptide is selected from the group consisting of VEPEP-3 peptides, VEPEP-4 peptides, VEPEP-5 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.

    [0073] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is a retro-inverso peptide, wherein the cell-penetrating peptide is an ADGN-100 peptide, wherein the cargo molecule does not comprise a virus. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is a retro-inverso peptide, wherein the cell-penetrating peptide is an ADGN-100 peptide, wherein the cargo molecule comprises a nucleic acid. In some embodiments, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the nucleic acid is selected from the group consisting of an RNAi (such as an siRNA, an miRNA, a shRNA), a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the cargo molecule comprises an mRNA. In some embodiments, the cargo molecule comprises or further comprises an RNAi (such as an siRNA, an miRNA, a shRNA). In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1).

    [0074] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is a retro-inverso peptide, wherein the cell-penetrating peptide is VEPEP-3 peptide, wherein the cargo molecule does not comprise a virus. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is a retro-inverso peptide, wherein the cell-penetrating peptide is a VEPEP-3 peptide, wherein the cargo molecule comprises a nucleic acid. In some embodiments, the VEPEP-3 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the nucleic acid is selected from the group consisting of an RNAi (such as an siRNA, an miRNA, a shRNA), a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the cargo molecule comprises an mRNA. In some embodiments, the cargo molecule comprises or further comprises an RNAi (such as an siRNA, an miRNA, a shRNA). In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the cargo comprises a DNA plasmid. In some embodiments, the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1).

    [0075] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is a retro-inverso peptide, wherein the cell-penetrating peptide is VEPEP-6 peptide, wherein the cargo molecule does not comprise a virus. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is a retro-inverso peptide, wherein the cell-penetrating peptide is a VEPEP-6 peptide, wherein the cargo molecule comprises a nucleic acid. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the nucleic acid is selected from the group consisting of an RNAi (such as an siRNA, an miRNA, a shRNA), a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the cargo molecule comprises an mRNA. In some embodiments, the cargo molecule comprises or further comprises an RNAi (such as an siRNA, an miRNA, a shRNA). In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1).

    [0076] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is a retro-inverso peptide, wherein the cell-penetrating peptide is VEPEP-9 peptide, wherein the cargo molecule does not comprise a virus. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is a retro-inverso peptide, wherein the cell-penetrating peptide is a VEPEP-9 peptide, wherein the cargo molecule comprises a nucleic acid. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the nucleic acid is selected from the group consisting of an RNAi (such as an siRNA, an miRNA, a shRNA), a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the cargo molecule comprises an mRNA. In some embodiments, the cargo molecule comprises or further comprises an RNAi (such as an siRNA, an miRNA, a shRNA). In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1).

    [0077] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule, wherein the complex comprises a cell-penetrating peptide and a cargo molecule, wherein the cell-penetrating peptide is a retro-inverso peptide comprising a sequence of SEQ ID NO: 85 or 86, and wherein the cargo molecule does not comprise a virus. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex and a protein complex. In some embodiments, the cargo molecule comprises a nucleic acid. In some embodiments, the nucleic acid is selected from the group consisting of an RNAi (such as an siRNA, an miRNA, a shRNA), a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the cargo molecule comprises an mRNA. In some embodiments, the cargo molecule comprises or further comprises an RNAi (such as an siRNA, an miRNA, a shRNA). In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the molar ratio of the cell-penetrating peptide to the cargo molecule (such as the nucleic acid) is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1).

    [0078] In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm).

    [0079] In some embodiments, the cell-penetrating peptide further comprises one or more moieties selected from the group consisting of an acetyl group, a stearyl group, a fatty acid, a cholesterol, a nuclear localization signal, a nuclear export signal, an antibody or antibody fragment thereof, a peptide, a polysaccharide, and a targeting sequence, wherein the one or more moieties are covalently linked to the N-terminus of the cell-penetrating peptide. In some embodiments, the one or more moieties is covalently linked to the N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the one or more moiety comprises an acetyl group and/or a stearyl group. In some embodiments, the one or more moiety comprises a targeting sequence. In some embodiments, the targeting sequence is covalently linked to the cell-penetrating peptide via a linker. In some embodiments, the targeting sequence is covalently linked to the cell-penetrating peptide without a linker.

    [0080] In some embodiments, the peptide further comprises one or more moieties selected from the group consisting of a cysteamide, a cysteine, a thiol, an amide, a nitrilotriacetic acid optionally substituted, a carboxyl, a linear or ramified C.sub.1-C.sub.6 alkyl optionally substituted, a primary or secondary amine, an osidic derivative, a lipid, a phospholipid, a fatty acid, a cholesterol, a nuclear localization signal, nuclear export signal, an antibody, a polysaccharide and a targeting sequence, wherein the one or more moieties are covalently linked to the C-terminus of the cell-penetrating peptide. In some embodiments, the one or more moieties is covalently linked to the C-terminus of the cell-penetrating peptide via a linker. In some embodiments, the one or more moiety comprises an acetyl group and/or a stearyl group. In some embodiments, the one or more moiety comprises a targeting sequence. In some embodiments, the targeting sequence is covalently linked to the cell-penetrating peptide via a linker. In some embodiments, the targeting sequence is covalently linked to the second cell-penetrating peptide without a linker.

    [0081] In some embodiments, the targeting sequence is selected from the group consisting of GY, YV, VS, SK, GYV, YVS, VSK, GYVS, YVSK, YI, IG, GS, SR, YIG, IGS, GSR, YIGS, and IGSR. In some embodiments, the targeting sequence is selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR.

    [0082] In some embodiments, the linker described herein comprises a polyglycine linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG linker moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG linker moiety is a linear PEG. In some embodiments, the PEG linker moiety is a branched PEG. In some embodiments, the linker comprises a β-Alanine. In some embodiments, the linker comprises at least about two, three, or four glycines, optionally continuous glycines. In some embodiments, the linker further comprises a serine. In some embodiments, the linker comprises a GGGGS or SGGGG sequence. In some embodiments, the linker comprises a Glycine-β-Alanine motif.

    Cargo Delivery Complexes that Comprise a Cell Penetrating Peptide with a Signaling Sequence (i.e. Targeting Moiety)

    [0083] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR. In some embodiments, the cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-4 peptides, VEPEP-5 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm). In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker comprises a polyglycine linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG linker moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG linker moiety is a linear PEG. In some embodiments, the PEG linker moiety is a branched PEG. In some embodiments, the linker comprises a β-Alanine. In some embodiments, the linker comprises at least about two, three, or four glycines, optionally continuous glycines. In some embodiments, the linker further comprises a serine. In some embodiments, the linker comprises a GGGGS or SGGGG sequence. In some embodiments, the linker comprises a Glycine-O-Alanine motif. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group.

    [0084] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, and wherein the cargo molecule does not comprise a virus. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the molar ratio of the cell-penetrating peptide to the cargo molecule is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1). In some embodiments, the cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-4 peptides, VEPEP-5 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker comprises a polyglycine linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (I 1-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG linker moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG linker moiety is a linear PEG. In some embodiments, the PEG linker moiety is a branched PEG. In some embodiments, the linker comprises a O-Alanine. In some embodiments, the linker comprises at least about two, three, or four glycines, optionally continuous glycines. In some embodiments, the linker further comprises a serine. In some embodiments, the linker comprises a GGGGS or SGGGG sequence. In some embodiments, the linker comprises a Glycine-O-Alanine motif. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group.

    [0085] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cargo molecule is a nucleic acid. In some embodiments, the nucleic acid is selected from the group consisting of an iRNA (such as an siRNA, an miRNA, or a shRNA), a gRNA, an mRNA, a DNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the nucleic acid comprises an mRNA. In some embodiments, the nucleic acid comprises or further comprises an RNAi. In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the nucleic acid is a DNA plasmid. In some embodiments, the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1). In some embodiments, the cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-4 peptides, VEPEP-5 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker comprises a polyglycine linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (II-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG linker moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG linker moiety is a linear PEG. In some embodiments, the PEG linker moiety is a branched PEG. In some embodiments, the linker comprises a O-Alanine. In some embodiments, the linker comprises at least about two, three, or four glycines, optionally continuous glycines. In some embodiments, the linker further comprises a serine. In some embodiments, the linker comprises a GGGGS or SGGGG sequence. In some embodiments, the linker comprises a Glycine-β-Alanine motif. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group.

    [0086] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK. GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is an ADGN-100 peptide, wherein the cargo molecule does not comprise a virus. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is an ADGN-100 peptide, wherein the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is an ADGN-100 peptide, wherein the cargo molecule is a nucleic acid. In some embodiments, the nucleic acid is selected from the group consisting of an iRNA (such as an siRNA, an miRNA, or a shRNA), a gRNA, an mRNA, a DNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the nucleic acid comprises an mRNA. In some embodiments, the nucleic acid comprises or further comprises an RNAi. In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the nucleic acid is a DNA plasmid. In some embodiments, the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1). In some embodiments, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker comprises a polyglycine linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG linker moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG linker moiety is a linear PEG. In some embodiments, the PEG linker moiety is a branched PEG. In some embodiments, the linker comprises a O-Alanine. In some embodiments, the linker comprises at least about two, three, or four glycines, optionally continuous glycines. In some embodiments, the linker further comprises a serine. In some embodiments, the linker comprises a GGGGS or SGGGG sequence. In some embodiments, the linker comprises a Glycine-O-Alanine motif. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group.

    [0087] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is a VEPEP-3 peptide, wherein the cargo molecule does not comprise a virus. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is a VEPEP-3 peptide, wherein the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is a VEPEP-3 peptide, wherein the cargo molecule is a nucleic acid. In some embodiments, the nucleic acid is selected from the group consisting of an iRNA (such as an siRNA, an miRNA, or a shRNA), a gRNA, an mRNA, a DNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the nucleic acid comprises an mRNA. In some embodiments, the nucleic acid comprises or further comprises an RNAi. In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the nucleic acid is a DNA plasmid. In some embodiments, the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1). In some embodiments, the VEPEP-3 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker comprises a polyglycine linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid). Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG linker moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG linker moiety is a linear PEG. In some embodiments, the PEG linker moiety is a branched PEG. In some embodiments, the linker comprises a β-Alanine. In some embodiments, the linker comprises at least about two, three, or four glycines, optionally continuous glycines. In some embodiments, the linker further comprises a serine. In some embodiments, the linker comprises a GGGGS or SGGGG sequence. In some embodiments, the linker comprises a Glycine-β-Alanine motif. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group.

    [0088] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK. GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is a VEPEP-6 peptide, wherein the cargo molecule does not comprise a virus. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is a VEPEP-6 peptide, wherein the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is a VEPEP-6 peptide, wherein the cargo molecule is a nucleic acid. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the nucleic acid is selected from the group consisting of an iRNA (such as an siRNA, an miRNA, or a shRNA), a gRNA, an mRNA, a DNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the nucleic acid comprises an mRNA. In some embodiments, the nucleic acid comprises or further comprises an RNAi. In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the nucleic acid is a DNA plasmid. In some embodiments, the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1). In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker comprises a polyglycine linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG linker moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG linker moiety is a linear PEG. In some embodiments, the PEG linker moiety is a branched PEG. In some embodiments, the linker comprises a β-Alanine. In some embodiments, the linker comprises at least about two, three, or four glycines, optionally continuous glycines. In some embodiments, the linker further comprises a serine. In some embodiments, the linker comprises a GGGGS or SGGGG sequence. In some embodiments, the linker comprises a Glycine-β-Alanine motif. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group.

    [0089] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is a VEPEP-9 peptide, wherein the cargo molecule does not comprise a virus. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is a VEPEP-9 peptide, wherein the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR, wherein the cell-penetrating peptide is a VEPEP-9 peptide, wherein the cargo molecule is a nucleic acid. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the nucleic acid is selected from the group consisting of an iRNA (such as an siRNA, an miRNA, or a shRNA), a gRNA, an mRNA, a DNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the nucleic acid comprises an mRNA. In some embodiments, the nucleic acid comprises or further comprises an RNAi. In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the nucleic acid is a DNA plasmid. In some embodiments, the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1). In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker comprises a polyglycine linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the molecular weight of the PEG linker moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG linker moiety is a linear PEG. In some embodiments, the PEG linker moiety is a branched PEG. In some embodiments, the linker comprises a O-Alanine. In some embodiments, the linker comprises at least about two, three, or four glycines, optionally continuous glycines. In some embodiments, the linker further comprises a serine. In some embodiments, the linker comprises a GGGGS or SGGGG sequence. In some embodiments, the linker comprises a Glycine-β-Alanine motif. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group.

    [0090] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of YIGSR, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiments, the cargo molecule does not comprise a virus. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0091] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of YIGSR, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker, and wherein the linker comprises at least about two, three, or four glycines. In some embodiments, the linker consists of two, three or four glycines. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiments, the cargo molecule does not comprise a virus. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0092] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of GYVS, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker, and wherein the linker comprises at least about two, three, or four glycines. In some embodiments, the linker consists of two, three or four glycines. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiments, the cargo molecule does not comprise a virus. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0093] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of YIGSR, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker, and wherein the linker comprises a Ma (5-amino pentanoic acid) moiety. In some embodiments, the Ava moiety further comprises a methylene group (i.e., CH2). In some embodiments, the Ava moiety comprises at least about two CH2. In some embodiments, the Ava moiety has two CH2. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiments, the cargo molecule does not comprise a virus. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0094] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of GYVS, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker, and wherein the linker comprises a Ava (5-amino pentanoic acid) moiety. In some embodiments, the Ava moiety further comprises a methylene group (i.e., CH2). In some embodiments, the Ava moiety comprises at least about two CH2. In some embodiments, the Ava moiety has two CH2. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiments, the cargo molecule does not comprise a virus. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0095] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of YIGSR, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker, and wherein the linker comprises a Aun (11-amino-undecanoic acid) moiety. In some embodiments, the Ava moiety further comprises a methylene group (i.e., CH2). In some embodiments, the Ava moiety comprises at least one CH2 (such as at least two, three, four, five or six). In some embodiments, the Ava moiety has about one to ten (such as about four to eight, about five to seven, or six) CH2. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiments, the cargo molecule does not comprise a virus. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0096] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of GYVS, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker, and wherein the linker comprises a Aun (11-amino-undecanoic acid) moiety. In some embodiments, the Ava moiety further comprises a methylene group (i.e., CH2). In some embodiments, the Ava moiety comprises at least one CH2 (such as at least two, three, four, five or six). In some embodiments, the Ava moiety has about one to ten (such as about four to eight, about five to seven, or six) CH2. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiments, the cargo molecule does not comprise a virus. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0097] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of GYVS or YIGSR, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker comprising a PEG linker moiety. In some embodiments, the targeting sequence comprises or consists of YIGSR. In some embodiments, the targeting sequence comprises or consists of GYVS. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the PEG linker moiety consists of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 ethylene glycol units. In some embodiments, the molecular weight of the PEG linker moiety is about 0.05 kDa to about 0.5 kDa (such as about 0.05-0.1, 0.05-0.4, 0.1-0.3, 0.05-0.25, 0.25-0.5 kDa). In some embodiments, the PEG linker moiety is a linear PEG. In some embodiments, the PEG linker moiety is a branched PEG. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiments, the cargo molecule does not comprise a virus. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0098] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of GYVS or YIGSR, wherein the peptide comprises a sequence selected from the group consisting of SEQ ID NO: 88, 89, 94-99, 101-112.

    [0099] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of SYTSSTM, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the targeting sequence is linked to N-terminus of the cell-penetrating peptide via a linker moiety. In some embodiments, the linker moiety is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiment, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiment, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1540, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 115, 128, 131, and 132. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0100] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of CKTRRVP, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the targeting sequence is linked to N-terminus of the cell-penetrating peptide via a linker moiety. In some embodiments, the linker moiety is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiment, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiment, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the cell-penetrating peptide comprises the amino acid sequence set forth in SEQ ID NOs: 134 or 137. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0101] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of THRPPNWSPV, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the targeting sequence is linked to N-terminus of the cell-penetrating peptide via a linker moiety. In some embodiments, the linker moiety is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiment, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiment, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the cell-penetrating peptide comprises the amino acid sequence set forth in SEQ ID NOs: 133 or 138. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0102] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of TGNYKALHPDHNG, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the targeting sequence is linked to N-terminus of the cell-penetrating peptide via a linker moiety. In some embodiments, the linker moiety is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiment, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiment, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1540, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the cell-penetrating peptide comprises the amino acid sequence set forth in SEQ ID NOs: 122 or 123. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0103] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of CARPAR, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the targeting sequence is linked to N-terminus of the cell-penetrating peptide via a linker moiety. In some embodiments, the linker moiety is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiment, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiment, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the cell-penetrating peptide comprises the amino acid sequence set forth in SEQ ID NOs: 121 or 139. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0104] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of ASSLNIA, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the targeting sequence is linked to N-terminus of the cell-penetrating peptide via a linker moiety. In some embodiments, the linker moiety is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiment, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiment, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the cell-penetrating peptide comprises the amino acid sequence set forth in SEQ ID NOs: 113. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0105] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of LSSRLDA, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the targeting sequence is linked to N-terminus of the cell-penetrating peptide via a linker moiety. In some embodiments, the linker moiety is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiment, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiment, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1540, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the cell-penetrating peptide comprises the amino acid sequence set forth in SEQ ID NOs: 114. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0106] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of KSYDTY, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the targeting sequence is linked to N-terminus of the cell-penetrating peptide via a linker moiety. In some embodiments, the linker moiety is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiment, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiment, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the cell-penetrating peptide comprises the amino acid sequence set forth in SEQ ID NOs: 116 or 119. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0107] In some embodiments, there is provided a cargo delivery complex for intracellular delivery of a cargo molecule comprising a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence comprising a sequence of CKRAV, wherein the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the peptide further comprises an acetyl group linked to the N-terminus of the targeting sequence. In some embodiments, the targeting sequence is linked to N-terminus of the cell-penetrating peptide via a linker moiety. In some embodiments, the linker moiety is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety. Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-6 peptide. In some embodiment, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiment, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the cell-penetrating peptide comprises the amino acid sequence set forth in SEQ ID NOs: 117. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex. In some embodiments, the cargo molecule is a nucleic acid selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof.

    [0108] In some embodiments, the average diameter of the cargo delivery complex is between about 20 nm and about 1000 nm (such as about 20 to about 500 nm, about 50 to about 400 nm, about 60 to about 300 nm, about 80 to about 200 nm, or about 100 to about 160 nm).

    [0109] In some embodiments, the cell-penetrating peptide further comprises one or more moieties selected from the group consisting of an acetyl group, a stearyl group, a fatty acid, a cholesterol, a nuclear localization signal, a nuclear export signal, an antibody or antibody fragment thereof, a peptide, and a polysaccharide, wherein the one or more moieties are covalently linked to the N-terminus of the cell-penetrating peptide. In some embodiments, the one or more moieties is covalently linked to the N-terminus of the cell-penetrating peptide via a second linker. In some embodiments, the one or more moiety comprises or consists of a stearyl group.

    [0110] In some embodiments, the peptide further comprises one or more moieties selected from the group consisting of a cysteamide, a cysteine, a thiol, an amide, a nitrilotriacetic acid optionally substituted, a carboxyl, a linear or ramified C.sub.1-C.sub.6 alkyl optionally substituted, a primary or secondary amine, an osidic derivative, a lipid, a phospholipid, a fatty acid, a cholesterol, a nuclear localization signal, nuclear export signal, an antibody, and a polysaccharide, wherein the one or more moieties are covalently linked to the C-terminus of the cell-penetrating peptide. In some embodiments, the one or more moieties is covalently linked to the C-terminus of the cell-penetrating peptide via a second linker. In some embodiments, the one or more moiety comprises or consists of a stearyl group.

    [0111] In some embodiments, the peptide is a retro-inverso peptide. In some embodiments, the retro-inverso peptide comprises a sequence of SEQ ID NO: 85 or 86.

    [0112] In some embodiments, the peptide comprises a sequence of SED ID NOs: 1-112.

    [0113] In some embodiments, cell-penetrating peptides described herein are complexed with the one or more cargo molecules. In some embodiments, the cell-penetrating peptides are non-covalently complexed with at least one of the one or more cargo molecules. In some embodiments, the cell-penetrating peptides are non-covalently complexed with each of the one or more cargo molecules. In some embodiments, the cell-penetrating peptides are covalently complexed with at least one of the one or more cargo molecule. In some embodiments, the cell-penetrating peptides are covalently complexed with each of the one or more cargo molecules.

    Cell-Penetrating Peptides

    [0114] Cell Penetrating Peptides (CPP) are one of the promising non-viral strategies. Although definition of CPPs is constantly evolving, they are generally described as short peptides of less than 30 amino acids either derived from proteins or from chimeric sequences. They are usually amphipathic and possess a net positive charge (Langel U (2007) Handbook of Cell-Penetrating Peptides (CRC Taylor & Francis, Boca Raton); Heitz et al. (2009) Br J Pharmacol 157, 195-206). CPPs are able to penetrate biological membranes, to trigger the movement of various biomolecules across cell membranes into the cytoplasm and to improve their intracellular routing, thereby facilitating interactions with the target. CPPs can be subdivided into two main classes, the first requiring chemical linkage with the cargo and the second involving the formation of stable, non-covalent complexes. CPPs from both strategies have been reported to favour the delivery of a large panel of cargos (plasmid DNA, oligonucleotide, siRNA, PNA, protein, peptide, liposome, nanoparticle . . . ) into a wide variety of cell types and in vivo models (Langel U (2007) Handbook of Cell-Penetrating Peptides (CRC Taylor & Francis, Boca Raton); Heitz et al. (2009) Br J Pharnacol 157, 195-206; Mickan et al. (2014) Curr Pharm Biotechnol 15, 200-209; Shukla et al. (2014)Mol Pharm 11, 3395-3408).

    [0115] The concept of protein transduction domain (PTD) was initially proposed based on the observation that some proteins, mainly transcription factors, could shuttle within cells and from one cell to another (for review see Langel U (2007) Handbook of Cell-Penetrating Peptides (CRC Taylor & Francis, Boca Raton); Heitz et al. (2009) Br J Pharmacol 157, 195-206). The first observation was made in 1988, by Frankel and Pabo. They showed that the transcription-transactivating (Tat) protein of HIV-1 could enter cells and translocate into the nucleus. In 1991, the group of Prochiantz reached the same conclusions with the Drosophila Antennapedia homeodomain and demonstrated that this domain was internalized by neuronal cells. These works were at the origin of the discovery in 1994 of the first Protein Transduction Domain: a 16 mer-peptide derived from the third helix of the homeodomain of Antennapedia named Penetratin. In 1997, the group of Lebleu identified the minimal sequence of Tat required for cellular uptake, and the first proofs-of-concept of the application of PTD in vivo were reported by the group of Dowdy for the delivery of small peptides and large proteins (Gump J M, and Dowdy S F (2007) Trends Mol Med 13, 443-448.). Historically, the notion of Cell Penetrating Peptide (CPP) was introduced by the group of Langel, in 1998, with the design of the first chimeric peptide carrier, the Transportan, which derived from the N-terminal fragment of the neuropeptide galanin, linked to mastoparan, a wasp venom peptide. Transportan has been originally reported to improve the delivery of PNAs (peptide nucleic acids) both in cultured cells and in vivo (Langel U (2007) Handbook of Cell-Penetrating Peptides (CRC Taylor & Francis. Boca Raton)). In 1997, the group of Heitz and Divita proposed a new strategy involving CPP in the formation of stable but non-covalent complexes with their cargo (Morris et al. (1997) Nucleic Acids Res 25, 2730-2736). The strategy was first based on the short peptide carrier (MPG) consisting of two domains: a hydrophilic (polar) domain and a hydrophobic (apolar) domain. MPG was designed for the delivery of nucleic acids. The primary amphipathic peptide Pep-1 was then proposed for non-covalent delivery of proteins and peptides (Morris et al. (2001) Nat Biotechnol 19, 1173-1176). Then the groups of Wender and of Futaki demonstrated that polyarginine sequences (Arg8) are sufficient to drive small and large molecules into cells and in vivo (Nakase et al. (2004) Mol Ther 10, 1011-1022; Rothbard et al. (2004) J Am Chem Soc 126, 9506-9507). Ever since, many CPPs derived from natural or unnatural sequences have been identified and the list is constantly increasing. Peptides have been derived from VP22 protein of Herpes Simplex Virus, from calcitonin, from antimicrobial or toxin peptides, from proteins involved in cell cycle regulation, as well as from polyproline-rich peptides (Heitz et al. (2009) Br J Pharmacol 157, 195-206). More recently, a new non-covalent strategy based on secondary amphipathic CPPs has been described. These peptides such as CADY and VEPEP-families are able to self-assemble in a helical shape with hydrophilic and hydrophobic residues on different side of the molecule. WO2014/053879 discloses VEPEP-3 peptides; WO2014/053881 discloses VEPEP-4 peptides; WO2014/053882 discloses VEPEP-5 peptides; WO2012/137150 discloses VEPEP-6 peptides; WO2014/053880 discloses VEPEP-9 peptides; WO 2016/102687 discloses ADGN-100 peptides; US2010/0099626 discloses CADY peptides; and U.S. Pat. No. 7,514,530 discloses MPG peptides; the disclosures of which are hereby incorporated herein by reference in their entirety.

    [0116] The cell-penetrating peptides in the cargo delivery complexes or nanoparticles of the present invention are capable of forming stable complexes and nanoparticles with various cargos. Any of the cell-penetrating peptides in any of the cargo delivery complexes or nanoparticles described herein may comprise or consist of any of the cell-penetrating peptide sequences described in this section.

    [0117] In some embodiments, a cargo delivery complex or nanoparticle described herein comprises a cell-penetrating peptide selected from the group consisting of CADY, PEP-1, PEP-2, MPG, VEPEP-3 peptides (used herein interchangeably with ADGN-103 peptides), VEPEP-4 peptides (used herein interchangeably with ADGN-104 peptides), VEPEP-5 peptides (used herein interchangeably with ADGN-105 peptides), VEPEP-6 peptides (used herein interchangeably with ADGN-106 peptides), VEPEP-9 peptides (used herein interchangeably with ADGN-109 peptides), and ADGN-100 peptides. In some embodiments, the cell-penetrating peptide is present in a cargo delivery complex. In some embodiments, the cell-penetrating peptide is present in a cargo delivery complex present in the core of a nanoparticle. In some embodiments, the cell-penetrating peptide is present in the core of a nanoparticle. In some embodiments, the cell-penetrating peptide is present in the core of a nanoparticle and is associated with a cargo molecule. In some embodiments, the cell-penetrating peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the cell-penetrating peptide is present in the surface layer of a nanoparticle. In some embodiments, the cell-penetrating peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent. In some embodiments, the covalent linkage is by chemical coupling. In some embodiments, the covalent linkage is by genetic methods. WO2014/053879 discloses VEPEP-3 peptides; WO2014/053881 discloses VEPEP-4 peptides; WO2014/053882 discloses VEPEP-5 peptides; WO2012/137150 discloses VEPEP-6 peptides; WO2014/053880 discloses VEPEP-9 peptides; WO 2016/102687 discloses ADGN-100 peptides; US2010/0099626 discloses CADY peptides; and U.S. Pat. No. 7,514,530 discloses MPG peptides; the disclosures of which are hereby incorporated herein by reference in their entirety.

    VEPEP-3 Peptides

    [0118] In some embodiments, a cargo delivery complex or nanoparticle described herein comprises a VEPEP-3 cell-penetrating peptide comprising the amino acid sequence X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.2X.sub.3X.sub.4X.sub.6X.sub.7X.sub.3X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13 (SEQ ID NO: 1), wherein X.sub.1 is beta-A or S, X.sub.2 is K, R or L (independently from each other), X.sub.3 is F or W (independently from each other), X.sub.4 is F, W or Y (independently from each other), X.sub.5 is E, R or S, X.sub.6 is R, T or S. X.sub.7 is E, R, or S. X.sub.8 is none, F or W, X.sub.9 is P or R, X.sub.10 is R or L, X.sub.11 is K, W or R, X.sub.12 is R or F, and X.sub.13 is R or K. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence X.sub.1X.sub.2WX.sub.4EX.sub.2WX.sub.4X.sub.6X.sub.7X.sub.3PRX.sub.11RX.sub.13 (SEQ ID NO: 2), wherein X.sub.1 is beta-A or S, X.sub.2 is K, R or L, X.sub.3 is F or W, X.sub.4 is F, W or Y, X.sub.5 is E, R or S, X.sub.6 is R, T or S, X.sub.7 is E, R, or S, X.sub.5 is none, F or W, X.sub.9 is P or R, X.sub.10 is R or L, X.sub.11 is K, W or R, X.sub.12 is R or F, and X.sub.13 is R or K. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence X.sub.1KWFERWFREWPRKRR (SEQ ID NO: 3), X.sub.1KWWERWWREWPRKRR (SEQ ID NO: 4), X.sub.1KWWERWWREWPRKRK (SEQ ID NO: 5), X.sub.1RWWEKWWTRWPRKRK (SEQ ID NO: 6), or X.sub.1RWYEKWYTEFPRRRR (SEQ ID NO: 7), wherein X.sub.1 is beta-A or S. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-7, wherein the cell-penetrating peptide is modified by replacement of the amino acid in position 10 by a non-natural amino acid, addition of a non-natural amino acid between the amino acids in positions 2 and 3, and addition of a hydrocarbon linkage between the two non-natural amino acids. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence X.sub.1KX.sub.14WWERWWRX.sub.14WPRKRK (SEQ ID NO: 8), wherein X.sub.1 is beta-A or S and X.sub.14 is a non-natural amino acid, and wherein there is a hydrocarbon linkage between the two non-natural amino acids. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence X.sub.1X.sub.2X.sub.3WXSX.sub.10X.sub.3WX.sub.6X.sub.7WX.sub.8X.sub.9X.sub.10WX.sub.12R (SEQ ID NO: 9), wherein X.sub.1 is beta-A or S. X.sub.2 is K, R or L, X.sub.3 is F or W, X.sub.5 is R or S, X.sub.6 is R or S, X.sub.7 is R or S, X.sub.8 is F or W, X.sub.9 is R or P, X.sub.10 is L or R, and X.sub.12 is R or F. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence X.sub.1RWWRLWWRSWFRLWRR (SEQ ID NO: 10), X.sub.1LWWRRWWSRWWPRWRR (SEQ ID NO: 11), X.sub.1LWWSRWWRSWFRLWFR (SEQ ID NO: 12), or X.sub.1KFWSRFWRSWFRLWRR (SEQ ID NO: 13), wherein X.sub.1 is beta-A or S. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1 and 9-13, wherein the cell-penetrating peptide is modified by replacement of the amino acids in position 5 and 12 by non-natural amino acids, and addition of a hydrocarbon linkage between the two non-natural amino acids. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence X.sub.1RWWX.sub.14LWWRSWX.sub.14RLWRR (SEQ ID NO: 14), wherein X.sub.1 is a beta-alanine or a serine and X.sub.14 is a non-natural amino acid, and wherein there is a hydrocarbon linkage between the two non-natural amino acids. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence set forth in SEQ ID NO: 75 or SEQ ID NO: 76. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence of SEQ ID NO: 113. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence of SEQ ID NO: 114. In some embodiments, the VEPEP-3 peptide comprises the amino acid sequence of SEQ ID NO: 115. In some embodiments, the VEPEP-3 peptide is present in a cargo delivery complex. In some embodiments, the VEPEP-3 peptide is present in a cargo delivery complex in the core of a nanoparticle. In some embodiments, the VEPEP-3 peptide is present in the core of a nanoparticle. In some embodiments, the VEPEP-3 peptide is present in the core of a nanoparticle and is associated with a cargo. In some embodiments, the VEPEP-3 peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the VEPEP-3 peptide is present in the surface layer of a nanoparticle. In some embodiments, the VEPEP-3 peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent. In some embodiments, the covalent linkage is by chemical coupling. In some embodiments, the covalent linkage is by genetic methods.

    VEPEP-6 Peptides

    [0119] In some embodiments, a cargo delivery complex or nanoparticle described herein comprises a VEPEP-6 cell-penetrating peptide. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of X.sub.1LX.sub.2RALWX.sub.9LX.sub.3X.sub.9X.sub.4LWX.sub.9LX.sub.5X.sub.6X.sub.7X.sub.8 (SEQ ID NO: 15), X.sub.1LX.sub.2LARWX.sub.9LX.sub.3X.sub.9X.sub.4LWX.sub.9LX.sub.5X.sub.6X.sub.7X.sub.8 (SEQ ID NO: 16) and X.sub.1LX.sub.2ARLWX.sub.9LX.sub.3X.sub.9X.sub.4LWX.sub.9LX.sub.5X.sub.6X.sub.7X.sub.8 (SEQ ID NO: 17), wherein X.sub.1 is beta-A or S. X.sub.2 is F or W. X.sub.3 is L, W, C or I, X.sub.4 is S, A, N or T, X.sub.5 is L or W, X.sub.6 is W or R, X.sub.7 is K or R, X.sub.8 is A or none, and X.sub.9 is R or S. In some embodiments, the VEPEP-6 peptide comprises the amino acid sequence X.sub.1LX.sub.2RALWRLX.sub.3RX.sub.4LWRLX.sub.5XX.sub.7X.sub.8 (SEQ ID NO: 18), wherein X.sub.1 is beta-A or S, X.sub.2 is F or W, X.sub.3 is L, W, C or I, X.sub.4 is S, A, N or T, X.sub.5 is L or W, X.sub.6 is W or R, X, is K or R, and X.sub.8 is A or none. In some embodiments, the VEPEP-6 peptide comprises the amino acid sequence X.sub.1LX.sub.2RALWRLX.sub.3RX.sub.4LWRLX.sub.5X.sub.6KX.sub.7 (SEQ ID NO: 19), wherein X.sub.1 is beta-A or S, X.sub.2 is F or W, X.sub.3 is L or W, X.sub.4 is S, A or N, X.sub.5 is L or W, X.sub.6 is W or R, X.sub.7 is A or none. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of X.sub.1LFRALWRLLRX.sub.2LWRLLWX.sub.3 (SEQ ID NO: 20), X.sub.1LWRALWRLWRX.sub.2LWRLLWX.sub.3A (SEQ ID NO: 21), X.sub.1LWRALWRLX.sub.4RX.sub.2LWRLWRX.sub.3A (SEQ ID NO: 22), X.sub.1LWRALWRLWRX.sub.2LWRLWRX.sub.3A (SEQ ID NO: 23), X.sub.1LWRALWRLX.sub.5RALWRLLWX.sub.3A (SEQ ID NO: 24), and X.sub.1LWRALWRLX.sub.4RNLWRLLWX.sub.3A (SEQ ID NO: 25), wherein X.sub.1 is beta-A or S, X.sub.2 is S or T, X.sub.3 is K or R, X.sub.4 is L. C or I and X.sub.5 is L or I. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of Ac-X.sub.1LFRALWRLLRSLWRLLWK-cysteamide (SEQ ID NO: 26), Ac-X.sub.1LWRALWRLWRSLWRLLWKA-cysteamide (SEQ ID NO: 27), Ac-X.sub.1LWRALWRLLRSLWRLWRKA-cysteamide (SEQ ID NO: 28), Ac-X.sub.1LWRALWRLWRSLWRLWRKA-cysteamide (SEQ ID NO: 29), Ac-X.sub.1LWRALWRLLRALWRLLWKA-cysteamide (SEQ ID NO: 30), and Ac-X.sub.1LWRALWRLLRNLWRLLWKA-cysteamide (SEQ ID NO: 31), wherein X.sub.1 is beta-A or S. In some embodiments, the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-31, further comprising a hydrocarbon linkage between two residues at positions 8 and 12. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of Ac-X.sub.1LFRALWR.sub.SLLRS.sub.SLWRLLWK-cysteamide (SEQ ID NO: 32), Ac-X.sub.1LFLARWR.sub.SLLRS.sub.SLWRLLWK-cysteamide (SEQ ID NO: 33), Ac-X.sub.1LFRALWS.sub.SLLRS.sub.SLWRLLWK-cysteamide (SEQ ID NO: 34), Ac-X.sub.1LFLARWS.sub.SLLRS.sub.SLWRLLWK-cysteamide (SEQ ID NO: 35), Ac-X.sub.1LFRALWRLLR.sub.SSLWS.sub.SLLWK-cysteamide (SEQ ID NO: 36), Ac-X.sub.1LFLARWRLLR.sub.SSLWS.sub.SLLWK-cysteamide (SEQ ID NO: 37), Ac-X.sub.1LFRALWRLLS.sub.SSLWS.sub.SLLWK-cysteamide (SEQ ID NO: 38). Ac-X.sub.1LFLARWRLLS.sub.SSLWS.sub.SLLWK-cysteamide (SEQ ID NO: 39), and Ac-X.sub.1LFAR.sub.SLWRLLRS.sub.SLWRLLWK-cysteamide (SEQ ID NO: 40), wherein X.sub.1 is beta-A or S and wherein the residues followed by an inferior “S” are those which are linked by said hydrocarbon linkage. In some embodiments, the VEPEP-6 peptide comprises the amino acid sequence of SEQ ID NO: 77. In some embodiments, the VEPEP-6 peptide comprises the amino acid sequence of SEQ ID NO: 85. In some embodiments, the VEPEP-6 peptide comprises the amino acid sequence of SEQ ID NO: 92 or 93. In some embodiments, the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 94-100, 105, 107-109, and 129-139. In some embodiments, the VEPEP-6 peptide is present in a cargo delivery complex. In some embodiments, the VEPEP-6 peptide is present in a cargo delivery complex in the core of a nanoparticle. In some embodiments, the VEPEP-6 peptide is present in the core of a nanoparticle. In some embodiments, the VEPEP-6 peptide is present in the core of a nanoparticle and is associated with a cargo. In some embodiments, the VEPEP-6 peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the VEPEP-6 peptide is present in the surface layer of a nanoparticle. In some embodiments, the VEPEP-6 peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent. In some embodiments, the covalent linkage is by chemical coupling. In some embodiments, the covalent linkage is by genetic methods.

    VEPEP-9 Peptides

    [0120] In some embodiments, a cargo delivery complex or nanoparticle described herein comprises a VEPEP-9 cell-penetrating peptide comprising the amino acid sequence X.sub.1X.sub.2X.sub.3WWX.sub.4X.sub.5WAX.sub.6X.sub.3X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12WX.sub.13R (SEQ ID NO: 41), wherein X.sub.1 is beta-A or S, X.sub.2 is L or none, X.sub.3 is R or none, X.sub.4 is L, R or G, X.sub.5 is R, W or S, X.sub.6 is S, P or T, X.sub.7 is W or P, X.sub.8 is F, A or R, X.sub.9 is S, L, P or R, X.sub.10 is R or S, X.sub.11 is W or none, X.sub.12 is A, R or none and X.sub.13 is W or F, and wherein if X.sub.3 is none, then X.sub.2, X.sub.11 and X.sub.12 are none as well. In some embodiments, the VEPEP-9 peptide comprises the amino acid sequence X.sub.1X.sub.2RWWLRWAX.sub.6RWX.sub.8X.sub.9X.sub.10WX.sub.12WX.sub.13R (SEQ ID NO: 42), wherein X.sub.1 is beta-A or S. X.sub.2 is L or none, X.sub.6 is S or P, X.sub.8 is F or A, X.sub.9 is S, L or P, X.sub.10 is R or S, X.sub.1 is A or R, and X.sub.13 is W or F. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of X.sub.1LRWWLRWASRWFSRWAWWR (SEQ ID NO: 43), X.sub.1LRWWLRWASRWASRWAWFR (SEQ ID NO: 44), X.sub.1RWWLRWASRWALSWRWWR (SEQ ID NO: 45), X.sub.1RWWLRWASRWFLSWRWWR (SEQ ID NO: 46), X.sub.1RWWLRWAPRWFPSWRWWR (SEQ ID NO: 47), and X.sub.1RWWLRWASRWAPSWRWWR (SEQ ID NO: 48), wherein X.sub.1 is beta-A or S. In some embodiments, the VEPEP-9 peptide comprises the amino acid sequence of X.sub.1WWX.sub.4X.sub.5WAX.sub.6X.sub.7X.sub.8RX.sub.10WWR (SEQ ID NO: 49), wherein X.sub.1 is beta-A or S, X.sub.4 is R or G, X.sub.5 is W or S, X.sub.6 is S. T or P, X.sub.7 is W or P, X.sub.1 is A or R. and X.sub.10 is S or R. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of X.sub.1WWRWWASWARSWWR (SEQ ID NO: 50), X.sub.1WWGSWATPRRRWWR (SEQ ID NO: 51), and X.sub.1WWRWWAPWARSWWR (SEQ ID NO: 52), wherein X.sub.1 is beta-A or S. In some embodiments, the VEPEP-9 peptide comprises the amino acid sequence set forth in SEQ ID NO: 78. In some embodiments, the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 116-120. In some embodiments, the VEPEP-9 peptide is present in a cargo delivery complex. In some embodiments, the VEPEP-9 peptide is present in a cargo delivery complex in the core of a nanoparticle. In some embodiments, the VEPEP-9 peptide is present in the core of a nanoparticle. In some embodiments, the VEPEP-9 peptide is present in the core of a nanoparticle and is associated with a cargo. In some embodiments, the VEPEP-9 peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the VEPEP-9 peptide is present in the surface layer of a nanoparticle. In some embodiments, the VEPEP-9 peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent. In some embodiments, the covalent linkage is by chemical coupling. In some embodiments, the covalent linkage is by genetic methods.

    ADGN-100 Peptides

    [0121] In some embodiments, a cargo delivery complex or nanoparticle described herein comprises an ADGN-100 cell-penetrating peptide comprising the amino acid sequence X.sub.1KWRSX.sub.2X.sub.3X.sub.4RWRLWRX.sub.5X.sub.6X.sub.7X.sub.8SR (SEQ ID NO: 53), wherein X.sub.1 is any amino acid or none, and X.sub.2-X.sub.8 are any amino acid. In some embodiments, the ADGN-100 peptide comprises the amino acid sequence X.sub.1KWRSX.sub.2X.sub.3X.sub.4RWRLWRX.sub.5X.sub.6X.sub.7X.sub.8SR (SEQ ID NO: 54), wherein X.sub.1 is βA, S, or none, X.sub.2 is A or V, X.sub.3 is or L, X.sub.4 is W or Y, X.sub.5 is V or S, X.sub.6 is R, V, or A, X.sub.7 is S or L, and X.sub.8 is W or Y. In some embodiments, the ADGN-100 peptide comprises the amino acid sequence KWRSAGWRWRLWRVRSWSR (SEQ ID NO: 55), KWRSALYRWRLWRVRSWSR (SEQ ID NO: 56), KWRSALYRWRLWRSRSWSR (SEQ ID NO: 57), or KWRSALYRWRLWRSALYSR (SEQ ID NO: 58). In some embodiments, the ADGN-100 peptide comprises two residues separated by three or six residues that are linked by a hydrocarbon linkage. In some embodiments, the ADGN-100 peptide comprises the amino acid sequence KWRS.sub.SAGWR.sub.SWRLWRVRSWSR (SEQ ID NO: 59), KWR.sub.SSAGWRWR.sub.SLWRVRSWSR (SEQ ID NO: 60), KWRSAGWR.sub.SWRLWRVR.sub.SSWSR (SEQ ID NO: 61), KWRS.sub.SALYR.sub.SWRLWRSRSWSR (SEQ ID NO: 62), KWR.sub.SSALYRWR.sub.SLWRSRSWSR (SEQ ID NO: 63), KWRSALYR.sub.SWRLWRSR.sub.SSWSR (SEQ ID NO: 64). KWRSALYRWR.sub.SLWRS.sub.SRSWSR (SEQ ID NO: 65), KWRSALYRWRLWRS.sub.SRSWS.sub.SR (SEQ ID NO: 66), KWR.sub.SSALYRWR.sub.SLWRSALYSR (SEQ ID NO: 67), KWRS.sub.SALYR.sub.SWRLWRSALYSR (SEQ ID NO: 68), KWRSALYRWR.sub.SLWRS.sub.SALYSR (SEQ ID NO: 69), or KWRSALYRWRLWRS.sub.SALYS.sub.SR (SEQ ID NO: 70), wherein the residues marked with a subscript “S” are linked by a hydrocarbon linkage. In some embodiments, the ADGN-100 peptide comprises the amino acid sequence set forth in SEQ ID NO: 79 or 80. In some embodiments, the ADGN-100 peptide comprises the amino acid sequence set forth in SEQ ID NO: 86. In some embodiments, the ADGN-100 peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 87-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the ADGN-100 peptide is present in a cargo delivery complex. In some embodiments, the ADGN-100 peptide is present in a cargo delivery complex in the core of a nanoparticle. In some embodiments, the ADGN-100 peptide is present in the core of a nanoparticle. In some embodiments, the ADGN-100 peptide is present in the core of a nanoparticle and is associated with a cargo. In some embodiments, the ADGN-100 peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the ADGN-100 peptide is present in the surface layer of a nanoparticle. In some embodiments, the ADGN-100 peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent. In some embodiments, the covalent linkage is by chemical coupling. In some embodiments, the covalent linkage is by genetic methods.

    VEPEP-4 Peptide

    [0122] In some embodiments, a genome-editing complex or nanoparticle described herein comprises a VEPEP-4 cell-penetrating peptide comprising the amino acid sequence XWXRLXXXXXX (SEQ ID NO: 140), wherein X in position 1 is beta-A or S; X in positions 3, 9 and 10 are, independently from each other, W or F; X in position 6 is R if X in position 8 is S, and X in position 6 is S if X in position 8 is R; X in position 7 is L or none; X in position 11 is R or none, and X in position 7 is L if X in position 11 is none. In some embodiments, the VEPEP-4 peptide comprises an amino acid sequence of any one of SEQ ID NOs: 141-144. In some embodiments, the VEPEP-4 peptide is present in a cargo delivery complex. In some embodiments, the VEPEP-4 peptide is present in a cargo delivery complex in the core of a nanoparticle. In some embodiments, the VEPEP-4 peptide is present in the core of a nanoparticle. In some embodiments, the VEPEP-4 peptide is present in the core of a nanoparticle and is associated with a cargo. In some embodiments, the VEPEP-4 peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the VEPEP-4 peptide is present in the surface layer of a nanoparticle. In some embodiments, the VEPEP-4 peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent. In some embodiments, the covalent linkage is by chemical coupling. In some embodiments, the covalent linkage is by genetic methods.

    VEPEP-5 Peptides

    [0123] In some embodiments, a genome-editing complex or nanoparticle described herein comprises a VEPEP-5 cell-penetrating peptide comprising the amino acid sequence RXWXRLWXRLR (SEQ ID NO: 145), wherein X in position 2 is R or S; and X in positions 4 and 8 are, independently from each other, W or F. In some embodiments, the VEPEP-5 peptide comprises an amino acid sequence of any one of SEQ ID NOs: 146-151. In some embodiments, the VEPEP-5 peptide is present in a cargo delivery complex. In some embodiments, the VEPEP-5 peptide is present in a cargo delivery complex in the core of a nanoparticle. In some embodiments, the VEPEP-5 peptide is present in the core of a nanoparticle. In some embodiments, the VEPEP-5 peptide is present in the core of a nanoparticle and is associated with a cargo. In some embodiments, the VEPEP-5 peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the VEPEP-5 peptide is present in the surface layer of a nanoparticle. In some embodiments, the VEPEP-5 peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent. In some embodiments, the covalent linkage is by chemical coupling. In some embodiments, the covalent linkage is by genetic methods.

    [0124] In some embodiments, the CPP described herein (e.g., PEP-1, PEP-2, VEPEP-3 peptide, VEPEP-6 peptide, VEPEP-9 peptide, or ADGN-100 peptide) further comprises one or more moieties linked to the N-terminus of the CPP. In some embodiments, the one or more moieties is covalently linked to the N-terminus of the CPP. In some embodiments, the one or more moieties are selected from the group consisting of an acetyl group, a stearyl group, a fatty acid, a cholesterol, a poly-ethylene glycol, a nuclear localization signal, a nuclear export signal, an antibody or antibody fragment thereof, a peptide, a polysaccharide, and a targeting molecule. In some embodiments, the one or more moieties is an acetyl group and/or a stearyl group. In some embodiments, the CPP comprises an acetyl group and/or a stearyl group linked to its N-terminus. In some embodiments, the CPP comprises an acetyl group linked to its N-terminus. In some embodiments, the CPP comprises a stearyl group linked to its N-terminus. In some embodiments, the CPP comprises an acetyl group and/or a stearyl group covalently linked to its N-terminus. In some embodiments, the CPP comprises an acetyl group covalently linked to its N-terminus. In some embodiments, the CPP comprises a stearyl group covalently linked to its N-terminus.

    [0125] In some embodiments, the CPP described herein (e.g., PEP-1, PEP-2, VEPEP-3 peptide, VEPEP-6 peptide, VEPEP-9 peptide, or ADGN-100 peptide) further comprises one or more moieties linked to the C-terminus of the CPP. In some embodiments, the one or more moieties is covalently linked to the C-terminus of the CPP. In some embodiments, the one or more moieties are selected from the group consisting of a cysteamide group, a cysteine, a thiol, an amide, a nitrilotriacetic acid, a carboxyl group, a linear or ramified CI-CG alkyl group, a primary or secondary amine, an osidic derivative, a lipid, a phospholipid, a fatty acid, a cholesterol, a poly-ethylene glycol, a nuclear localization signal, a nuclear export signal, an antibody or antibody fragment thereof, a peptide, a polysaccharide, and a targeting molecule. In some embodiments, the one or more moieties is a cysteamide group. In some embodiments, the CPP comprises a cysteamide group linked to its C-terminus. In some embodiments, the CPP comprises a cysteamide group covalently linked to its C-terminus.

    [0126] In some embodiments, the CPP described herein (e.g., PEP-1, PEP-2, VEPEP-3 peptide, VEPEP-6 peptide, VEPEP-9 peptide, or ADGN-100 peptide) is stapled. “Stapled” as used herein refers to a chemical linkage between two residues in a peptide. In some embodiments, the CPP is stapled, comprising a chemical linkage between two amino acids of the peptide. In some embodiments, the two amino acids linked by the chemical linkage are separated by 3 or 6 amino acids. In some embodiments, two amino acids linked by the chemical linkage are separated by 3 amino acids. In some embodiments, the two amino acids linked by the chemical linkage are separated by 6 amino acids. In some embodiments, each of the two amino acids linked by the chemical linkage is R or S. In some embodiments, each of the two amino acids linked by the chemical linkage is R. In some embodiments, each of the two amino acids linked by the chemical linkage is S. In some embodiments, one of the two amino acids linked by the chemical linkage is R and the other is S. In some embodiments, the chemical linkage is a hydrocarbon linkage.

    [0127] In some embodiments, the CPP is an L-peptide comprising L-amino acids. In some embodiments, the CPP is a retro-inverso peptide (e.g., a peptide made up of D-amino acids in a reversed sequence and, when extended, assumes a side chain topology similar to that of its parent molecule but with inverted amide peptide bonds).

    [0128] In some embodiments, the CPP described herein (e.g., PEP-1, PEP-2, VEPEP-3 peptide, VEPEP-6 peptide, VEPEP-9 peptide, or ADGN-100 peptide) further comprises one or more moieties. In some embodiments, the one or more moieties is conjugated to the N-terminus or the C-terminus of the CPP. In some embodiments, a first moiety is conjugated to the N-terminus of the CPP and a second moiety is conjugated to the C-terminus of the CPP.

    [0129] In some embodiments, the one or more moieties comprise a targeting molecule. In some embodiments, the targeting molecule is conjugated to the N-terminus or the C-terminus of the CPP. In some embodiments, a first targeting molecule is conjugated to the N-terminus of the CPP and a second targeting molecule is conjugated to the C-terminus of the CPP. In some embodiments, the targeting molecule comprises at least about 3, 4, or 5 amino acids. In some embodiments, the targeting molecule comprises no more than about 8, 7, 6, 5, or 4 amino acids. In some embodiments, the targeting molecule comprises about 3, 4, or 5 amino acids. In some embodiments, the targeting molecule comprises a sequence selected from the group consisting of GY, YV, VS, SK, GYV, YVS, VSK, GYVS, YVSK, YI, IG, GS, SR, YIG, IGS, GSR, YIGS, IGSR. In some embodiments, the sequence (e.g., a targeting sequence) is selected from the group consisting of GYVSK. GYVS. YIGS, and YIGSR.

    [0130] In some embodiments, the sequence (e.g., a targeting sequence) is selected from the group consisting of SEQ ID NOS: 152-162.

    [0131] In some embodiments, the targeting molecule is conjugated to the CPP via a linker. In some embodiments, the linker comprises a polyglycine linker. In some embodiments, the linker comprises a β-Alanine. In some embodiments, the linker comprises at least about two, three, or four glycines, optionally continuous glycines. In some embodiments, the linker further comprises a serine. In some embodiments, the linker comprises a GGGGS or SGGGG sequence. In some embodiments, the linker comprises a Glycine-β-Alanine motif.

    [0132] In some embodiments, the one or more moieties comprise a polymer (e.g., PEG, polylysine, PET). In some embodiments, the polymer is conjugated to the N-terminus or the C-terminus of the CPP. In some embodiments, a first polymer is conjugated to the N-terminus of the CPP and a second polymer is conjugated to the C-terminus of the CPP. In some embodiments, the polymer is a PEG. In some embodiments, the PEG is a linear PEG. In some embodiments, the PEG is a branched PEG. In some embodiments, the molecular weight of the PEG is no more than about 5 kDa, 10 kDa, 15 kDa, 20 kDa, 30 kDa, or 40 kDa. In some embodiments, the molecular weight of the PEG is at least about 5 kDa, 10 kDa, 15 kDa, 20 kDa, 30 kDa, or 40 kDa. In some embodiments, the molecular weight of the PEG is about 5 kDa to about 10 kDa, about 10 kDa to about 15 kDa, about 15 kDa to about 20 kDa, about 20 kDa to about 30 kDa, or about 30 kDa to about 40 kDa. In some embodiments, the molecular weight of the PEG is about 5 kDa, 10 kDa, 20 kDa, or 40 kDa. In some embodiments, the molecular weight of the PEG is selected from the group consisting of 5 kDa, 10 kDa, 20 kDa or 40 kDa. In some embodiments, the molecular weight of the PEG is about 5 kDa. In some embodiments, the molecular weight of the PEG is about 10 kDa. In some embodiments, the PEG comprises at least about 1, 2, or 3 ethylene glycol units. In some embodiments, the PEG comprises no more than about 3, 2, or 1 ethylene glycol units. In some embodiments, the PEG comprises about 1, 2, or 3 ethylene glycol units.

    Targeting Moiety

    [0133] In some embodiments, the cell-penetrating peptide comprises a targeting moiety. In some embodiments, the targeting moiety is conjugated to the N-terminus the CPP. In some embodiments, the targeting moiety is conjugated to the C-terminus the CPP. In some embodiments, a first targeting moiety is conjugated to the N-terminus of the CPP and a second targeting moiety is conjugated to the C-terminus of the CPP.

    [0134] In some embodiments, the targeting moiety comprises a targeting peptide that targets one or more organs. In some embodiments, the one or more organs are selected from the group consisting of muscle, heart, brain, spleen, lymph node, liver, lung, and kidney. In some embodiments, the targeting peptide targets brain. In some embodiments, the targeting peptide targets muscle. In some embodiments, the targeting peptide targets heart.

    [0135] In some embodiments, the targeting moiety comprises at least about 3, 4, or 5 amino acids. In some embodiments, the targeting moiety comprises no more than about 8, 7, 6, 5, or 4 amino acids. In some embodiments, the targeting moiety comprises about 3, 4, or 5 amino acids. In some embodiments, the targeting moiety comprises a sequence selected from the group consisting of GY, YV, VS, SK, GYV, YVS, VSK, GYVS, YVSK, YI, IG, GS, SR, YIG, IGS, GSR. YIGS, IGSR. In some embodiments, the sequence (e.g., a targeting sequence) is selected from the group consisting of GYVSK, GYVS, YIGS, and YIGSR.

    [0136] In some embodiments, the targeting moiety comprises a targeting sequence selected from the group consisting of SEQ ID NOs: 152-162. In some embodiments, the targeting moiety comprises a targeting sequence SYTSSTM (SEQ ID NO: 152). In some embodiments, the targeting moiety comprises a targeting sequence CKTRRVP (SEQ ID NO: 153). In some embodiments, the targeting moiety comprises a targeting sequence THRPPNWSPV (SEQ ID NO: 154). In some embodiments, the targeting moiety comprises a targeting sequence TGNYKALHPDHNG (SEQ ID NO: 155). In some embodiments, the targeting moiety comprises a targeting sequence CARPAR (SEQ ID NO: 156). In some embodiments, the targeting moiety comprises a targeting sequence ASSLNIA (SEQ ID NO: 159). In some embodiments, the targeting moiety comprises a targeting sequence LSSRLDA (SEQ ID NO: 160). In some embodiments, the targeting moiety comprises a targeting sequence KSYDTY (SEQ ID NO: 161). In some embodiments, the targeting moiety comprises a targeting sequence CKRAV (SEQ ID NO: 162).

    [0137] In some embodiments, the targeting moiety is conjugated to the CPP via a linker moiety such as any one of the linker moieties described herein.

    Linker Moiety

    [0138] In some embodiments, the cell-penetrating peptide comprise a linker moiety.

    [0139] In some embodiments, the linker moiety comprises a polyglycine linker. In some embodiments, the linker comprises a β-Alanine. In some embodiments, the linker comprises at least about two, three, or four glycines, optionally continuous glycines. In some embodiments, the linker further comprises a serine. In some embodiments, the linker comprises a GGGGS or SGGGG sequence. In some embodiments, the linker comprises a Glycine-O-Alanine motif.

    [0140] In some embodiments, the one or more moieties comprise a polymer (e.g., PEG, polylysine. PET). In some embodiments, the polymer is conjugated to the N-terminus of the CPP. In some embodiments, the polymer is conjugated to the C-terminus of the CPP. In some embodiments, a first polymer is conjugated to the N-terminus of the CPP and a second polymer is conjugated to the C-terminus of the CPP. In some embodiments, the polymer is a PEG. In some embodiments, the PEG is a linear PEG. In some embodiments, the PEG is a branched PEG. In some embodiments, the molecular weight of the PEG is no more than about 5 kDa, 10 kDa, 15 kDa, 20 kDa, 30 kDa, or 40 kDa. In some embodiments, the molecular weight of the PEG is at least about 5 kDa, 10 kDa, 15 kDa, 20 kDa, 30 kDa, or 40 kDa. In some embodiments, the molecular weight of the PEG is about 5 kDa to about 10 kDa, about 10 kDa to about 15 kDa, about 15 kDa to about 20 kDa, about 20 kDa to about 30 kDa, or about 30 kDa to about 40 kDa. In some embodiments, the molecular weight of the PEG is about 5 kDa, 10 kDa, 20 kDa, or 40 kDa. In some embodiments, the molecular weight of the PEG is selected from the group consisting of 5 kDa, 10 kDa, 20 kDa or 40 kDa. In some embodiments, the molecular weight of the PEG is about 5 kDa. In some embodiments, the molecular weight of the PEG is about 10 kDa. In some embodiments, the PEG comprises at least about 1, 2, or 3 ethylene glycol units. In some embodiments, the PEG consists of no more than about 10, 9, 8 or 7 ethylene glycol units. In some embodiments, the PEG consists of about 1, 2, or 3 ethylene glycol units. In some embodiments, the PEG moiety consists of about one to eight, or about two to seven ethylene glycol units.

    [0141] In some embodiments, the linker moiety is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker moiety comprises Aun (11-amino-undecanoic acid). In some embodiments, the linker moiety comprises Ava (5-amino pentanoic acid). In some embodiments, the linker moiety comprises Ahx (aminocaproic acid).

    Carbohydrate Moiety

    [0142] In some embodiments, the cell-penetrating peptide further comprises a carbohydrate moiety. In some embodiments, the carbohydrate moiety is GalNAc. In some embodiments, the cell-penetrating peptide is an ADGN-106 peptide. In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide. In some embodiments, the carbohydrate moiety modifies an alanine within the cell-penetrating peptide. In some embodiments, the cell-penetrating peptide is set forth in SEQ ID NO: 124 or 129.

    First Cell-Penetrating Peptide and Second Cell-Penetrating Peptide

    [0143] In some embodiments, the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and the first peptide does not have a PEG moiety. In some embodiments, the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 50 to 1 (such as about 25 to about 2, about 20 to about 3, about 15 to about 4, about 12 to about 4, about 12 to about 5, or about 10 to about 5.)

    [0144] In some embodiments, the PEG moiety is a linear PEG. In some embodiments, the PEG moiety is a branched PEG. In some embodiments, the molecular weight of the PEG moiety is about 5 kDa to about 10 kDa. In some embodiments, the PEG moiety consists of about one to ten ethylene glycol units. In some embodiments, the PEG moiety is conjugated to the N-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to the C-terminus of the second cell-penetrating peptide.

    Cargo Molecules

    [0145] In some embodiments, the cargo molecule of the complex or nanoparticle as described above e is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0146] In some embodiments, the cargo molecule of the complex or nanoparticle as described above is a nucleic acid. In some embodiments, the cargo molecule is selected from the group consisting of oligonucleotides, polynucleotides, single- or double-stranded oligo and polynucleotides, antisense oligonucleotides, various forms of RNAi, including for example siRNA, shRNA, etc., microRNA (miRNA), antagomirs, ribozymes, aptamers, plasmid DNA, etc. and suitable combinations of one or more thereof. In some embodiments, the nucleic acid is selected from the group consisting of an siRNA, an miRNA, a shRNA, a gRNA, an mRNA, a DNA, a DNA plasmid, an oligonucleotide and an analogue thereof. In some embodiments, the nucleic acid comprises an mRNA. In some embodiments, the nucleic acid comprises an RNAi. In some embodiments, the nucleic acid comprises an mRNA and an RNAi, and wherein the mRNA encodes a therapeutic protein for treating a disease or condition, and wherein the RNAi targets an RNA, wherein expression of the RNA is associated with the disease or condition. In some embodiments, the molar ratio of the cell-penetrating peptide to the nucleic acid is between about 1:1 and about 100:1.

    [0147] In some embodiments, the cargo molecule is a protein, such as for example an enzyme or antibody, or a small molecule. In some embodiments, the cargo molecule comprises a plurality of cargo molecules that comprise a combination of nucleic acids with proteins or small molecules. In some embodiments, the combination comprises nucleic acids with proteins or small molecules that are covalently attached to each other. In some embodiments, the combination comprises nucleic acids with proteins or small molecules that are not covalently attached to each other.

    [0148] “Polynucleotide,” or “nucleic acid,” as used interchangeably herein, refers to polymers of nucleotides of any length, and includes DNA and RNA. The nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. The term “nucleic acid” as used herein refers to a polymer containing at least two deoxyribonucleotides or ribonucleotides in either single- or double-stranded form and includes DNA and RNA. DNA may be in the form of, e.g., antisense molecules, plasmid DNA, pre-condensed DNA, a PCR product, vectors (PAC, BAC, YAC, artificial chromosomes), expression cassettes, chimeric sequences, chromosomal DNA, or derivatives and combinations of these groups. RNA may be in the form of siRNA, asymmetrical interfering RNA (aiRNA), microRNA (miRNA), mRNA, tRNA, rRNA, RNA, viral RNA (vRNA), and combinations thereof. Nucleic acids include nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, including for example locked nucleic acid (LNA), unlocked nucleic acid (UNA), and zip nucleic acid (ZNA), which can be synthetic, naturally occurring, and non-naturally occurring, and which have similar binding properties as the reference nucleic acid. Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2′-O-methyl ribonucleotides, and peptide-nucleic acids (PNAs). Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer e al., Nucleic Acid Res., 19:5081 (1991); Ohtsuka et al. j. Biol. Chem., 260:2605-2608 (1985); Rossolini et al., Mol. Cell. Probes, 8:91-98 (1994)). “Nucleotides” contain a sugar deoxyribose (DNA) or ribose (RNA), a base, and a phosphate group. Nucleotides are linked together through the phosphate groups. “Bases” include purines and pyrimidines, which further include natural compounds adenine, thymine, guanine, cytosine, uracil, inosine, and natural analogs, and synthetic derivatives of purines and pyrimidines, which include, but are not limited to, modifications which place new reactive groups such as, but not limited to, amines, alcohols, thiols, carboxylases, and alkylhalides. “Oligonucleotide,” as used herein, generally refers to short, generally synthetic polynucleotides that are generally, but not necessarily, less than about 200 nucleotides in length. The terms “oligonucleotide” and “polynucleotide” are not mutually exclusive. The description above for polynucleotides is equally and fully applicable to oligonucleotides.

    [0149] In some embodiments, the nucleic acids are single stranded oligonucleotides. In some embodiments, the nucleic acids are double stranded oligonucleotides. The nucleic acids described herein may be any of a range of length of up to, but not necessarily 200 nucleotides in the case of antisense oligonucleotides, RNAi, siRNA, shRNA, iRNA, antagomirs or up to 1000 kilo bases in the case of plasmid DNA.

    [0150] In some embodiments, the nucleic acids are interference RNA, such as siRNA or shRNA. The term “interfering RNA” or “RNAi” or “interfering RNA sequence” refers to single-stranded RNA (e.g., mature miRNA) or double-stranded RNA (i.e., duplex RNA such as siRNA, aiRNA, or pre-miRNA) that is capable of reducing or inhibiting the expression of a target gene or sequence (e.g., by mediating the degradation or inhibiting the translation of mRNAs which are complementary to the interfering RNA sequence) when the interfering RNA is in the same cell as the target gene or sequence, interfering RNA thus refers to the single-stranded RNA that is complementary to a target mRNA sequence or to the double-stranded RNA formed by two complementary strands or by a single, self-complementary strand. Interfering RNA may have substantial or complete identity to the target gene or sequence, or may comprise a region of mismatch (i.e., a mismatch motif). The sequence of the interfering RNA can correspond to the full-length target gene, or a subsequence thereof. Interfering RNA includes “small-interfering RNA” or “siRNA,” e.g., interfering RNA of about 15-60, 15-50, or 5-40 (duplex) nucleotides in length, more typically about 15-30, 15-25, or 19-25 (duplex) nucleotides in length, and is preferably about 20-24, 21-22, or 21-23 (duplex) nucleotides in length (e.g., each complementary sequence of the double-stranded siRNA is 15-60, 15-50, 15-40, 15-30, 15-25, or 19-25 nucleotides in length, preferably about 20-24, 21-22, or 21-23 nucleotides in length, and the double-stranded siRNA is about 15-60, 15-50, 15-40, 5-30, 5-25, or 19-25 base pairs in length, preferably about 8-22, 9-20, or 19-21 base pairs in length). siRNA duplexes may comprise 3′ overhangs of about 1 to about 4 nucleotides or about 2 to about 3 nucleotides and 5′ phosphate termini. Examples of siRNA include, without limitation, a double-stranded polynucleotide molecule assembled from two separate stranded molecules, wherein one strand is the sense strand and the other is the complementary antisense strand; a double-stranded polynucleotide molecule assembled from a single stranded molecule, where the sense and antisense regions are linked by a nucleic acid-based or non-nucleic acid-based linker; a double-stranded polynucleotide molecule with a hairpin secondary structure having self-complementary sense and antisense regions; and a circular single-stranded polynucleotide molecule with two or more loop structures and a stem having self-complementary sense and antisense regions, where the circular polynucleotide can be processed in vivo or in vitro to generate an active double-stranded siRNA molecule. Preferably, siRNA are chemically synthesized. siRNA can also be generated by cleavage of longer dsRNA (e.g., dsRNA greater than about 25 nucleotides in length) with the E coli RNase III or Dicer. These enzymes process the dsRNA into biologically active siRNA (see, e.g., Yang et al., Proc Natl. Acad. Set. USA, 99:9942-9947 (2002); Calegari et al., Proc. Natl. Acad. Sci. USA, 99: 14236 (2002); Byrom et al., Ambion TeehNotes, 10(1):4-6 (2003); Kawasaki et al., Nucleic Acids Res., 3 1:981-987 (2003); Knight et al., Science, 293:2269-2271 (2001); and Robertson et al., J. Biol. Chem., 243:82 (1968)). Preferably, dsRNA are at least 50 nucleotides to about 100, 200, 300, 400, or 500 nucleotides in length A dsRNA may be as long as 1000, 1500, 2000, 5000 nucleotides in length, or longer. The dsRNA can encode for an entire gene transcript or a partial gene transcript. In certain instances, siRNA may be encoded by a plasmid (e.g., transcribed as sequences that automatically fold into duplexes with hairpin loops). A small hairpin RNA or short hairpin RNA (shRNA) is a sequence of RNA that makes a tight hairpin turn that can be used to silence gene expression via RNA interference. The shRNA hairpin structure is cleaved by the cellular machinery into siRNA, which is then bound to the RNA-induced silencing complex (RISC). This complex binds to and cleaves mRNAs which match the siRNA that is bound to it. Suitable length of the interference RNA are about 5 to about 200 nucleotides, or 10-50 nucleotides or base pairs or 15-30 nucleotides or base pairs. In some embodiments, the interference RNA is substantially complementary (such as at least about 60%, 70%, 80%, 90%, 95%, 98%, 99%, or more identical to) the corresponding target gene. In some embodiments, the interference RNA is modified, for example by incorporating non-naturally occurring nucleotides.

    [0151] In some embodiments, the nucleic acids are double-stranded antisense RNA. Suitable length of the interference RNA are about 5 to about 200 nucleotides, or 10-50 nucleotides or base pairs or 15-30 nucleotides or base pairs n some embodiments, the interference RNA is substantially complementary (such as at least about 60%, 70%, 80%, 90%, 95%, 98%, 99%, or more identical) to the corresponding target gene. In some embodiments, the antisense RNA is modified, for example by incorporating non-naturally occurring nucleotides.

    [0152] In some embodiments, the nucleic acid is an interfering RNA, such as an siRNA, that specifically targets an RNA molecule, such as an mRNA, encoding a protein involved in a disease, such as cancer. In some embodiments, the disease is cancer, such as a solid tumor or hematological malignancy, and the interfering RNA targets mRNA encoding a protein involved in the cancer, such as a protein involved in regulating the progression of the cancer.

    [0153] In some embodiments, the nucleic acid is an interfering RNA, such as an siRNA, that specifically targets an RNA molecule, such as an mRNA, encoding a protein involved in negatively regulating an immune response. In some embodiments, the interfering RNA targets mRNA encoding a negative co-stimulatory molecule. In some embodiments, the negative co-stimulatory molecule includes, for example, PD-1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, and CTLA-4.

    [0154] In some embodiments, the nucleic acids are miRNA. A microRNA (abbreviated miRNA) is a short ribonucleic acid (RNA) molecule found in eukaryotic cells. A microRNA molecule has very few nucleotides (an average of 22) compared with other R As. miRNAs are post-transcriptional regulators that bind to complementary sequences on target messenger RNA transcripts (mRNAs), usually resulting in translational repression or target degradation and gene silencing. The human genome may encode over 1000 miRNAs, which may target about 60% of mammalian genes and are abundant in many human cell types. Suitable length of the miRNAs are about 5 to about 200 nucleotides, or 0-50 nucleotides or base pairs or 15-30 nucleotides or base pairs. In some embodiments, the miRNA s substantially complementary (such as at least about 60%, 70%, 80%, 90%, 95%, 98%, 99%, or more identical to) the corresponding target gene. In some embodiments, the antisense RNA is modified, for example by incorporating non-naturally occurring nucleotides.

    [0155] In some embodiments, the nucleic acids are plasmid DNA or DNA (e.g., DNA fragments, for example DNA fragments of lengths of up to about 1000 bp). In addition, the plasmid DNA or DNA may be hypermethylated or hypomethylated. In some embodiments, the plasmid DNA or DNA encode one or more genes, and may contain regulatory elements necessary for the expression of said one or more genes. In some embodiments, the plasmid DNA or DNA may comprise one or more genes that encode a selectable marker, allowing for maintenance of the plasmid DNA or DNA fragment in an appropriate host cell.

    [0156] In some embodiments, the plasmid DNA comprises a DNA sequence encoding a chimeric antigen receptor (CAR) comprising an extracellular antigen-binding domain that specifically binds to a target antigen, a transmembrane domain, and an intracellular signaling domain. CARs are described, for example, in U.S. Pat. No. 8,822,647, U.S. Patent Application Publication No. 2015/0051266, WO 2014/127261, and WO2014099671, the disclosures of which are specifically incorporated herein by reference in their entirety. In some embodiments, the target antigen is an antigen specifically associated with (such as expressed by) a cancer cell. For example, in some embodiments, the plasmid DNA comprises a DNA sequence encoding a CAR comprising an extracellular antigen-binding domain that specifically binds to a cancer-associated antigen, a transmembrane domain, and an intracellular signaling domain. In some embodiments, the cancer-associated antigen is associated with a solid tumor. In some embodiments, the cancer-associated antigen is associated with a hematological malignancy, such as a B cell malignancy or leukemia.

    [0157] In some embodiments, the cargo molecule comprises a virus. In some embodiments, the virus is a recombinant virus, including recombinant adeno-associated virus (AAV), adenovirus, lentivirus, retrovirus, herpes simplex virus (HSV), poxvirus, Epstein-Barr virus (EBV), vaccinia virus, and human cytomegalovirus (hCMV). In some embodiments, the recombinant virus comprises a transgene for insertion into a cell genome. In some embodiments, the transgene is a therapeutic transgene. In some embodiments, the transgene encodes a protein, such as a therapeutic protein. In some embodiments, the transgene encodes an inhibitory RNA (RNAi), such as an RNAi targeting an endogenous gene, e.g., a disease-associated endogenous gene. In some embodiments, the transgene encodes a CAR In some embodiments, the virus comprises a first transgene encoding an RNAi. In some embodiments, the RNAi is a therapeutic RNAi targeting an endogenous gene involved in a disease or condition. In some embodiments, the therapeutic RNAi targets a disease-associated form of the endogenous gene (e.g., a gene encoding a mutant protein, or a gene resulting in abnormal expression of a protein). In some embodiments, the virus comprises a second transgene encoding a protein. In some embodiments, the protein is a therapeutic protein useful for treating a disease or condition. In some embodiments, the second transgene is a therapeutic form of an endogenous gene (e.g., the second transgene encodes a wild-type or functional form of a mutant protein encoded by the endogenous gene, or the second transgene results in normal expression of a protein encoded by the endogenous gene). In some embodiments, there is provided a virus comprising the first transgene and the second transgene.

    [0158] In some embodiments, the cargo molecule comprises both an mRNA (e.g., PTEN) and an siRNA (such as an siRNA targeting an oncogene (e.g., KRAS)).

    [0159] In some embodiments, the cargo molecule comprises both an mRNA (such as an mRNA encoding a DNA nuclease (e.g., Cas9)) and a guide RNA (such as a guide RNA that targets a mutated oncogene (e.g., KRAS)).

    Genome-Editing System

    [0160] In some embodiments, the cargo comprises a genome-editing system molecule.

    [0161] In some embodiments, a genome-editing system molecule (e.g. RGEN) of a genome-editing complex or nanoparticle described herein is a protein or polypeptide. For example, in some embodiments, a genome-editing complex or nanoparticle described herein comprises an RGEN (e.g., Cas9). In some embodiments, the protein or polypeptide is between about 10 kDa and about 200 kDa (such as about any of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, and 200 kDa, including any ranges between these values). In some embodiments, the genome-editing complex or nanoparticle comprises a plurality of proteins or polypeptides, wherein each of the plurality of protein or polypeptides is between about 10 kDa and about 200 kDa (such as about any of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, and 200 kDa, including any ranges between these values).

    [0162] In some embodiments, a genome-editing system molecule (e.g. gRNA) of a genome-editing complex or nanoparticle described herein is a nucleic acid. In some embodiments, the nucleic acid is between about 20 nt and about 20 kb (such as about any of 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20 kb, including any ranges between these values). For example, in some embodiments, a genome-editing complex or nanoparticle described herein comprises a gRNA (e.g., a Cas9 gRNA). In some embodiments, the gRNA is between about 20 nt and about 200 nt (such as about any of 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, and 200 nt, including any ranges between these values). In some embodiments, the nucleic acid is DNA, such as a DNA plasmid encoding a genome-editing system molecule. In some embodiments, the DNA plasmid comprises an expression cassette for expressing the genome-editing system molecule. In some embodiments, the DNA plasmid is between about 1 kb and about 20 kb (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20 kb, including any ranges between these values). In some embodiments, the nucleic acid is RNA, such as mRNA encoding a genome-editing system molecule. In some embodiments, the mRNA is between about 100 nt and about 10 kb (such as about any of 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, and 10 kb, including any ranges between these values). In some embodiments, the genome-editing complex or nanoparticle comprises a plurality of nucleic acids, such as any of the nucleic acids described herein. For example, in some embodiments, the genome-editing complex or nanoparticle comprises a gRNA and a nucleic acid encoding a genome-editing system molecule (e.g., a DNA plasmid or mRNA encoding the genome-editing system molecule). In some embodiments, the genome-editing complex or nanoparticle comprises nucleic acid encoding a plurality of genome-editing system molecules (e.g., one or more DNA plasmid encoding the plurality of genome-editing system molecules, or a plurality of mRNAs encoding the plurality of genome-editing system molecules).

    [0163] In some embodiments, a genome-editing system molecule (e.g. RGEN or gRNA) of a genome-editing complex or nanoparticle described herein is replaced with a nucleic acid encoding the genome-editing system molecule. For example, in some embodiments, a genome-editing complex or nanoparticle described herein comprises a nucleic acid encoding an RGEN and/or a nucleic acid encoding a gRNA. In some embodiments, the nucleic acid is DNA, such as a DNA plasmid encoding a genome-editing system molecule. In some embodiments, the DNA plasmid comprises an expression cassette for expressing the genome-editing system molecule. In some embodiments, the DNA plasmid is between about 1 kb and about 20 kb (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20 kb, including any ranges between these values). In some embodiments, the nucleic acid is RNA, such as mRNA encoding a genome-editing system molecule. In some embodiments, the mRNA is between about 100 nt and about 10 kb (such as about any of 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, and 10 kb, including any ranges between these values).

    [0164] In some embodiments, cargo comprises a CRISPR-associated nuclease. In some embodiments, the CRISPR-associated nuclease is a Cas nuclease. Non-limiting examples of Cas proteins include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 and Csx12), Cas10, Cpf1, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, Csf4, homologs thereof, or modified versions thereof, such as inducible, inactivated, or split Cas proteins (see for example Dominguez et al. (2015). Nature Reviews Molecular Cell Biology; Polstein, L. R., & Gersbach, C. A. (2015). Nature chemical biology, 11(3):198-200; Dow et al. (2015). Nature biotechnology, 33(4):390-394; Zetsche et al. (2015). Nature biotechnology, 33(2):139-142: Kleinstiver et al. (2015). Nature. 523:481-485; Bikard et al. (2013). Nucleic acids research, 41(15):7429-7437; Qi et al. (2013). Cell, 152(5):1173-1183). These enzymes are known to those of skill in the art; for example, the amino acid sequence of S. pyogenes Cas9 protein may be found in the SwissProt database under accession number Q99ZW2, and the amino acid sequence of Acidaminococcus sp. Cpf1 protein may be found in the SwissProt database under accession number U2UMQ6. In some embodiments, the unmodified CRISPR enzyme has DNA cleavage activity, such as Cas9. In some embodiments the CRISPR enzyme is Cas9, and may be Cas9 from S. pyogenes or S. pneumoniae. In some embodiments the CRISPR enzyme is Cpf1, and may be Cpf1 from Acidaminococcus or Lachnospiraceae. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence. In some embodiments, the CRISPR enzyme is mutated with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence. For example, an aspartate-to-alanine substitution (D10A) in the RuvC I catalytic domain of Cas9 from S. pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand). Other examples of mutations that render Cas9 a nickase include, without limitation, H840A, N854A, and N863A. In some embodiments, a Cas9 nickase may be used in combination with guide sequences, e.g., two guide sequences, which target respectively sense and antisense strands of the DNA target. This combination allows both strands to be nicked and used to induce NHEJ.

    [0165] As a further example, two or more catalytic domains of Cas9 (RuvC I, RuvC II, and RuvC III) may be mutated to produce a mutated Cas9 substantially lacking all DNA cleavage activity. In some embodiments, a D10A mutation is combined with one or more of H840A, N854A, or N863A mutations to produce a Cas9 enzyme substantially lacking all DNA cleavage activity. In some embodiments, a CRISPR enzyme is considered to substantially lack all DNA cleavage activity when the DNA cleavage activity of the mutated enzyme is less than about 25%, 10%, 5%, 1%, 0.1%, 0.01%, or lower with respect to its non-mutated form. Other mutations may be useful; where the Cas9 or other CRISPR enzyme is from a species other than S. pyogenes, mutations in corresponding amino acids may be made to achieve similar effects.

    [0166] In some embodiments, the Cas protein (such as Cas9) is a split Cas protein comprising an N-terminal Cas protein fragment, Cas(N), and a C-terminal Cas protein fragment, Cas(C), wherein Cas(N) is fused to a first dimerization domain and Cas(C) is fused to a second dimerization domain, and wherein the first and second dimerization domains facilitate dimerization of Cas(N) and Cas(C) to form a complex with a functional Cas nuclease activity. In some embodiments, dimerization of the first and second dimerization domains is sensitive to a dimerization agent. For example, in some embodiments, the first and second dimerization domains comprise the FK506 binding protein 12 (FKBP) and FKBP rapamycin binding (FRB) domains of the mammalian target of rapamycin (mTOR), and the dimerization agent is rapamycin.

    [0167] In some embodiments, an enzyme coding sequence encoding a CRISPR enzyme is codon optimized for expression in particular cells, such as eukaryotic cells. The eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, mouse, rat, rabbit, dog, or non-human primate. In general, codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g, about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence. Various species exhibit particular bias for certain codons of a particular amino acid. Codon bias (differences in codon usage between organisms) often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, among other things, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the “Codon Usage Database”, and these tables can be adapted in a number of ways. See Nakamura, Y., et al. “Codon usage tabulated from the international DNA sequence databases: status for the year 2000” Nucl. Acids Res. 28:292 (2000). Computer algorithms for codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, Pa.), are also available. In some embodiments, one or more codons (e.g. 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons) in a sequence encoding a CRISPR enzyme correspond to the most frequently used codon for a particular amino acid.

    [0168] In some embodiments, a CRISPR enzyme comprises one or more nuclear localization sequences (NLSs), such as about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs. In some embodiments, the CRISPR enzyme comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-terminus, or a combination of these (e.g. one or more NLS at the amino-terminus and one or more NLS at the carboxy terminus). When more than one NLS is present, each may be selected independently of the others, such that a single NLS may be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies. In some embodiments, the CRISPR enzyme comprises at most 6 NLSs. In some embodiments, an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus. Typically, an NLS consists of one or more short sequences of positively charged lysines or arginines exposed on the protein surface, but other types of NLS are known. Non-limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV; the NLS from nucleoplasmin (e.g. the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK); the c-myc NLS having the amino acid sequence PAAKRVKLD or RQRRNELKRSP; the hRNPA1 M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY; the sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV of the IBB domain from importin-alpha; the sequences VSRKRPRP and PPKKARED of the myoma T protein; the sequence PQPKKKPL of human p53; the sequence SALIKKKKKMAP of mouse c-abl IV; the sequences DRLRR and PKQKKRK of the influenza virus NS1; the sequence RKLKKKIKKL of the Hepatitis virus delta antigen; the sequence REKKKFLKRR of the mouse Mxl protein; the sequence KRKGDEVDGVDEVAKKKSKK of the human poly(ADP-ribose) polymerase; and the sequence RKCLQAGMNLEARKTKK of the steroid hormone receptors (human) glucocorticoid.

    [0169] In general, a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence. In some embodiments, the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm, is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies, ELAND (Illumina, San Diego. Calif.), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net). In some embodiments, a guide sequence is about or more than about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length. In some embodiments, a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length. The ability of a guide sequence to direct sequence-specific binding of a CRISPR complex to a target sequence may be assessed by any suitable assay. For example, the components of a CRISPR system sufficient to form a CRISPR complex, including the guide sequence to be tested, may be provided to a host cell having the corresponding target sequence, followed by an assessment of preferential cleavage within the target sequence, such as by Surveyor assay as described herein. Similarly, cleavage of a target polynucleotide sequence may be evaluated in a test tube by providing the target sequence, components of a CRISPR complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions. Other assays are possible, and will occur to those skilled in the art.

    [0170] A guide sequence may be selected to target any target sequence. In some embodiments, the target sequence is a sequence within a genome of a cell. Exemplary target sequences include those that are unique in the target genome. In some embodiments, a guide sequence is selected to reduce the degree of secondary structure within the guide sequence. Secondary structure may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFold, as described by Zuker and Stiegler (Nucleic Acids Res. 9 (1981), 133-148). Another example folding algorithm is the online webserver RNAfold, developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g. A. R. Gruber et al., 2008, Cell 106(1): 23-24; and P A Carr and G M Church, 2009, Nature Biotechnology 27(12): 1151-62). Further algorithms may be found in U.S. application Ser. No. 61/836,080; incorporated herein by reference.

    [0171] In general, a tracr mate sequence includes any sequence that has sufficient complementarity with a tracr sequence to promote one or more of: (1) excision of a guide sequence flanked by tracr mate sequences in a cell containing the corresponding tracr sequence; and (2) formation of a CRISPR complex at a target sequence, wherein the CRISPR complex comprises the tracr mate sequence hybridized to the tracr sequence. In general, degree of complementarity is with reference to the optimal alignment of the tracr mate sequence and tracr sequence, along the length of the shorter of the two sequences. Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self-complementarity within either the tracr sequence or tracr mate sequence. In some embodiments, the degree of complementarity between the tracr sequence and tracr mate sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher. In some embodiments, the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length. In some embodiments, the guide sequence, tracr sequence and tracr mate sequence are contained within a single RNA (referred to herein as a “single-guide RNA,” or “sgRNA”), such that hybridization between the tracr sequence and the tracr mate sequence produces a secondary structure, such as a hairpin. Preferred loop forming sequences for use in hairpin structures are four nucleotides in length, and most preferably have the sequence GAAA. However, longer or shorter loop sequences may be used, as may alternative sequences. The sequences preferably include a nucleotide triplet (for example, AAA), and an additional nucleotide (for example C or G). Examples of loop forming sequences include CAAA and AAAG. In an embodiment of the invention, the sgRNA has at least two or more hairpins. In preferred embodiments, the sgRNA has two, three, four or five hairpins. In a further embodiment of the invention, the sgRNA has at most five hairpins. In some embodiments, the sgRNA further includes a transcription termination sequence; preferably this is a polyT sequence, for example six T nucleotides.

    [0172] In some embodiments, a donor nucleic acid is also provided. In some embodiments, the donor nucleic acid is designed to serve as a template in homologous recombination, such as within or near a target sequence nicked or cleaved by a CRISPR enzyme as a part of a CRISPR complex. A donor nucleic acid may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length. In some embodiments, the donor nucleic acid comprises a sequence that is complementary to a portion of a polynucleotide comprising the target sequence. In some embodiments, when a donor nucleic acid and a polynucleotide comprising a target sequence are optimally aligned, the donor nucleic acid overlaps with one or more nucleotides of the target sequence (e.g, about or more than about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or more nucleotides). In some embodiments, when a donor nucleic acid and a polynucleotide comprising a target sequence are optimally aligned, the nearest nucleotide of the donor nucleic acid in the region of complementarity is within about 1, 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.

    [0173] In some embodiments, the CRISPR enzyme is part of a fusion protein comprising one or more heterologous protein domains (e.g, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more domains in addition to the CRISPR enzyme). A CRISPR enzyme fusion protein may comprise any additional protein sequence, and optionally a linker sequence between any two domains. Examples of protein domains that may be fused to a CRISPR enzyme include, without limitation, epitope tags, reporter gene sequences, and protein domains having one or more of the following activities: methylase activity, demethylase activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, RNA cleavage activity and nucleic acid binding activity. Non-limiting examples of epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags. Examples of reporter genes include, but are not limited to, glutathione-S-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP). A CRISPR enzyme may be fused to a gene sequence encoding a protein or a fragment of a protein that bind DNA molecules or bind other cellular molecules, including but not limited to maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4 DNA binding domain fusions, and herpes simplex virus (HSV) BP16 protein fusions. Additional domains that may form part of a fusion protein comprising a CRISPR enzyme are described in US20110059502, incorporated herein by reference. In some embodiments, a tagged CRISPR enzyme is used to identify the location of a target sequence.

    [0174] In some embodiments, the cargo comprises a fusion protein comprising a catalytically disabled nuclease (such as a catalytically disabled Cas9 endonuclease) and a reversed transcriptase (such as a pentamutant of M-MLV reverse transcriptase). See for example, Anzalone & Liu et al., Nature. 2019 December; 576 (7785):149-157. In some embodiments, the cargo comprises a polynucleotide encoding the fusion protein.

    [0175] In some embodiments, the cargo comprises a fusion protein comprising a catalytically disabled nuclease (such as a catalytically disabled Cas9 endonuclease) and a nucleobase deaminase enzyme. In some embodiments, the nucleobase deaminase enzyme is APOBEC1 cytidine deaminase. In some embodiments, the nucleobase deaminase enzyme is cytidine deaminase CDA1. In some embodiments, the fusion protein further comprises a DNA glycosylase inhibitor. In some embodiments, the DNA glycosylase inhibitor is uracil DNA glycosylase inhibitor (UGI). In some embodiments, the cargo comprises a polynucleotide encoding the fusion protein.

    mRNA

    [0176] In some embodiments, the cargo comprises an mRNA. Exemplary mRNA enocodes a polypeptide of interest selected from any of several target categories including, but not limited to, biologics, antibodies, vaccines, therapeutic proteins or peptides, cell penetrating peptides, secreted proteins, plasma membrane proteins, cytoplasmic or cytoskeletal proteins, intracellular membrane bound proteins, nuclear proteins, proteins associated with human disease, targeting moieties or those proteins encoded by the human genome for which no therapeutic indication has been identified but which nonetheless have utility in areas of research and discovery.

    [0177] In some embodiments, an mRNA contained in a cargo delivery complex according to any of the embodiments described herein comprises a region encoding a polypeptide of interest and a region of linked nucleosides according to any of the mRNAs described in U.S. Pat. Nos. 9,061,059 and 9,221,891, each of which is incorporated herein in its entirety.

    [0178] In some embodiments, an mRNA contained in a cargo delivery complex according to any of the embodiments described herein encodes a polypeptide variant of a reference polypeptide. In some embodiments, the polypeptide variant may have the same or a similar activity as the reference polypeptide. Alternatively, the variant may have an altered activity (e.g., increased or decreased) relative to a reference polypeptide. Generally, variants of a particular polynucleotide or polypeptide of the invention will have at least about 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% but less than 100% sequence identity to that particular reference polynucleotide or polypeptide as determined by sequence alignment programs and parameters described herein and known to those skilled in the art.

    [0179] In some embodiments, an mRNA contained in a cargo delivery complex according to any of the embodiments described herein encodes a biologic. As used herein, a “biologic” is a polypeptide-based molecule produced by the methods provided herein and which may be used to treat, cure, mitigate, prevent, or diagnose a serious or life-threatening disease or medical condition. Biologics, according to the present invention include, but are not limited to, allergenic extracts (e.g. for allergy shots and tests), blood components, gene therapy products, human tissue or cellular products used in transplantation, vaccines, monoclonal antibodies, cytokines, growth factors, enzymes, thrombolytics, and immunomodulators, among others. In some embodiments, the biologic is currently being marketed or in development.

    [0180] In some embodiments, an mRNA contained in a cargo delivery complex according to any of the embodiments described herein encodes an antibody or fragment thereof (such as an antigen-binding fragment). In some embodiments, the antibody or fragment thereof is currently being marketed or in development.

    [0181] The term “antibody” includes monoclonal antibodies (including full length antibodies which have an immunoglobulin Fc region), antibody compositions with polyepitopic specificity, multispecific antibodies (e.g., bispecific antibodies, diabodies, and single-chain molecules), as well as antibody fragments. The term “immunoglobulin” (Ig) is used interchangeably with “antibody” herein. As used herein, the term “monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations and/or post-translation modifications (e.g., isomerizations, amidations) that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site.

    [0182] In some embodiments, an mRNA contained in a cargo delivery complex according to any of the embodiments described herein encodes a vaccine. As used herein, a “vaccine” is a biological preparation that improves immunity to a particular disease or infectious agent. In some embodiments, the vaccine is currently being marketed or in development.

    [0183] In some embodiments, the vaccine encoded by the mRNA is utilized to treat conditions or diseases in many therapeutic areas such as, but not limited to, cardiovascular, CNS, dermatology, endocrinology, oncology, immunology, respiratory, and anti-infective.

    [0184] In some embodiments, an mRNA contained in a cargo delivery complex according to any of the embodiments described herein encodes a therapeutic protein. In some embodiments, the therapeutic protein is currently being marketed or in development. In some embodiments, the therapeutic protein is useful for: (a) replacing a protein that is deficient or abnormal; (b) augmenting an existing pathway; (c) providing a novel function or activity; or (d) interfering with a molecule or organism. In some embodiments, the therapeutic protein includes, without limitation, antibody-based drugs, Fc fusion proteins, anticoagulants, blood factors, bone morphogenetic proteins, engineered protein scaffolds, enzymes, growth factors, hormones, interferons, interleukins, and thrombolytics. In some embodiments, the therapeutic protein acts by: (a) binding non-covalently to target. e.g., mAbs; (b) affecting covalent bonds, e.g., enzymes; or (c) exerting activity without specific interactions, e.g., serum albumin. In some embodiments, the therapeutic protein is a recombinant protein.

    [0185] In some embodiments, the therapeutic protein encoded by the mRNA is utilized to treat conditions or diseases in many therapeutic areas such as, but not limited to, blood, cardiovascular, CNS, poisoning (including antivenoms), dermatology, endocrinology, genetic, genitourinary, gastrointestinal, musculoskeletal, oncology, and immunology, respiratory, sensory and anti-infective. In some embodiments, the therapeutic protein includes, without limitation, vascular endothelial growth factor (VEGF-A, VEGF-B, VEGF-C, VEGF-D), placenta growth factor (PGF), OX40 ligand (OX40L; CD134L), interleukin 12 (IL 12), interleukin 23 (IL23), interleukin 36 γ (IL36γ), and CoA mutase.

    [0186] In some embodiments, the therapeutic protein replaces a protein that is deficient or abnormal. In some embodiments, the therapeutic protein includes, without limitation, alpha 1 antitrypsin, frataxin, insulin, growth hormone (somatotropin), growth factors, hormones, dystrophin, insulin-like growth factor 1 (IGF1), factor VIII, factor IX, antithrombin III, protein C. β-Gluco-cerebrosidase, Alglucosidase-α, α-1-iduronidase, Iduronate-2-sulphatase, Galsulphase, human α-galactosidase A. α-1-Proteinase inhibitor, lactase, pancreatic enzymes (including lipase, amylase, and protease), Adenosine deaminase, and albumin, including recombinant forms thereof.

    [0187] In some embodiments, the therapeutic protein provides a novel function or activity. In some embodiments, the therapeutic protein includes, without limitation, Botulinum toxin type A, Botulinum toxin type B, collagenase, Human deoxy-ribonuclease I, dornase-α, Hyaluronidase, papain, L-Asparaginase, Rasburicase, Lepirudin, Bivalirudin, Streptokinase, and anisoylated plasminogen streptokinase activator complex (APSAC).

    [0188] In some embodiments, the therapeutic protein interferes with a molecule or organism. In some embodiments, the therapeutic protein includes, without limitation, anti-VEGFA antibody, anti-EGFR antibody, anti-CD52 antibody, anti-CD20 antibody, anti-HER2/Neu antibody, fusion protein between extracellular domain of human CTLA4 and the modified Fc portion of human immunoglobulin G1, interleukin 1 (IL1) receptor antagonist, anti-TNFα antibody, CD2-binding protein, anti-CD11a antibody, anti-α4-subunit of α4β1 and α4β7 integrins antibody, anti-complement protein C5 antibody, Antithymocyte globulin, Chimeric (human/mouse) IgG1, Humanized IgG1 mAb that binds the alpha chain of CD25, anti-CD3 antibody, anti-IgE antibody, Humanized IgG1 mAb that binds the A antigenic site of the F protein of respiratory syncytial virus, HIV envelope protein gp120/gp41-binding peptide, Fab fragment of chimeric (human/mouse) mAb 7E3 that binds to the glycoprotein Ib/IIIa integrin receptor, and Fab fragments of IgG that bind and neutralize venom toxins.

    [0189] In some embodiments, an mRNA contained in a cargo delivery complex according to any of the embodiments described herein encodes a tumor suppressor protein, wherein the protein corresponds to a tumor suppressor gene. In some embodiments, the tumor-suppressor protein is a Retinoblastoma protein (pRb). In some embodiments, the tumor-suppressor protein is a p53 tumor-suppressor protein. In some embodiments, the corresponding tumor-suppressor gene is Phosphatase and tensin homolog (PTEN). In some embodiments, the corresponding tumor-suppressor gene is BRCAL. In some embodiments, the corresponding tumor-suppressor gene is BRCA2. In some embodiments, the corresponding tumor-suppressor gene is Retinoblastoma RB (or RB1). In some embodiments, the corresponding tumor-suppressor gene is TSC1. In some embodiments, the corresponding tumor-suppressor gene is TSC2. In some embodiments, the corresponding tumor-suppressor gene includes, without limitation, Retinoblastoma RB (or RB1), TP53, TP63, TP73, CDKN2A (INK4A), CDKN1B, CDKN1C, DLD/NP1, HEPACAM, SDHB, SDHD, SFRP1, TCF21, TIG1, MLH1, MSH2, MSH6, WT1, WT2, NF1, NF2N, VHL, KLF4, pVHL, APC, CD95, ST5, YPEL3, ST7, APC, MADR2, BRCA1, BRCA2, Patched, TSC1, TSC2, PALB2, ST14, or VHL.

    [0190] In some embodiments, the mRNA encodes a tumor suppressor protein PTEN. In some embodiments, the tumor suppressor protein PTEN is encoded by a human PTEN sequence. In some embodiments, the mRNA comprises a sequence selected from the group consisting of sequences with accession number of BC005821, JF268690, U92436, CR450306, AK024986, AK313581, U96180, and U93051 and NM_000314 in NCBI GenBank.

    [0191] In some embodiments, the mRNA encodes a tumor suppressor protein p53. In some embodiments, the tumor suppressor protein p53 is encoded by a human TP53 sequence. In some embodiments, the mRNA comprises a sequence selected from the group consisting of sequences with accession number of AF052180, NM_000546, AY429684, BT019622, AK223026, DQ 186652, DQ186651, DQ186650, DQ186649, DQ186648, DQ263704, DQ286964, DQ191317, DQ401704, AF307851, AM076972, AM076971, AM076970, DQ485152, BC003596, DQ648887, DQ648886, DQ648885, DQ648884, AK225838, M14694, M14695, EF101869, EF101868, EF101867, X01405, AK312568, NM_001126117, NM_001126116, NM_001126115, NM_001126114, NM_001126113, NM_001126112, FJ207420, X60020, X60019, X60018, X60017, X60016, X60015, X60014, X60013, X60011, X60012, X60010, X02469, S66666, AB082923, NM_001126118, JN900492, NM_001276699, NM_001276698, NM_001276697, NM_001276761, NM_001276760, NM_001276696, and NM_001276695 in NCBI GenBank.

    [0192] In some embodiments, the mRNA encodes a tumor suppressor protein BRCA1. In some embodiments, the tumor suppressor protein BRCA1 is encoded by a human BRCA1 sequence. In some embodiments, the mRNA comprises a sequence selected from the group consisting of a sequence with with accession number of NM 007294, NM_007297, NM_007298. NM_007304. NM_007299, NM_007300, BC046142, BC062429, BC072418, AY354539, AY751490, BC085615, BC106746, BC106745, BC114511, BC115037, U14680, AK293762, U68041, BC030969, BC012577, AK316200, DQ363751, DQ333387, DQ333386, Y08864, JN686490, AB621825, BC038947, U64805, and AF005068 in NCBI GenBank.

    [0193] In some embodiments, the mRNA encodes a tumor suppressor protein BRCA2. In some embodiments, the tumor suppressor protein BRCA2 is encoded by a human BRCA2 sequence. In some embodiments, the mRNA comprises a sequence selected from the group consisting of a sequence with with accession number of BC047568, NM_000059, DQ897648, BC026160 in NCBI GenBank.

    [0194] In some embodiments, the mRNA encodes a tumor suppressor protein TSC1. In some embodiments, the tumor suppressor protein TSC1 is encoded by a human TSC1 sequence. In some embodiments, the mRNA comprises a sequence selected from the group consisting of a sequence with with accession number of BC047772, NM_000368, BC070032, AB190910, BC108668, BC121000, NM_001162427, NM_001162426, D87683, and AF013168 in NCBI GenBank.

    [0195] In some embodiments, the mRNA encodes a tumor suppressor protein TSC2. In some embodiments, the tumor suppressor protein TSC2 is encoded by a human TSC2 sequence. In some embodiments, the mRNA comprises a sequence selected from the group consisting of a sequence with with accession number of BC046929, BX647816, AK125096, NM_000548, AB210000, NM_001077183, BC150300, BC025364, NM_001114382, AK094152, AK299343, AK295728, AK295672, AK294548, and X75621 in NCBI GenBank.

    [0196] In some embodiments, the mRNA encodes a tumor suppressor protein Retinoblastoma 1 (RB1). In some embodiments, the tumor suppressor protein RB1 is encoded by a human RB1 sequence. In some embodiments, the mRNA comprises a sequence selected from the group consisting of a sequence with with accession number of NM_000321, AY429568, AB208788, M19701, AK291258, L41870, AK307730, AK307125, AK300284. AK299179, M33647, M15400, M28419, BC039060, BC040540, and AF043224 in NCBI GenBank.

    [0197] In some embodiments, an mRNA contained in a cargo delivery complex according to any of the embodiments described herein encodes a protein, wherein the deficiency of the protein results in a disease or disorder. In some embodiments, the protein is Frataxin. In some embodiments, the protein is alpha 1 antitrypsin. In some embodiments, the protein is factor VIII. In some embodiments, the protein is factor IX.

    [0198] In some embodiments, an mRNA contained in a cargo delivery complex according to any of the embodiments described herein encodes a protein, wherein expression of the protein in an individual modulates an immune response to the protein in the individual. In some embodiments, the protein is an antigen. In some embodiments, the antigen is a disease-associated antigen (e.g., a tumor-associated antigen), and expression of the antigen in the individual results in an increased immune response to the antigen in the individual. In some embodiments, the antigen is a self-antigen, and expression of the antigen in the individual results in a decreased immune response to the antigen in the individual.

    [0199] In some embodiments, an mRNA contained in a cargo delivery complex according to any of the embodiments described herein encodes an antibody or antigen-binding fragment thereof. In some embodiments, the antibody is a therapeutic antibody. In some embodiments, the antibody is a bispecific antibody, such as a bispecific T cell engager (BiTE). In some embodiments, the antibody specifically binds to a disease-associated antigen, such as a tumor-associated antigen.

    [0200] In some embodiments, an mRNA contained in a cargo delivery complex according to any of the embodiments described herein comprises a reporter mRNA. In some embodiments, the mRNA comprises an EGFP mRNA, for example, CleanCap EGFP mRNA, CleanCap EGFP mRNA (5moU), or CleanCap Cyanine 5 EGFP mRNA (5moU). In some embodiments, the mRNA comprises a Luc mRNA, for example, CleanCap Fluc mRNA, CleanCap Fluc mRNA (5moU), CleanCap Cyanine 5 Fluc mRNA (5moU), CleanCap Gaussia Luc mRNA (5moU), or CleanCap Renilla Luc mRNA (5moU). In some embodiments, the mRNA comprises an mRNA selected from CleanCap β-gal mRNA, CleanCap β-gal mRNA (5moU) and CleanCap mCherry mRNA (5moU).

    RNAi

    [0201] In some embodiments, the cargo molecule comprises an interfering RNA (RNAi). In some embodiments, the RNAi includes, without limitation, an siRNA, shRNA, or miRNA. In some embodiments, the RNAi is an siRNA. In some embodiments, the RNAi is a microRNA. In some embodiments, the RNAi targets an endogenous gene. In some embodiments, the RNAi targets an exogenous gene. In some embodiments, the RNAi targets a disease-associated gene, e.g., a cancer-associated genes, such as an oncogene. In some embodiments, the RNAi targets an oncogene. In some embodiments, the oncogene is Smoothened. In some embodiments, the oncogene is rasK. In some embodiments, the oncogene is KRAS.

    [0202] In some embodiments, the cargo molecule comprises both an mRNA (such as any one of the mRNAs described herein) and an RNAi (such as a siRNA).

    [0203] In some embodiments, the RNAi (e.g., siRNA) targets an oncogene, wherein the oncogene is KRAS. In some embodiments, the individual comprises an aberration of KRAS. In some embodiments, the aberration of KRAS comprises a mutation on codon 12, 13, 17, 34 or 61 of KRAS. In some embodiments, an aberration of KRAS is selected from the group consisting of G12C, G12S, G12R, G12F, G12L, G12N, G12A, G12D, G12S, G12V, G13C, G13S, G13R, G13A, G13D, G13V, G13P, S17G, P34S, Q61E, Q61K, Q61L, Q61R, Q61P, Q61H, K117N, A146P, A146T and A146V. In some embodiments, the aberration of KRAS is selected from the group consisting of G12C, G12S, G12R, G12F, G12L, G12N, G12A, G12D, G12V, G13C, G13S, G13D, G13V, G13P, S17G, P34S, Q61K, Q61L, Q61R, and Q61H. In some embodiments, the aberration of KRAS is selected from the group consisting of G12C, G12R, G12S, G12A, G12D, G12V, G13C, G13R, G13S, G13A, G13D, G3V, Q61K, Q61L, Q61R, Q61H, K117N, A146P, A146T and A146V. In some embodiments, the aberration of KRAS is selected from the group consisting of KRAS G12A, G12C, G12D, G12R, G12S, G12V, G13A, G13C, G13D, G13R, G13S, G13V, Q61E, Q61H, Q61K, Q61L, Q61P, and Q61R. In some embodiments, the aberration of KRAS comprises G12C. In some embodiments, the aberration of KRAS comprises G12D. In some embodiments, the aberration of KRAS comprises Q61K. In some embodiments, the aberration of KRAS comprises G12C and G12D. In some embodiments, the aberration of KRAS comprises G12C and Q61K. In some embodiments, the aberration of KRAS comprises G12D and Q61K. In some embodiments, the aberration of KRAS comprises G12C, G12D and Q61K.

    [0204] In some embodiments, the RNAi (e.g., siRNA) targets a mutant form of KRAS. In some embodiments, the RNAi (e.g., siRNA) specifically targets a mutant form of KRAS but not the wildtype form of KRAS. In some embodiments, the mutant form comprises an aberration of KRAS, wherein the aberration of KRAS comprises a mutation on codon 12, 13, 17, 34 or 61 of KRAS. In some embodiments, the mutant form comprises an aberration of KRAS, wherein the aberration of KRAS is selected from the group consisting of G12C, G12S, G12R, G12F, G12L, G12N, G12A, G12D, G12S, G12V, G13C, G13S, G13R, G13A, G13D, G13V, G13P, S17G, P34S, Q61E, Q61K, Q61L, Q61R, Q61P, Q61H, K117N, A146P, A146T and A146V. In some embodiments, the mutant form comprises an aberration of KRAS, wherein the aberration of KRAS is selected from the group consisting of G12C, G12S, G12R, G12F, G12L, G12N, G12A, G12D, G12V, G13C, G13S, G13D, G13V, G13P, S17G, P34S, Q61K, Q61L, Q61R, and Q61H. In some embodiments, the mutant form comprises an aberration of KRAS, wherein the aberration of KRAS is selected from the group consisting of G12C, G12R, G12S, G12A, G12D, G12V, G13C, G13R, G13S, G13A. G13D, G13V, Q61K, Q61L, Q61R, Q61H, K117N, A146P, A146T and A146V. In some embodiments, the mutant form comprises an aberration of KRAS, wherein the aberration of KRAS is selected from the group consisting of KRAS G12A, G 12C, G12D, G12R, G12S, G12V, G13A, G13C, G3D, G13R, G13S, G13V, Q61E, Q61H, Q61K. Q61L, Q61P, and Q61R In some embodiments, the aberration of KRAS is selected from the group consisting of KRAS G12C, G12D, G12R, G12S, G12V and G13D. In some embodiments, the aberration of KRAS comprises G12C. In some embodiments, the aberration of KRAS comprises G12D. In some embodiments, the aberration of KRAS comprises Q61K. In some embodiments, the aberration of KRAS comprises G12C and G12D. In some embodiments, the aberration of KRAS comprises G12C and Q61K. In some embodiments, the aberration of KRAS comprises G12D and Q61K. In some embodiments, the aberration of KRAS comprises G12C, G12D and Q61K.

    [0205] In some embodiments, the RNAi (e.g., siRNA) targets a plurality of mutant forms of KRAS. In some embodiments, the plurality of mutant forms comprises a plurality of aberrations of KRAS, wherein the plurality of aberrations of KRAS comprise at least two or more mutations on codon 12, 13, 17, 34 and/or 61 of KRAS. In some embodiments, the plurality of aberrations of KRAS comprises at least two or more mutations on codon 12 and 61 of KRAS. In some embodiments, the aberration of KRAS is selected from the group consisting of G12C, G12S, G12R, G12F, G12L, G12N, G12A, G12D, G12S, G12V, G13C, G13S, G13R, G13A, G13D, G13V, G13P, S17G, P34S, Q61E, Q61K, Q61L, Q61R, Q61P, Q61H, K117N, A146P, A146T and A146V. In some embodiments, the aberrations of KRAS are selected from the group consisting of G12C, G12S, G12R, G12F, G12L, G12N, G12A, G12D, G12V, G13C, G13S, G13D, G13V, G13P, S17G, P34S, Q61K, Q61L, Q61R, and Q61H. In some embodiments, the aberrations of KRAS are selected from the group consisting of G12C, G12R, G12S, G12A, G12D, G12V, G13C, G13R, G13S, G13A, G13D, G13V, Q61K, Q61L, Q61R, Q61H, K117N, A146P, A146T and A146V. In some embodiments, the aberrations of KRAS is selected from the group consisting of KRAS G12A, G12C, G12D, G12R, G12S, G12V, G13A, G13C, G13D, G13R, G13S, G13V, Q61E, Q61H, Q61K, Q61 L, Q61P, and Q61R. In some embodiments, the aberrations of KRAS are selected from the group consisting of KRAS G12C, G12D, G12R. G12S, G12V and G13D. In some embodiments, the aberrations of KRAS are selected from the group consisting of KRAS G12C, G12D, and Q61K. In some embodiments, the aberrations of KRAS comprise G12C and G12D. In some embodiments, the aberrations of KRAS comprise G12C and Q61K. In some embodiments, the aberrations of KRAS comprise G12D and Q61K. In some embodiments, the aberration of KRAS comprises G12C, G12D and Q61K.

    [0206] In some embodiments, the RNAi (e.g., siRNA) comprises a plurality of RNAi (e.g., siRNA) comprising a first RNAi (e.g., a first siRNA) and a second RNAi (e.g., a second siRNA), wherein the first RNAi targets a first mutant form of KRAS, and wherein the second RNAi targets a second mutant form of KRAS. In some embodiments, the first RNAi and/or the second RNAi do not target the wildtype form of KRAS. In some embodiments, the first mutant form and/or the second mutant form comprises an aberration of KRAS, wherein the aberration of KRAS comprises a mutation on codon 12, 13, 17, 34 and/or 61 of KRAS. In some embodiments, the first mutant form and/or the second mutant form comprises an aberration of KRAS, wherein the aberration of KRAS comprises a mutation on codon 12 or 61 of KRAS. In some embodiments, the first mutant form comprises an aberration of KRAS comprising a mutation on codon 12, and the second mutant form comprises an aberration of KRAS comprising a mutation on codon 61. In some embodiments, the first mutant form and/or the second mutant form comprises an aberration of KRAS, wherein the aberration of KRAS is selected from the group consisting of G12C, G12S, G12R, G12F, G12L, G12N, G12A, G12D, G12S, G12V, G13C, G13S, G13R, G13A, G13D, G13V, G13P, S17G, P34S, Q61E, Q61K, Q61L, Q61R, Q61P, Q61H, K 117N, A146P, A146T and A146V. In some embodiments, the first mutant form and/or the second mutant form comprises an aberration of KRAS, wherein the aberration of KRAS is selected from the group consisting of G12C. G12S, G12R, G12F, G12L, G12N, G12A, G12D, G12V, G13C, G13S, G13D, G13V, G13P, S17G, P34S, Q61K, Q61L, Q61R, and Q61H. In some embodiments, the first mutant form and/or the second mutant form comprises an aberration of KRAS, wherein the aberration of KRAS is selected from the group consisting of G12C, G12R, G12S, G12A, G12D. G12V, G13C, G13R, G13S, G13A, G13D, G13V, Q61K, Q61L, Q61R, Q61H, K117N, A146P, A146T and A146V. In some embodiments, the first mutant form and/or the second mutant form comprises an aberration of KRAS, wherein the aberration of KRAS is selected from the group consisting of KRAS G12A, G12C, G12D, G12R, G12S, G12V, G13A, G13C, G13D, G13R, G13S, G13V, Q61E, Q61H, Q61K, Q61L, Q61P, and Q61R. In some embodiments, the first mutant form and/or the second mutant form comprises an aberration of KRAS, wherein the aberration of KRAS is selected from the group consisting of KRAS G12C, G12D, G12R, G12S. G12V and G13D. In some embodiments, the first mutant form and/or the second mutant form comprises an aberration of KRAS, wherein the aberration of KRAS is selected from G12C, G12D and Q61K. In some embodiments, the first mutant form comprises an aberration of KRAS comprising KRAS G12C, and the second mutant form comprises an aberration of KRAS comprising KRAS G12D. In some embodiments, the first mutant form comprises an aberration of KRAS comprising KRAS G12C, and the second mutant form comprises an aberration of KRAS comprising KRAS Q61K. In some embodiments, the first mutant form comprises an aberration of KRAS comprising KRAS G12D, and the second mutant form comprises an aberration of KRAS comprising KRAS Q61K.

    [0207] In some embodiments, the RNAi (e.g., siRNA) comprises a plurality of RNAi (e.g., siRNA) comprising a first RNAi (e.g., a first siRNA), a second RNAi (e.g., a second siRNA), and a third RNAi (e.g., siRNA). In some embodiments, the first RNAi targets a first mutant form of KRAS, the second RNAi targets a second mutant form of KRAS, and the third RNAi targets a third mutant form of KRAS. In some embodiments, the first, second and third KRAS mutant form each comprises an aberration of KRAS comprising a mutation on codon 12, 13, 17, 34 and/or 61 of KRAS. In some embodiments, the first, second and third KRAS mutant form each comprises an aberration of KRAS selected from the group consisting of G12C, G12S, G12R, G12F, G12L, G12N, G12A, G12D, G12S, G12V, G13C, G13S, G13R, G13A, G13D, G13V, G13P, S17G, P34S, Q61E, Q61K, Q61L, Q61R, Q61P, Q61H, K 117N. A146P, A146T and A146V. In some embodiments, the first, second and third KRAS mutant form each comprises an aberration of KRAS selected from the group consisting of G12C, G12S, G12R, G12F, G12L, G12N, G12A, G12D, G12V, G13C, G13S, G13D, G13V, G13P, S17G, P34S, Q61K, Q61L. Q61R, and Q61H. In some embodiments, the first, second and third KRAS mutant form each comprises an aberration of KRAS selected from the group consisting of G12C, G12R. G12S, G12A, G12D, G12V, G13C, G13R, G13S, G13A, G13D, G13V, Q61K, Q61L, Q61R, Q61H, K117N, A146P, A146T and A146V. In some embodiments, the first, second and third KRAS mutant form each comprises an aberration of KRAS selected from the group consisting of KRAS G12A, G12C, G12D, G12R, G12S, G12V, G13A, G13C, G13D, G13R, G13S, G13V, Q61E, Q61H, Q61K, Q61L, Q61P, and Q61R. In some embodiments, the first, second and third KRAS mutant form each comprises an aberration of KRAS selected from the group consisting of KRAS G12C, G12D, G12R, G12S, G12V, G13D and Q61K. In some embodiments, the first, second and third KRAS mutant form each comprises an aberration of KRAS selected from the group consisting of G12C, G12D and Q61K. In some embodiments, the first mutant form comprises an aberration of KRAS comprising KRAS G12C, the second mutant form comprises an aberration of KRAS comprising KRAS G12D, and the third mutant form comprises an aberration of KRAS comprising KRAS Q61K.

    [0208] In some embodiments, the RNAi (e.g., siRNA) comprises an RNAi (e.g., siRNA) targeting KRAS comprising a sequence of 5′-GUUGGAGCUUGUGGCGUAGTT-3′ (sense), 5′-CUACGCCACCAGCUCCAACTT-3 (anti-sense), 5′-GAAGUGCAUACACCGAGACTT-3′ (sense), 5′-GUCUCGGUGUAGCACUUCTT-3′ (anti-sense), 5′-GUUGGAGCUGUUGGCGUAGTT-3′ (sense) and/or 5′-CUACGCCAACAGCUCCAACTT-3′ (anti-sense). In some embodiments, the RNAi (e.g., siRNA) comprises an RNAi (e.g., siRNA) targeting KRAS comprising a nucleic acid sequence selected from sequences with SEQ ID NOS: 179, 180, 182-185. In some embodiments, the RNAi (e.g., siRNA) comprises an RNAi (e.g., siRNA) targeting KRAS comprising a sequence targeting KRAS G12S, such as the siRNA sequences disclosed in Acunzo, M. et al., Proc Natl Acad Sci USA. 2017 May 23; 114(21):E4203-E4212. In some embodiments, the RNAi (e.g., siRNA) comprises an RNAi (e.g., siRNA) targeting KRAS as disclosed in WO2014013995, JP2013212052, WO2014118817, WO2012129352, WO2017179660, JP2013544505, U.S. Pat. Nos. 8,008,474, 7,745,611, 7,576,197. U.S. Pat. No. 7,507,811, each of which is incorporated fully in this application.

    [0209] In some embodiments, the RNAi includes, without limitation, siRNA, shRNA, and miRNA. The term “interfering RNA” or “RNAi” or “interfering RNA sequence” refers to single-stranded RNA (e.g., mature miRNA) or double-stranded RNA (i.e., duplex RNA such as siRNA, aiRNA, or pre-miRNA) that is capable of reducing or inhibiting the expression of a target gene or sequence (e.g., by mediating the degradation or inhibiting the translation of mRNAs which are complementary to the interfering RNA sequence) when the interfering RNA is in the same cell as the target gene or sequence, interfering RNA thus refers to the single-stranded RNA that is complementary to a target mRNA sequence or to the double-stranded RNA formed by two complementary strands or by a single, self-complementary strand. Interfering RNA may have substantial or complete identity to the target gene or sequence, or may comprise a region of mismatch (i.e., a mismatch motif). The sequence of the interfering RNA can correspond to the full-length target gene, or a subsequence thereof. Interfering RNA includes “small-interfering RNA” or “siRNA,” e.g., interfering RNA of about 15-60, 15-50, or 5-40 (duplex) nucleotides in length, more typically about 15-30, 15-25, or 19-25 (duplex) nucleotides in length, and is preferably about 20-24, 21-22, or 21-23 (duplex) nucleotides in length (e.g., each complementary sequence of the double-stranded siRNA is 15-60, 15-50, 15-40, 15-30, 15-25, or 19-25 nucleotides in length, preferably about 20-24, 21-22, or 21-23 nucleotides in length, and the double-stranded siRNA is about 15-60, 15-50, 15-40, 5-30, 5-25, or 19-25 base pairs in length, preferably about 8-22, 9-20, or 19-21 base pairs in length), siRNA duplexes may comprise 3′ overhangs of about 1 to about 4 nucleotides or about 2 to about 3 nucleotides and 5′ phosphate termini. Examples of siRNA include, without limitation, a double-stranded polynucleotide molecule assembled from two separate stranded molecules, wherein one strand is the sense strand and the other is the complementary antisense strand; a double-stranded polynucleotide molecule assembled from a single stranded molecule, where the sense and antisense regions are linked by a nucleic acid-based or non-nucleic acid-based linker; a double-stranded polynucleotide molecule with a hairpin secondary structure having self-complementary sense and antisense regions, and a circular single-stranded polynucleotide molecule with two or more loop structures and a stem having self-complementary sense and antisense regions, where the circular polynucleotide can be processed in vivo or in vitro to generate an active double-stranded siRNA molecule. Preferably, siRNA are chemically synthesized. siRNA can also be generated by cleavage of longer dsRNA (e.g., dsRNA greater than about 25 nucleotides in length) with the E coli RNase III or Dicer. These enzymes process the dsRNA into biologically active siRNA (see, e.g., Yang et al., Proc Natl. Acad. Set. USA, 99:9942-9947 (2002); Calegai et al., Proc. Natl. Acad. Sci. USA, 99: 14236 (2002); Byrom et al., Ambion TeehNotes, 10(1):4-6 (2003); Kawasaki et al., Nucleic Acids Res., 3 1:981-987 (2003); Knight et al., Science, 293:2269-2271 (2001), and Robertson et al., J. Biol. Chem., 243:82 (1968)). Preferably, dsRNA are at least 50 nucleotides to about 100, 200, 300, 400, or 500 nucleotides in length A dsRNA may be as long as 1000, 1500, 2000, 5000 nucleotides in length, or longer. The dsRNA can encode for an entire gene transcript or a partial gene transcript. In certain instances, siRNA may be encoded by a plasmid (e.g., transcribed as sequences that automatically fold into duplexes with hairpin loops). A small hairpin RNA or short hairpin RNA (shRNA) is a sequence of RNA that makes a tight hairpin turn that can be used to silence gene expression via RNA interference. The shRNA hairpin structure is cleaved by the cellular machinery into siRNA, which is then bound to the RNA-induced silencing complex (RISC). This complex binds to and cleaves mRNAs which match the siRNA that is bound to it. Suitable lengths of the RNAi include, without limitation, about 5 to about 200 nucleotides, or 10-50 nucleotides or base pairs or 15-30 nucleotides or base pairs. In some embodiments, the RNAi is substantially complementary (such as at least about 60%, 70%, 80%, 90%, 95%, 98%, 99%, or more identical to) the corresponding target gene. In some embodiments, the RNAi is modified, for example by incorporating non-naturally occurring nucleotides.

    [0210] In some embodiments, the RNAi is a double-stranded RNAi. Suitable lengths of the RNAi include, without limitation, about 5 to about 200 nucleotides, or 10-50 nucleotides or base pairs or 15-30 nucleotides or base pairs. In some embodiments, the RNAi is substantially complementary (such as at least about 60%, 70%, 80%, 90%, 95%, 98%/o, 99%, or more identical) to the corresponding target gene. In some embodiments, the RNAi is modified, for example by incorporating non-naturally occurring nucleotides.

    [0211] In some embodiments, the RNAi specifically targets an RNA molecule, such as an mRNA, encoding a protein involved in a disease, such as cancer. In some embodiments, the disease is cancer, such as a solid tumor or hematological malignancy, and the interfering RNA targets mRNA encoding a protein involved in the cancer, such as a protein involved in regulating the progression of the cancer. In some embodiments, the RNAi targets an oncogene involved in the cancer.

    [0212] In some embodiments, the RNAi specifically targets an RNA molecule, such as an mRNA, encoding a protein involved in negatively regulating an immune response. In some embodiments, the interfering RNA targets mRNA encoding a negative co-stimulatory molecule. In some embodiments, the negative co-stimulatory molecule includes, for example, PD-1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, and CTLA-4.

    [0213] In some embodiments, the RNAi is an miRNA. A microRNA (abbreviated miRNA) is a short ribonucleic acid (RNA) molecule found in eukaryotic cells. A microRNA molecule has very few nucleotides (an average of 22) compared with other RNAs. miRNAs are post-transcriptional regulators that bind to complementary sequences on target messenger RNA transcripts (mRNAs), usually resulting in translational repression or target degradation and gene silencing. The human genome may encode over 1000 miRNAs, which may target about 60% of mammalia genes and are abundant in many human cell types. Suitable lengths of the miRNAs include, without limitation, about 5 to about 200 nucleotides, or about 0-50 nucleotides or base pairs or 15-30 nucleotides or base pairs. In some embodiments, the miRNA is substantially complementary (such as at least about 60%, 70%, 80%, 90%, 95%, 98%, 99%, or more identical to) the corresponding target gene. In some embodiments, the miRNA is modified, for example by incorporating non-naturally occurring nucleotides.

    Virus

    [0214] In some embodiments, according to any of the complexes and/or nanoparticles described herein, the virus is a recombinant virus, including recombinant adeno-associated virus (AAV), adenovirus, lentivirus, retrovirus, herpes simplex virus (HSV), poxvirus, Epstein-Barr virus (EBV), vaccinia virus, and human cytomegalovirus (hCMV). In some embodiments, the recombinant virus comprises a transgene for insertion into a cell genome. In some embodiments, the transgene is a therapeutic transgene. In some embodiments, the transgene encodes a protein, such as a therapeutic protein. In some embodiments, the transgene encodes an inhibitory RNA (RNAi), such as an RNAi targeting an endogenous gene, e.g., a disease-associated endogenous gene. In some embodiments, the transgene encodes a CAR. In some embodiments, the virus comprises a first transgene encoding an RNAi. In some embodiments, the RNAi is a therapeutic RNAi targeting an endogenous gene involved in a disease or condition. In some embodiments, the therapeutic RNAi targets a disease-associated form of the endogenous gene (e.g., a gene encoding a mutant protein, or a gene resulting in abnormal expression of a protein). In some embodiments, the virus comprises a second transgene encoding a protein. In some embodiments, the protein is a therapeutic protein useful for treating a disease or condition. In some embodiments, the second transgene is a therapeutic form of an endogenous gene (e.g., the second transgene encodes a wild-type or functional form of a mutant protein encoded by the endogenous gene, or the second transgene results in normal expression of a protein encoded by the endogenous gene). In some embodiments, there is provided a virus comprising the first transgene and the second transgene.

    [0215] In some embodiments, according to any of the complexes and/or nanoparticles described herein, the virus is a modified virus, including modified adeno-associated virus (AAV), adenovirus, lentivirus, retrovirus, herpes simplex virus (HSV), poxvirus, Epstein-Barr virus (EBV), vaccinia virus, and human cytomegalovirus (hCMV). In some embodiments, according to any of the complexes and/or nanoparticles described herein, the virus is an inactivated virus, including inactivated adeno-associated virus (AAV), adenovirus, lentivirus, retrovirus, herpes simplex virus (HSV), poxvirus, Epstein-Barr virus (EBV), vaccinia virus, and human cytomegalovirus (hCMV). In some embodiments, according to any of the complexes and/or nanoparticles described herein, the virus is a replication-deficient virus, including replication-deficient adeno-associated virus (AAV), adenovirus, lentivirus, retrovirus, herpes simplex virus (HSV), poxvirus, Epstein-Barr virus (EBV), vaccinia virus, and human cytomegalovirus (hCMV). In some embodiments, according to any of the complexes and/or nanoparticles described herein, the virus is only able to replicate in target cells.

    Nanoparticles

    [0216] In some embodiments, there is provided a nanoparticle for intracellular delivery of a cargo molecule that comprises a core comprising any one or more cargo delivery complex as described herein.

    [0217] In some embodiments, there is provided a nanoparticle for intracellular delivery of a cargo molecule comprising a core comprising one or more cargo delivery complexes described herein. In some embodiments, the nanoparticle core comprises a plurality of cargo delivery complexes. In some embodiments, the nanoparticle core comprises a plurality of cargo delivery complexes present in a predetermined ratio. In some embodiments, the predetermined ratio is selected to allow the most effective use of the nanoparticle in any of the methods described below in more detail. In some embodiments, the nanoparticle core further comprises one or more additional cell-penetrating peptides and/or one or more additional cargo.

    [0218] In some embodiments, there is provided a nanoparticle for intracellular delivery of a cargo molecule comprising a core comprising a cargo delivery complex described herein, wherein at least one cell-penetrating peptide in the cargo delivery complex is associated with the cargo. In some embodiments, the association is non-covalent. In some embodiments, the association is covalent.

    [0219] In some embodiments, the nanoparticle further comprises a surface layer (e.g., a shell) comprising a peripheral cell-penetrating peptide (i.e., CPP), wherein the core is coated by the shell. In some embodiments, the peripheral CPP is the same as a CPP in the core. In some embodiments, the peripheral CPP is different than any of the CPPs in the core. In some embodiments, the peripheral CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-4, VEPEP-5, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide. In some embodiments, the peripheral CPP is a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. IN some embodiments, the peripheral cell-penetrating peptide is selected from the group consisting of PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-6 peptides. VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, at least some of the peripheral cell-penetrating peptides in the surface layer are linked to a targeting moiety. In some embodiments, the linkage is covalent. In some embodiments, the covalent linkage is by chemical coupling. In some embodiments, the covalent linkage is by genetic methods. In some embodiments, the nanoparticle further comprises an intermediate layer between the core of the nanoparticle and the surface layer. In some embodiments, the intermediate layer comprises an intermediate CPP. In some embodiments, the intermediate CPP is the same as a CPP in the core. In some embodiments, the intermediate CPP is different than any of the CPPs in the core. In some embodiments, the intermediate CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide. In some embodiments, the intermediate CPP is a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.

    [0220] In some embodiments, according to any of the nanoparticles described herein, the mean size (diameter) of the nanoparticle is from about 20 nm to about 1000 nm, including for example from about 50 nm to about 800 nm, from about 75 nm to about 600 nm, from about 100 nm to about 600 nm, and from about 200 nm to about 400 nm. In some embodiments, the mean size (diameter) of the nanoparticle is no greater than about 1000 nanometers (nm), such as no greater than about any of 900, 800, 700, 600, 500, 400, 300, 200, or 100 nm. In some embodiments, the average or mean diameter of the nanoparticle is no greater than about 200 nm. In some embodiments, the average or mean diameters of the nanoparticles is no greater than about 150 nm. In some embodiments, the average or mean diameter of the nanoparticle is no greater than about 100 nm. In some embodiments, the average or mean diameter of the nanoparticle is about 20 nm to about 400 nm. In some embodiments, the average or mean diameter of the nanoparticle is about 30 nm to about 400 nm. In some embodiments, the average or mean diameter of the nanoparticle is about 40 nm to about 300 nm. In some embodiments, the average or mean diameter of the nanoparticle is about 50 nm to about 200 nm. In some embodiments, the average or mean diameter of the nanoparticle is about 60 nm to about 150 nm. In some embodiments, the average or mean diameter of the nanoparticle is about 70 nm to about 100 nm. In some embodiments, the nanoparticles are sterile-filterable.

    [0221] In some embodiments, the zeta potential of the nanoparticle is from about −30 mV to about 60 mV (such as about any of −30, −25, −20, −15, −10, −5, 0, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, and 60 mV, including any ranges between these values). In some embodiments, the zeta potential of the nanoparticle is from about −30 mV to about 30 mV, including for example from about −25 mV to about 25 mV, from about −20 mV to about 20 mV, from about −15 mV to about 15 mV, from about −10 mV to about 10 mV, and from about −5 mV to about 10 mV. In some embodiments, the polydispersity index (PI) of the nanoparticle is from about 0.05 to about 0.6 (such as about any of 0.05, 0.1, 0.15, 0.2, 0.25, 0.3, 0.35, 0.4, 0.45, 0.5, 0.55, and 0.6, including any ranges between these values). In some embodiments, the nanoparticle is substantially non-toxic.

    Compositions

    [0222] In some embodiments, there is provided a composition (e.g., a pharmaceutical composition) comprising a cargo delivery complex or nanoparticle as described herein. In some embodiments, the composition is a pharmaceutical composition comprising a cargo delivery complex or nanoparticle as described herein and a pharmaceutically acceptable diluent, excipient, and/or carrier. In some embodiments, the concentration of the complex or nanoparticle in the composition is from about 1 nM to about 100 mM, including for example from about 10 nM to about 50 mM, from about 25 nM to about 25 mM, from about 50 nM to about 10 mM, from about 100 nM to about 1 mM, from about 500 nM to about 750 μM, from about 750 nM to about 500 μM, from about 1 μM to about 250 μM, from about 10 μM to about 200 μM, and from about 50 μM to about 150 μM. In some embodiments, the pharmaceutical composition is lyophilized.

    [0223] The term “pharmaceutically acceptable diluent, excipient, and/or carrier” as used herein is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with administration to humans or other vertebrate hosts. Typically, a pharmaceutically acceptable diluent, excipient, and/or carrier is a diluent, excipient, and/or carrier approved by a regulatory agency of a Federal, a state government, or other regulatory agency, or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans as well as non-human mammals. The term diluent, excipient, and/or “carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the pharmaceutical composition is administered. Such pharmaceutical diluent, excipient, and/or carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin. Water, saline solutions and aqueous dextrose and glycerol solutions can be employed as liquid diluents, excipients, and/or carriers, particularly for injectable solutions. Suitable pharmaceutical diluents and/or excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like, including lyophilization aids. The composition, if desired, can also contain minor amounts of wetting, bulking, emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, sustained release formulations and the like. Examples of suitable pharmaceutical diluent, excipient, and/or carriers are described in “Remington's Pharmaceutical Sciences” by E. W. Martin. The formulation should suit the mode of administration. The appropriate diluent, excipient, and/or carrier will be evident to those skilled in the art and will depend in large part upon the route of administration.

    [0224] In some embodiments, a composition comprising a cargo delivery complex or nanoparticle as described herein further comprises a pharmaceutically acceptable diluent, excipient, and/or carrier. In some embodiments, the pharmaceutically acceptable diluent, excipient, and/or carrier affects the level of aggregation of a cargo delivery complex or nanoparticle in the composition and/or the efficiency of intracellular delivery mediated by a cargo delivery complex or nanoparticle in the composition. In some embodiments, the extent and/or direction of the effect on aggregation and/or delivery efficiency mediated by the pharmaceutically acceptable diluent, excipient, and/or carrier is dependent on the relative amount of the pharmaceutically acceptable diluent, excipient, and/or carrier in the composition.

    [0225] For example, in some embodiments, the presence of a pharmaceutically acceptable diluent, excipient, and/or carrier (such as a salt, sugar, chemical buffering agent, buffer solution, cell culture medium, or carrier protein) at one or more concentrations in the composition does not promote and/or contribute to aggregation of the cargo delivery complex or nanoparticle, or promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 200% (such as no more than about any of 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 90, 80, 70, 60, 50, 40, 30, 20, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1%, including any ranges between any of these values) larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises the pharmaceutically acceptable diluent, excipient, and/or carrier at a concentration that does not promote and/or contribute to aggregation of the cargo delivery complex or nanoparticle, or promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 200% (such as no more than about any of 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 90, 80, 70, 60, 50, 40, 30, 20, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1%, including any ranges between any of these values) larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises the pharmaceutically acceptable diluent, excipient, and/or carrier at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 150% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises the pharmaceutically acceptable diluent, excipient, and/or carrier at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 100% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises the pharmaceutically acceptable diluent, excipient, and/or carrier at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 50% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises the pharmaceutically acceptable diluent, excipient, and/or carrier at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 20% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises the pharmaceutically acceptable diluent, excipient, and/or carrier at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 15% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises the pharmaceutically acceptable diluent, excipient, and/or carrier at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 10% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the pharmaceutically acceptable diluent, excipient, and/or carrier is a salt, including, without limitation, NaCl. In some embodiments, the pharmaceutically acceptable diluent, excipient, and/or carrier is a sugar, including, without limitation, sucrose, glucose, and mannitol. In some embodiments, the pharmaceutically acceptable diluent, excipient, and/or carrier is a chemical buffering agent, including, without limitation, HEPES. In some embodiments, the pharmaceutically acceptable diluent, excipient, and/or carrier is a buffer solution, including, without limitation, PBS. In some embodiments, the pharmaceutically acceptable diluent, excipient, and/or carrier is a cell culture medium, including, without limitation, DMEM. Particle size can be determined using any means known in the art for measuring particle size, such as by dynamic light scattering (DLS). For example, in some embodiments, an aggregate having a Z-average as measured by DLS that is 10% greater than the Z-average as measured by DLS of a cargo delivery complex or nanoparticle is 10% larger than the cargo delivery complex or nanoparticle.

    [0226] In some embodiments, the composition comprises a salt (e.g., NaCl) at a concentration that does not promote and/or contribute to aggregation of the cargo delivery complex or nanoparticle, or promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 100% (such as no more than about any of 90, 80, 70, 60, 50, 40, 30, 20, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1%, including any ranges between any of these values) larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a salt (e.g., NaCl) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 75% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a salt (e.g., NaCl) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 50% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a salt (e.g., NaCl) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 20% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a salt (e.g., NaCl) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 15% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a salt (e.g., NaCl) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 10% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the concentration of the salt in the composition is no more than about 100 mM (such as no more than about any of 90, 80, 70, 60, 50, 40, 30, 20, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 mM, including any ranges between any of these values). In some embodiments, the salt is NaCl.

    [0227] In some embodiments, the composition comprises a sugar (e.g., sucrose, glucose, or mannitol) at a concentration that does not promote and/or contribute to aggregation of the cargo delivery complex or nanoparticle, or promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 25% (such as no more than about any of 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1%, including any ranges between any of these values) larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a sugar (e.g., sucrose, glucose, or mannitol) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 75% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a sugar (e.g., sucrose, glucose, or mannitol) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 50% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a sugar (e.g., sucrose, glucose, or mannitol) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 20% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a sugar (e.g., sucrose, glucose, or mannitol) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 15% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a sugar (e.g., sucrose, glucose, or mannitol) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 10% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the concentration of the sugar in the composition is no more than about 20% (such as no more than about any of 18, 16, 14, 12, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1%, including any ranges between any of these values). In some embodiments, the sugar is sucrose. In some embodiments, the sugar is glucose. In some embodiments, the sugar is mannitol.

    [0228] In some embodiments, the composition comprises a chemical buffering agent (e.g., HEPES or phosphate) at a concentration that does not promote and/or contribute to aggregation of the cargo delivery complex or nanoparticle, or promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 10% (such as no more than about any of 9, 8, 7, 6, 5, 4, 3, 2, or 1%, including any ranges between any of these values) larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a chemical buffering agent (e.g., HEPES or phosphate) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 7.5% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a chemical buffering agent (e.g., HEPES or phosphate) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 5% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a chemical buffering agent (e.g., HEPES or phosphate) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 3% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a chemical buffering agent (e.g., HEPES or phosphate) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 1% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a chemical buffering agent (e.g., HEPES or phosphate) at a concentration that does not promote and/or contribute to the formation of aggregates of the cargo delivery complex or nanoparticles. In some embodiments, the chemical buffering agent is HEPES. In some embodiments, the HEPES is added to the composition in the form of a buffer solution comprising HEPES. In some embodiments, the solution comprising HEPES has a pH between about 5 and about 9 (such as about any of 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, and 9, including any ranges between these values). In some embodiments, the composition comprises HEPES at a concentration of no more than about 75 mM (such as no more than about any of 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10 mM or less, including any ranges between any of these values). In some embodiments, the chemical buffering agent is phosphate. In some embodiments, the phosphate is added to the composition in the form of a buffer solution comprising phosphate. In some embodiments, the composition does not comprise PBS.

    [0229] In some embodiments, the composition comprises a cell culture medium (e.g., DMEM or Opti-MEM) at a concentration that does not promote and/or contribute to aggregation of the cargo delivery complex or nanoparticle, or promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 200% (such as no more than about any of 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 90, 80, 70, 60, 50, 40, 30, 20, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1%, including any ranges between any of these values) larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a cell culture medium (e.g., DMEM or Opti-MEM) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 150% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a cell culture medium (e.g., DMEM or Opti-MEM) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 100% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a cell culture medium (e.g., DMEM or Opti-MEM) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 50% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a cell culture medium (e.g., DMEM or Opti-MEM) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 25% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a cell culture medium (e.g., DMEM or Opti-MEM) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 10% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the cell culture medium is DMEM. In some embodiments, the composition comprises DMEM at a concentration of no more than about 70% (such as no more than about any of 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10%, or less, including any ranges between any of these values).

    [0230] In some embodiments, the composition comprises a carrier protein (e.g., albumin) at a concentration that does not promote and/or contribute to aggregation of the cargo delivery complex or nanoparticle, or promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 200% (such as no more than about any of 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 90, 80, 70, 60, 50, 40, 30, 20, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1%, including any ranges between any of these values) larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a carrier protein (e.g., albumin) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 150% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a carrier protein (e.g., albumin) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 100% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a carrier protein (e.g., albumin) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 50% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a carrier protein (e.g., albumin) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 25% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the composition comprises a carrier protein (e.g., albumin) at a concentration that promotes and/or contributes to the formation of aggregates of the cargo delivery complex or nanoparticles having a size no more than about 10% larger than the size of the cargo delivery complex or nanoparticle. In some embodiments, the carrier protein is albumin. In some embodiments, the albumin is human serum albumin.

    [0231] In some embodiments, a pharmaceutical composition as described herein is formulated for intravenous, intratumoral, intraarterial, topical, intraocular, ophthalmic, intraportal, intracranial, intracerebral, intracerebroventricular, intrathecal, intravesicular, intradermal, subcutaneous, intramuscular, intranasal, intratracheal, pulmonary, intracavity, or oral administration.

    [0232] Exemplary dosing frequencies include, but are not limited to, no more than once every three days.

    Methods of Preparation

    [0233] In some embodiments, there is provided a method of preparing a cargo delivery complex or nanoparticle as described herein.

    [0234] In some embodiments, there is provided a method of preparing the cargo delivery complex comprising a first peptide and a second peptide as described above, comprising a) combining the first peptide and the second peptide, thereby forming a peptide mixture; b) combining the peptide mixture with the cargo, thereby forming the cargo delivery complex.

    [0235] In some embodiments, there is provided a method of preparing the cargo delivery complex comprising a peptide and a cargo molecule as described above, comprising combining the peptide with the cargo molecule, thereby forming the cargo delivery complex.

    [0236] In some embodiments, the peptide or the peptide mixture and the cargo molecule are combined at a molar ratio from about 1:1 to about 100:1 (such as about between about 1:1 and about 50:1, or about 20:1), respectively.

    [0237] In some embodiments, the method comprises mixing a first solution comprising the cargo molecule with a second solution comprising the peptide or peptide mixture to form a third solution, wherein the third solution comprises or is adjusted to comprise i) about 0-5% sucrose, ii) about 0-5% glucose, iii) about 0-50% DMEM, iv) about 0-80 mM NaCl, or v) about 0-20% PBS, and wherein the third solution is incubated to allow formation of the cargo delivery complex. In some embodiments, the first solution comprises the cargo in sterile water and/or wherein the second solution comprises the peptide or peptide mixture in sterile water. In some embodiments, the third solution is adjusted to comprise i) about 0-5% sucrose, ii) about 0-5% glucose, iii) about 0-50% DMEM, iv) about 0-80 mM NaCl, or v) about 0-20% PBS after incubating to form the cargo delivery complex.

    [0238] In some embodiments, the method further comprises a filtration process, wherein the cargo delivery complex is filtered through a pore-sized membrane. In some embodiments, the pore has a diameter of at least about 0.1 μm (such as at least about 0.1 μm, 0.15 μm, 0.2 μm, 0.25 μm, 0.3 μm, 0.35 μm, 0.4 μm, 0.45 μm, 0.5 μm, 0.6 μm, 0.7 μm, 0.8 μm, 0.9 μm, 1.0 μm, 1.1 μm or 1.2 μm). In some embodiments, the pore has a diameter of no more about 1.2 μm, 1.0 μm, 0.8 μm, 0.6 μm, 0.5 μm, 0.45 μm, 0.4 μm, 0.35 μm, 0.3 μm, or 0.25 μm. In some embodiments, the port has a diameter of about 0.1 μm to about 1.2 μm (such as about 0.1 to about 0.8 μm, about 0.2 to about 0.5 μm).

    [0239] In some embodiments, for a stable composition comprising a cargo molecule delivery complex or nanoparticle of the application, the average diameter of the complex or nanoparticle does not change by more than about 100%, and the polydispersity index does not change by more than about 10%.

    [0240] Also provided are methods of preparing any of the peptides comprising cell-penetrating peptides described herein.

    Methods of Use

    [0241] The present application also provides methods of delivering one or more cargo into a cell. In some embodiments, the methods comprise contacting the cell with the cargo delivery complex or the nanoparticle, wherein the cargo delivery complex comprises one or more cargo.

    [0242] In some embodiments, there is provided a method of delivering one or more cargo into a cell, comprising contacting a cell with a cargo delivery complex described herein, wherein the cargo delivery complex comprises one or more cargo. In some embodiments, the cell is a cancer cell. In some embodiments, the cell is a human cell. In some embodiments, the cell expresses an antigen (such as a tumor antigen), wherein the cargo molecule in the cargo delivery complex specifically binds to or targets the antigen.

    [0243] The present application also provides methods of delivering one or more cargo into a tissue or organ of an individual, comprising administering into the individual an effective amount of the cargo delivery complexes, nanoparticles, or pharmaceutical compositions as described herein, wherein the tissue or organ is selected from the group consisting of liver, lung, kidney, brain, intestine, spleen, heart, muscle, and lymph node.

    [0244] In some embodiments, there is provided a method of delivering one or more cargo molecule into a tissue or organ of an individual, comprising administering into the individual an effective amount of a cargo delivery complex described herein, wherein the tissue or organ is selected from the group consisting of liver, lung, kidney, brain, intestine, spleen, heart, muscle, and lymph node. In some embodiments, the tissue or organ is selected from the group consisting of liver, lung, kidney, brain, spleen and lymph node.

    [0245] In some embodiments, there is provided a method of promoting retention of one or more cargo molecule in a tissue or organ of an individual, comprising administering into the individual an effective amount of a cargo delivery complex described herein, wherein the tissue or organ is selected from the group consisting of liver, lung, kidney, brain, intestine, spleen, heart, muscle, and lymph node. In some embodiments, the tissue or organ is selected from the group consisting of liver, lung, kidney, brain, spleen and lymph node.

    [0246] In some embodiments, there is provided a method of promoting stability of one or more cargo molecule in an individual, comprising administering into the individual an effective amount of a cargo delivery complex described herein.

    [0247] In some embodiments, there is provided a method of promoting retention of one or more cargo molecule in a tissue or organ of an individual, comprising a) combining a first peptide comprising a first cell-penetrating peptide and a second peptide comprising a second cell-penetrating peptide thereby forming a peptide mixture, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety; b) combining the peptide mixture with the cargo molecule, thereby forming the cargo delivery complex; and c) administering the cargo delivery complex into an individual. In some embodiments, the tissue or organ is selected from the group consisting of liver, lung, kidney, brain, intestine, spleen, heart, muscle, and lymph node. In some embodiments, the tissue or organ is selected from the group consisting of liver, lung, kidney, brain, spleen and lymph node. In some embodiments, there is provided a method of promoting stability of one or more cargo molecule in an individual, comprising a) combining a first peptide comprising a first cell-penetrating peptide and a second peptide comprising a second cell-penetrating peptide thereby forming a peptide mixture, wherein the second peptide comprises a polyethylene glycol (PEG) moiety that is covalently linked to the second cell-penetrating peptide, and wherein the first peptide does not have a PEG moiety; b) combining the peptide mixture with the cargo molecule, thereby forming the cargo delivery complex; and c) administering the cargo delivery complex into an individual. In some embodiments, the ratio of the first cell-penetrating peptide to the second cell-penetrating peptide is about 20:1 to about 1:1 (such as about 15:1 to about 2:1, about 10:1 to about 4:1). Examples of peptides (e.g., cell-penetrating peptides or peptides comprising cell-penetrating peptides), cargos, and PEG moiety include those described herein. In some embodiments, the PEG moiety is conjugated to the N- or C-terminus of the second cell-penetrating peptide. In some embodiments, the PEG moiety is conjugated to a site within the second cell-penetrating peptide.

    [0248] The present application also provides methods of delivering a cargo molecule into an organ/tissue in an individual, comprising administering into the individual a cargo delivery complex as described above.

    [0249] In some embodiments, there is provided a method of delivering a cargo molecule into an organ/tissue in an individual, comprising administering into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule, wherein the peptide further comprises a targeting sequence selected from the group consisting of SEQ ID NOs: 152-162. In some embodiments, the organ or tissue is a tumor tissue, kidney, pancreas, muscle, heart, brain, liver, kidney, lymph node, lung or spleen. In some embodiments, the cell-penetrating peptide is a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a PEP-1 peptide, a PEP-2 peptide, or a PEP-3 peptide. In some embodiments, the cell-penetrating peptides are selected from the group consisting of CADY, PEP-1 peptides, PEP-2 peptides, PEP-3 peptides, VEPEP-3 peptides, VEPEP-4 peptides, VEPEP-5 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid). Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0250] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., heart or muscle) in an individual, comprising administering (e.g., intravenously) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule (e.g., PNA, oligonucleotide, mRNA), wherein the peptide further comprises a targeting sequence LSSRLDA. In some embodiments, the peptide comprises a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 114. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0251] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., brain or liver) in an individual, comprising administering (e.g., intravenously) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule (e.g., siRNA/mRNA), wherein the peptide further comprises a targeting sequence SYTSSTM. In some embodiments, the peptide comprises a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 115, 128, 131, or 132. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid). Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0252] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., brain or lymph node) in an individual, comprising administering (e.g., intravenously) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule (e.g., siRNA/mRNA/peptide), wherein the peptide further comprises a targeting sequence KSYDTY. In some embodiments, the peptide comprises a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 116 or 119. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0253] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., heart or lung) in an individual, comprising administering (e.g., intravenously) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule (e.g., siRNA/mRNA), wherein the peptide further comprises a targeting sequence CARPAR In some embodiments, the peptide comprises a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 121 or 139. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0254] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., brain or lung) in an individual, comprising administering (e.g., intravenously) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule (e.g., siRNA/mRNA), wherein the peptide further comprises a targeting sequence TGNYKALHPDHNG. In some embodiments, the peptide comprises a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 122 or 123. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0255] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., lung, kidney, liver, tumor, pancreas) in an individual, comprising administering (e.g., intravenously or intramuscularly) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule (e.g., siRNA/mRNA/CRISPR molecule), wherein the peptide further comprises a targeting sequence YIGSR. In some embodiments, the peptide comprises a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 88, 94, 96, 98, 101, 103, 105-112, 125, 126, 130, and 135. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0256] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., lung, kidney, liver, spleen, brain, tumor, pancreas) in an individual, comprising administering (e.g., intravenously or intramuscularly) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule (e.g., siRNA/mRNA/CRISPR molecule), wherein the peptide further comprises a targeting sequence GYVS. In some embodiments, the peptide comprises a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 89, 95, 97, 99, 102, 104, 127, and 136. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0257] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., heart) in an individual, comprising administering (e.g., intravenously) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule (e.g., oligonucleotide), wherein the peptide further comprises a targeting sequence CKRAV. In some embodiments, the peptide comprises a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 117. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0258] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., brain) in an individual, comprising administering (e.g., intravenously or intramuscularly) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule (e.g., mRNA, siRNA, CRISPR molecule), wherein the peptide further comprises a targeting sequence THRPPNWSPV. In some embodiments, the peptide comprises a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1540, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 133 or 138. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0259] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., muscle, heart) in an individual, comprising administering (e.g., intravenously or intramuscularly) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule (e.g., mRNA, siRNA. CRISPR molecule), wherein the peptide further comprises a targeting sequence CKTRRVP. In some embodiments, the peptide comprises a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 134 or 137. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (11-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0260] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., muscle) in an individual, comprising administering (e.g., intravenously or intramuscularly) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide and b) a cargo molecule (e.g., peptide, protein, PNA), wherein the peptide further comprises a targeting sequence ASSLNIA. In some embodiments, the peptide comprises a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14, 75, 76, and 113-115. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40, 77, 85, 92-100, 105, 107-109, and 129-139. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52, 78, and 116-120. In some embodiments, the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70, 79, 80, 86-91, 101-104, 106, 110-112, and 121-128. In some embodiments, the peptide comprises an amino acid sequence set forth in SEQ ID NO: 113. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide via a linker. In some embodiments, the linker is selected from the group consisting of beta alanine, cysteine, cysteamide bridge, poly glycine (such as G2 or G4), a PEG linker moiety, Aun (I 1-amino-undecanoic acid), Ava (5-amino pentanoic acid), and Ahx (aminocaproic acid). In some embodiments, the linker comprises a PEG linker moiety. In some embodiments, the PEG linker moiety consists of about one to ten (such as about 1-8, 2-7, 1-5, or 6-10) ethylene glycol units. In some embodiments, the targeting sequence is covalently linked to N-terminus of the cell-penetrating peptide without a linker. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0261] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., pancreas, kidney) in an individual, comprising administering (e.g., intravenously) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide comprising an amino acid sequence set forth in SEQ ID NO: 75, and b) a cargo molecule (e.g., mRNA, protein, peptide, virus or virus like particle). In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0262] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., brain, liver, lung, kidney) in an individual, comprising administering (e.g., intravenously, intramuscularly) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide comprising an amino acid sequence set forth in SEQ ID NO: 78, and b) a cargo molecule (e.g., peptide, oligonucleotide, plasmid DNA, virus or virus like particle). In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0263] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., liver, lung, kidney, brain) in an individual, comprising administering (e.g., intravenously) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide comprising an amino acid sequence set forth in SEQ ID NO: 118, and b) a cargo molecule (e.g., peptide, oligonucleotide, plasmid DNA, virus or virus like particle). In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0264] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., liver, lung, kidney, pancreas) in an individual, comprising administering (e.g., intravenously, intramuscularly, subcutaneously) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide comprising an amino acid sequence set forth in SEQ ID NO: 79 or 80, and b) a cargo molecule (e.g., plasmid DNA, peptide, siRNA, CRISPR molecule, mRNA). In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0265] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., liver, lung, kidney, spleen) in an individual, comprising administering (e.g., intravenously, intramuscularly) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide, and b) a cargo molecule (e.g., plasmid DNA, siRNA, mRNA), wherein the cell-penetrating peptide is a retro-inverso peptide. In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or VEPEP-6 peptide. In some embodiments, the peptide comprises the amino acid sequence set forth in SEQ ID NO: 85 or 86. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    [0266] In some embodiments, there is provided a method of delivering a cargo molecule into an organ or tissue (e.g., liver) in an individual, comprising administering (e.g., intravenously, subcutaneously) into the individual a cargo delivery complex, wherein the cargo delivery complex comprises a) a peptide comprising a cell-penetrating peptide, and b) a cargo molecule (e.g., plasmid DNA, CRISPR molecule. mRNA), wherein the cell-penetrating peptide comprises a carbohydrate moiety (such as GalNAc). In some embodiments, the cell-penetrating peptide is an ADGN-100 peptide or VEPEP-6 peptide. In some embodiments, the peptide comprises the amino acid sequence set forth in SEQ ID NO: 124 or 129. In some embodiments, the peptide further comprises one or more moieties linked to the N-terminus of the targeting sequence, wherein the one or more moieties are selected from the group consisting of an acetyl group and a stearyl group. In some embodiments, the cargo molecule is selected from the group consisting of a nucleic acid, a virus, a polypeptide, a protein/nucleic complex, virus like particles, and a protein complex.

    Disease and Conditions

    [0267] The present application also provides methods of treating a disease or condition in an individual, comprising administering into the individual an effective amount of the cargo delivery complex, nanoparticles, or pharmaceutical compositions as described herein. In some embodiments, the disease or condition is associated with a pathological cell in an organ or tissue selected from the group consisting of liver, lung, kidney, brain, intestine, spleen, heart, muscle, and lymph node. In some embodiments, the disease or condition is selected from the group consisting of cancer, diabetes, autoimmune diseases, hematological diseases, cardiac diseases, vascular diseases, inflammatory diseases, fibrotic diseases, viral infectious diseases, hereditary diseases, ocular diseases, liver diseases, lung diseases, muscle diseases, protein deficiency diseases, lysosomal storage diseases, neurological diseases, kidney diseases, aging and degenerative diseases, and diseases characterized by cholesterol level abnormality.

    [0268] In some embodiments of the methods described herein, the disease to be treated is cancer. In some embodiments, the cancer is a solid tumor, and the pharmaceutical composition comprises a cargo delivery complex or nanoparticle comprising one or more mRNA that encode proteins including, but not limited to, growth factors and cytokines, cell surface receptors, signaling molecules and kinases, transcription factors and other modulators of transcription, regulators of protein expression and modification, tumor suppressors, and regulators of apoptosis and metastasis.

    [0269] In some embodiments, the solid tumor includes, but is not limited to, sarcomas and carcinomas such as fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, Kaposi's sarcoma, soft tissue sarcoma, uterine sacronomasynovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma, and retinoblastoma.

    [0270] In some embodiments, the cargo delivery complexes or nanoparticles in accordance with the present invention may be used for treatment of any of a variety of diseases, disorders, and/or conditions, including but not limited to one or more of the following: autoimmune disorders (e.g. diabetes, lupus, multiple sclerosis, psoriasis, rheumatoid arthritis); inflammatory disorders (e.g. arthritis, pelvic inflammatory disease); infectious diseases (e.g. viral infections (e.g., HIV, HCV, RSV, Chikungunya virus, Zika virus, influenza virus), bacterial infections, fungal infections, sepsis); neurological disorders (e.g. Alzheimer's disease, Huntington's disease; autism; Duchenne muscular dystrophy); cardiovascular disorders (e.g. atherosclerosis, hypercholesterolemia, thrombosis, clotting disorders, angiogenic disorders such as macular degeneration); proliferative disorders (e.g. cancer, benign neoplasms); respiratory disorders (e.g. chronic obstructive pulmonary disease); digestive disorders (e.g. inflammatory bowel disease, ulcers); musculoskeletal disorders (e.g. fibromyalgia, arthritis); endocrine, metabolic, and nutritional disorders (e.g. diabetes, osteoporosis); urological disorders (e.g. renal disease); psychological disorders (e.g. depression, schizophrenia); skin disorders (e.g. wounds, eczema); blood and lymphatic disorders (e.g. anemia, hemophilia); etc.

    [0271] In some embodiments, the cargo delivery complexes or nanoparticles described herein can be used for treating diseases characterized by dysfunctional or aberrant protein activity include cystic fibrosis, sickle cell anemia, epidermolysis bullosa, amyotrophic lateral sclerosis, and glucose-6-phosphate dehydrogenase deficiency. For example, the present invention provides a method for treating such conditions or diseases in a subject by administering a cargo delivery complex comprising a nucleic acid or cell-based therapeutic containing an mRNA, wherein the mRNA encode for a protein that antagonizes or otherwise overcomes the aberrant protein activity present in the cell of the subject. Specific examples of a dysfunctional protein are the missense mutation variants of the cystic fibrosis transmembrane conductance regulator (CFTR) gene, which produce a dysfunctional protein variant of CFTR protein, which causes cystic fibrosis.

    [0272] Diseases characterized by missing (or substantially diminished such that proper (normal or physiological protein function does not occur) protein activity include cystic fibrosis, Niemann-Pick type C, .beta, thalassemia major, Duchenne muscular dystrophy, Hurler Syndrome, Hunter Syndrome, and Hemophilia A. Such proteins may not be present, or are essentially non-functional. The present invention provides a method for treating such conditions or diseases in a subject by administering a cargo delivery complex comprising a nucleic acid or cell-based therapeutic containing an mRNA, wherein the mRNA encode for a protein that replaces the protein activity missing from the target cells of the subject. Specific examples of a dysfunctional protein are the nonsense mutation variants of the cystic fibrosis transmembrane conductance regulator (CFTR) gene, which produce a nonfunctional protein variant of CFTR protein, which causes cystic fibrosis.

    [0273] In some embodiments of the methods described herein, the disease to be treated is cancer, wherein the cancer is a solid tumor, and the pharmaceutical composition comprises an cargo delivery complex or nanoparticle comprising one or more mRNA encoding proteins involved in tumor development and/or progression. In some embodiments, the mRNA encodes proteins involved in tumor development and/or progression include, but are not limited to, IL-2, IL-12, interferon-gamma, GM-CSF, B7-1, caspase-9, p53, MUC-1, MDR-1, HLA-B7/Beta 2-Microglobulin, Her2, Hsp27, thymidine kinase, and MDA-7, including mutants thereof. In some embodiments, the mRNA encodes a protein, such as a therapeutic protein. In some embodiments, mRNA encodes a CAR. In some embodiments, the complex or nanoparticle comprises a plurality of mRNA encoding a plurality of protein. In some embodiments, the complex or nanoparticle comprises a plurality of mRNA encoding a single protein. In some embodiments, the complex or nanoparticle comprises a single mRNA encoding a first protein and a second protein. In some embodiments, the complex or nanoparticle further comprises a RNAi such as siRNA, such as an RNAi targeting an endogenous gene, e.g., a disease-associated endogenous gene. In some embodiments, the RNAi targets an exogenous gene. In some embodiments, the RNAi is a therapeutic RNAi targeting an endogenous gene involved in a disease or condition, and the protein is a therapeutic protein useful for treating the disease or condition. In some embodiments, the complex or nanoparticle comprises a therapeutic mRNA and a therapeutic RNAi, wherein the therapeutic RNAi targets a disease-associated form of the endogenous gene (e.g., a gene encoding a mutant protein, or a gene resulting in abnormal expression of a protein), and the therapeutic mRNA corresponds to a therapeutic form of the endogenous gene (e.g., the second transgene encodes a wild-type or functional form of the mutant protein, or the second transgene results in normal expression of the protein).

    [0274] In some embodiments of the methods described herein, the pharmaceutical composition is administered to the individual by any of intravenous, intratumoral, intraarterial, topical, intraocular, ophthalmic, intraportal, intracranial, intracerebral, intracerebroventricular, intrathecal, intravesicular, intradermal, subcutaneous, intramuscular, intranasal, intratracheal, pulmonary, intracavity, intratraccheal instillation, nebulization, or oral administration.

    [0275] In some embodiments of the methods described herein, the individual is a mammal. In some embodiments, the individual is human.

    Kits

    [0276] Also provided herein are kits, reagents, and articles of manufacture useful for the methods described herein. Such kits may contain the cargo delivery complexes, nanoparticles, or pharmaceutical compositions as described herein.

    [0277] The kits described herein may further comprise instructions for using the components of the kit to practice the subject methods (for example instructions for making the pharmaceutical compositions described herein and/or for use of the pharmaceutical compositions). The instructions for practicing the subject methods are generally recorded on a suitable recording medium. For example, the instructions may be printed on a substrate, such as paper or plastic, etc. As such, the instructions may be present in the kits as a package insert, in the labeling of the container of the kits or components thereof (i.e., associated with the packaging or sub packaging) etc. In some embodiments, the instructions are present as an electronic storage data file present on a suitable computer readable storage medium, e.g., CD-ROM, diskette, etc. In yet other embodiments, the actual instructions are not present in the kit, but means for obtaining the instructions from a remote source, e.g., via the internet, are provided. An example of this embodiment is a kit that includes a web address where the instructions can be viewed and/or from which the instructions can be downloaded. As with the instructions, this means for obtaining the instructions is recorded on a suitable substrate

    [0278] The various components of the kit may be in separate containers, where the containers may be contained within a single housing, e.g., a box.

    EXAMPLES

    [0279] Those skilled in the art will recognize that several embodiments are possible within the scope and spirit of this invention. The invention will now be described in greater detail by reference to the following non-limiting examples. The following examples further illustrate the invention but, of course, should not be construed as in any way limiting its scope.

    Example 1: Optimization of ADGN-Peptides/mRNA/Plasmid-DNA/siRNA Nanoparticles for In Vivo Applications

    Materials

    [0280] mRNA: CleanCap™ Luc mRNA (5moU) was obtained for Trilink Biotechnology (USA).

    [0281] Plasmid: pGL4 reporter vector expressing luciferase under CMV promoter was obtained by Promega.

    [0282] siRNA luc: siRNA targeting Luciferase Luc2 5′ CUU-ACG-CUG-AGU-ACU-UCG-ATT-3′ (sense strand) and 5′-UCG-AAG-UAC-UCA-GCG-UAA-GT-3′(antisense strand) were obtained from Eurogentec.

    [0283] ADGN Peptides: the following peptides were used:

    TABLE-US-00001 ADGN-106: βALWRALWRLWRSLWRLLWKA ADGN-106-RI: akwllrwlsrwlrwlarwlr ADGN-106-PEG7: Ac-(PEG)7-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-PEG2: Ac-(PEG)2-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-Hydro-1: Ac-YIGSR-(G)4-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106 hydro-2: Ac-GYVS-(G)4-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-Hydro-3: Ac-YIGSR-Ava(CH2).sub.2-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106 hydro-4: Ac-GYVS-Ava(CH2).sub.2-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-Hydro-5: Ac-YIGSR-Aun(CH2).sub.6-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106 hydro-6: Ac-GYVS-Aun(CH2).sub.6-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-Hydro-8: Ac-YIGSR-Ahx-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106 Stearyl: Stearyl-βA-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-100: βAKWRSAGWRWRLWRVRSWSR ADGN-100-RI: rswsrvrwlrwrwgasrwk ADGN-100-PEG7: Ac-(PEG)7-βA-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100-PEG2: Ac-(PEG)2-βA-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100-Hydro-1: Ac-YIGSR-(G)4-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100 hydro-2: Ac-GYVS-(G)4-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100-Hydro-3: Ac-YIGSR-Ava-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100 hydro-4: Ac-GYVS-Ava-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100-Hydro-5: Ac-YIGSR-Aun-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100 hydro-6: Ac-GYVS-Aun-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100-Hydro-8: Ac-YIGSR-Ahx-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100 Stearyl: Stearyl-βA-KWRSALWRWRLWRVRSWSR-NH2 ADGN-103C: Ac-ASSLNIA-Ava-KWWERWWREWPRKRR-NH2 ADGN-104 Ac-LSSRLDA-Ava-KWWERWWREWPRKRR ADGN-105 Ac-SYTSSTM-Ava-KWWERWWREWPRKRR ADGN-106TB: Ac-SYTSSTM-Ava-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-109: Ac-KSYDTY-Ava-ALRWLRWASRWFSRWAWR-NH2 ADGN-109D: Ac-KSYDTYAAETR-RWASRWFSRWAWWR-NH2 ADGN-109b: Ac-CKRAV-RWWLRWASRWFSRWAWWR-NH2 ADGN-101: Ac-CARPAR-WRSAGWRWRLWRVRSWSR-NH2 ADGN-102: Ac-TGNYKALHPDHNG-WRSALRWRLWRWSR-NH2 ADGN-100GALNAC: Ac-KWRSA(GalNac)LWRWRLWRVRSWSR-NH2 ADGN-106GALNAC: AC-ALWRA(GalNac)LWRLWRSLWRLLWKA-NH2 ADGN-106TC: Ac-THRPPNWSPVWP-RALWRLWRSLWRLRWKA-NH2 ADGN-106TD: Ac-CKTRRVP-WRALWRLWRSLWRLLWKA-NH2

    [0284] It was noted that the yield of peptide preparation is about 20 fold higher with the ones obtained with a Ahx linker.

    [0285] Cell lines: 293T cells (ATCC® 9 CRL-3216™) and HepG2 (ATCC® HB-8065™) cells were obtained from ATCC. SKOV-3/Luc Cells and A375/Luc cells were obtained from clinisciences.

    Methods

    [0286] Complex formation with mRNA. The following protocols were used for the transfection of 2-5 106 Cells or Cells at confluency of about 70-80% cultured in 24 well plates. ADGN peptide/mRNA particles were prepared at a 20:1 molar ratio of ADGN-Peptide/mRNA, using (0.25 μg) mRNA. Luc mRNA (0.25 μg) was diluted in 20 μl of sterile water (GIBCO) at room temperature. 5 μl Final Peptide Solution was added to obtain a total volume of 20 μl. The volume was adjusted to 50 μl with sterile water and was mixed gently with vortex 1 min low speed and incubated 30 min at room temperature. Then the volume was made up to 100 μl by adding sterile water containing 5% sucrose, and the solution was mixed gently with vortex 1 min low speed and incubate 5 min at 37° C., and then was proceeded to cell transfection.

    [0287] Optimized Complex formation with mRNA. ADGN peptide/mRNA/gRNA particles were prepared at a 2:1 molar ratio (2×) of ADGN-Peptide/nucleic acid. ADGN/CAS9mRNA/sgRNA complexes were prepared at a 1:2 molar ratio (2×) with 0.2 μg mRNA: 0.15 μg sgRNA and 5% Glucose or DMEM (example for 96 well plates). Premixed CAS9 mRNA/gRNA (5 μg/15 μg) were prepared in sterile water at room temperature in a glass vial (1-4 ml). ADGN-peptide solution was added dropwise (1 drop/sec) under magnetic agitation at 400 rpm to obtain a 1:2 ratio. The solution was then incubated for 30 minutes at room temperature or 37° C. Just before transfection, 150 μl Glucose or DMEM was added. The solution was then mixed under magnetic agitation at 400 rpm for 1 minute then incubated for 5 min at 37° C. Then, the solution was ready for cell transfection or IV administration. Prior to IV administration, complexes were diluted in sucrose 5% solution.

    [0288] Complex formation with plasmid DNA. The following protocols were used for the transfection of 2-5 106 Cells or Cells at confluency of about 70-80% cultured in 24 well plates. ADGN peptide/plasmid DNA pGL4 particles were prepared at a 20:1 molar ratio of ADGN-Peptide/pGL4, using (0.2 μg). PGL4 plasmid (0.15 μg) was diluted in 20 μl of sterile water (GIBCO) at room temperature. 10 μl Final Peptide Solution was added to obtain a total volume of 20 μl. The volume was adjusted to 50 μl with sterile water and was mixed gently with vortex 1 min low speed and incubated 30 min at room temperature. Then the volume was made up to 100 μl by adding sterile water containing 5% sucrose, and the solution was mixed gently with vortex 1 min low speed and incubate 5 min at 37° C., and then was proceeded to cell transfection.

    [0289] Complex formation with siRNA. The following protocols were used for the transfection of 2-5 106 Cells or Cells at confluency of about 70-80% cultured in 24 well plates. ADGN peptide/siRNA Luc particles were prepared at a 20:1 molar ratio of ADGN-Peptide/pGL4, using 20 nM siRNA. The siRNA duplex (10 and 25 nM) was diluted in 20 μl of sterile water (GIBCO) at room temperature. 1.5 or 3 μl of a Final Peptide Solution (55 μM) was added to obtain a total volume of 20 μl. The volume was adjusted to 50 μl with sterile water and was mixed gently with vortex 1 min low speed and incubated 30 min at room temperature. Then the volume was made up to 100 μl by adding sterile water containing 5% sucrose, and the solution was mixed gently with vortex 1 min low speed and incubate 5 min at 37° C., and then was proceeded to cell transfection.

    [0290] Transfection protocol Protocol is reported for 24 well plate format. Cells were cultured in Dulbecco's Modified Eagle's Medium (DMEM), supplemented with 2 mM glutamine, 1% antibiotics (streptomycin 10,000 μg/mL, penicillin, 10,000 IU/mL) and 10% (w/v) foetal calf serum (FCS), at 37° C. in a humidified atmosphere containing 5% CO2, 24 well plates seeded with 150,000 cells the day prior to transfection were grown to 50-60% confluence and set up to be at about 70% confluences at the time of transfection. Before transfection, cells were washed twice with DMEM. Cells were then overlaid with 0.1 ml of ADGN-peptide/cargo complex solution containing 0.25 μg mRNA, 0.15 μg plasmid DNA or 10-25 nM siRNA, mixed gently, and incubated for 10 min at 37° C. 0.2 mL of fresh DMEM, were added and cells were incubated for 20 min at 37° C. 1 mL of complete DMEM containing 15% FCS were then added in order to reach a final FCS concentration of 10%, without removing the overlay of ADGN-peptide/cargo complexes. Cells were returned to the incubator (37° C., 5% CO2) and 72 hrs post transfection.

    Results

    [0291] The purpose of the study was to evaluate which ADGN formulations may result in superior ADGN-nanoparticles with mRNA or plasmid DNA or siRNA for in vivo systemic IV and topical or IM delivery. Several different modifications of ADGN peptides have been evaluated, including stearyl, PEGylation with different PEG length, signaling sequences and retro-inverso transformation. Retro-inverso peptides-peptides consists of D-amino acids in the reverse sequence of the naturally occurring L-isoforms to investigate if they result in proteolytically stable peptide analogues while maintaining the structural features. The ADGN-peptide/cargo formulations have been characterized in vitro and their potency to deliver mRNA, plasmid DNA and siRNA was evaluated on cultured cells and in vivo.

    Example 2: Characterization and Stability of ADGN-Peptide Variant/mRNA Complexes

    [0292] The ability of the different ADGN-peptides to form stable nanoparticles with mRNA was analyzed. The particle sizes and level of aggregation were measured on DLS NanoZS (Malvern Ltd). The mean size and the polydispersity of the ADGN/mRNA complexes were determined at 25° C. for 3 minute per measurement. In order to remove large particles, ADGN/mRNA complexed were filtered using either PES or PVDF 0.45 μm filters. Data are shown in FIG. 8 and FIG. 9 for a mean of 3 separate experiments.

    [0293] As reported in FIG. 8, all ADGN-100 peptides formed stable nanoparticles with mRNA with a mean size ranging between 100 to 160 nm. ADGN/mRNA complex solution contained a small fraction, between 5% to 13%, of nanoparticles with mean size higher than 400 nm. Retro inverso modifications of ADGN-100 did not modify the ability of the peptide to form stable complex with mRNA. Highly homogenous nanoparticles, with less than 4% aggregates are obtained with ADGN-100Retro inverso, ADGN-100 Hydro5 and ADGN-100 Hydro6 peptides.

    [0294] As reported in FIG. 9, all ADGN-106 peptides formed stable nanoparticles with mRNA with a mean size ranging between 110 to 160 nm. ADGN/mRNA complex solution contained a small fraction, between 5% to 13%, of nanoparticles with mean size higher than 400 nm. Retro inverso modifications of ADGN-106 did not modify the ability of the peptide to form stable complex with mRNA. Highly homogenous nanoparticles, with less than 3% aggregates are obtained with ADGN-106 Retro inverso and ADGN-100 Hydro6 peptides.

    [0295] For both ADGN-100 and ADGN-106 peptide variants, the large particles and aggregates are efficiently removed by filtration on 0.45 μm filters and results in about 15-20% loss of material in PES filter and about 30% in PVDF filter. Therefore a filtration step with 0.45 μm PES filters will be added for further investigation.

    Example 3: Characterization and Stability of ADGN-Peptide Variant/DNA Plasmid Complexes

    [0296] The ability of the different ADGN-peptides to form stable nanoparticles with DNA pGL4 a 5.6KpB plasmid expression Luciferase was analyzed. The particle sizes and level of aggregation were measured on DLS NanoZS (Malvern Ltd). The mean size and the polydispersity of the ADGN/plasmid DNA complexes were determined at 25° C. for 3 minute per measurement. In order to remove large particles, ADGN/plasmid DNA complexed were filtered using either PES or PVDF 0.45 μm filters. Data are shown in FIG. 10 for a mean of 3 separate experiments.

    [0297] As reported in FIG. 10, All ADGN peptides, except ADGN-106, ADGN-106RI, ADGN-100HYDRO2A and ADGN-100HYDRO3, formed stable nanoparticles with PGL4 in the range of 100-150 nm. Stable ADGN/plasmid DNA complex solution contained a small fraction, between 5% to 20%, of nanoparticles with mean size higher than 400 nm. The large particles and aggregates are efficiently removed by filtration on 0.45 μm filters and results in about 15-30% loss of material in PES filter and about 40% in PVDF filter. Therefore a filtration step with 0.45 μm PES filters will be added for further investigation. Retro inverso modification of ADGN-100 did not modify the ability of the peptide to form stable complex with plasmid DNA. Retro inverso modification of ADGN-106 did not improve the potency of ADGN-106 to form stable particle with plasmid. Highly homogenous nanoparticles, with less than 4% aggregates are obtained with ADGN-100 Retro inverso, ADGN-100 Hydro5 and ADGN-100 Hydro6 peptides.

    Example 4: ADGN-Peptide Variants Improve Cargo Delivery in 293T Cells

    [0298] ADGN-peptides were evaluated for cellular delivery of Luciferase mRNA in 293T cells. A single dose of mRNA of 0.25 μg was evaluated. Luc mRNA (0.25 μg) in sterile water (GIBCO) were mixed with ADGN-100, ADGN-100RI, ADGN-106, ADGN-106RI, ADGN-100 Stearyl, ADGN-Hydro1, ADGN-Hydro2, ADGN-Hydro5 and ADGN-Hydro6. ADGN-peptide/mRNA complexes were filtered with 0.45 μm PES filter. In order to evaluate the stability of the ADGN/mRNA complexes in high serum and cell culture conditions, the complexes were incubated for 3 hrs in the presence of either 25% serum or heparan sulfate prior transfection, then 293T cells were transfected and Luciferase expression was monitored at 72 hrs.

    [0299] As reported in FIGS. 1A and 1B, filtration did not affect ADGN particle efficiency. In the absence of serum or of heparan sulfate treatments, high level of luciferase expression was obtained for both ADGN-100 and ADGN-106 peptides, ADGN-106 being 2 fold more potent than ADGN-100. Luciferase expression is not significantly affected by the presence of stearyl. Hydro5 and Hydro 6 motif linked to ADGN peptide. In contrast, the presence of Hydro1 and Hydro2 motif reduced by 20 to 50% efficiency of ADGN peptide. Retro-inverso modification did not modify ADGN-100 and ADGN-106 efficiency.

    [0300] The presence of serum or of heparan sulfate reduced the stability of the ADGN/mRNA complexes, which is correlated with a significant decrease in luciferase expression. ADGN-106 efficiency is reduced by 71% in the presence of serum and 50% in heparan sulfate and ADGN-100 efficiency is reduced by 90% in serum and 50% in heparan. The presence of Stearyl or Hydro-1, Hydro-5 and Hydro-6 motifs stabilized ADGN/mRNA particles and luciferase expression is reduced by only 30-40% in serum and 10-20% in heparan sulfate. Introducing Retro-inverso modification strongly stabilized the ADGN-mRNA complexes particularly in the presence of serum and heparan sulfate. ADGN-100 RI mediated luciferase expression is reduced by 40% in the presence of serum and by 16% with heparan sulfate. ADGN-106RI mediated luciferase expression is reduced by 26% in the presence of serum and by 13% with heparan sulfate.

    [0301] Luc mRNA (0.25 μg) were associated to ADGN-100 or ADGN-106 solution containing 10% or 20% of ADGN-100-PEG and to ADGN-106 containing 10% or 20% of ADGN-106-PEG. Combining ADGN-100 or ADGN-106 with 10% or 20% of pegylated ADGN-100 or pegylated ADGN-106 significantly stabilized complexes. Transfection efficiency after serum treatment is reduced by only 20% or 17% using ADGN-100 PEG 10% and 20% respectively.

    [0302] In order to evaluate the impact of the linker sequence, the YIGSR targeting sequence was linked to ADGN-106 using various linker motifs.

    TABLE-US-00002 ADGN-106: Ac-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-Hydro: Ac-YIGSR-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-HYPEG2: Ac-YIGSR-(PEG)2-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-HYPEG4: Ac-YIGSR-(PEG)4-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-HYPEG7: Ac-YIGSR-(PEG)7-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-Hydro-1: Ac-YIGSR-(G)4-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-Hydro-7: Ac-YIGSR-(G)2-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-Hydro-3: Ac-YIGSR-Ava(CH2).sub.2-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-Hvdro-5: Ac-YIGSR-Aun(CH2).sub.6-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-Hydro-8: Ac-YIGSR-Ahx-ALWRALWRLWRSLWRLLWKA-NH2

    [0303] ADGN-106 peptides containing YIGSR targeting sequence were evaluated for cellular delivery of Luciferase mRNA in 293T cells. A single dose of mRNA of 0.25 μg was evaluated. Luc mRNA (0.25 μg) in sterile water (GIBCO) were mixed with ADGN-106 and ADGN-106Hydro variant. ADGN-peptide/mRNA complexes were filtered with 0.45 μm PES filter. The ADGN-106/mRNA complexes were incubated for 3 hrs in the presence of 25% serum prior transfection, then 293T cells were transfected and Luciferase expression was monitored at 72 hrs.

    [0304] As reported in FIG. 1C, in the absence of serum treatment, high level of luciferase expression was obtained for ADGN-106, ADGN-106 Hydro. ADGN-106HYPEG2, ADGN-106-Hydrol, hydro3, hydro5 and hydro8 suggesting that using linkers such as beta Ala, PEG2, Ava, Aun, Ahx, and (Gly)4, do not affected transfection efficiency. In contrast, using PEG4, PEG7 and Gly-Gly as linker, reduced luciferase expression by 35%, 72% and 28%, respectively.

    [0305] In the presence of serum the stability of the ADGN-106/mRNA complexes, is significantly reduced which is correlated with a significant decrease in luciferase expression. ADGN-106 and ADGN-106Hydro efficiency are reduced by 80%. Using PEG2, Ava, Ahx. (Gly)4 and Aun as a linker reduced the impact of the serum on the stability of the particles. Best results were obtained with Aun>Ahx>PEG2>Ava>Gly.sub.4 linkers with a decrease in luciferase expression of 15%, 17%, 21%, 32% and 40%, respectively. The results demonstrated that both the length and the nature of the linker are important and the best results are obtained for (CH2).sub.4 motifs.

    [0306] The results demonstrated that ADGN-100 and ADGN-106 promote efficient delivery of mRNA in 293T cells. Filtration can be used to clarify nanoparticle preparation without affecting efficiency. The results showed than using retro-inverso or hydro-6 modification of ADGN peptides, or combining 10% to 20% of pegylated-ADGN peptide within the ADGN/mRNA particles strongly stabilize the complexes in the presence of high serum conditions.

    Example 5: ADGN-Peptide Variants Improve pGL4 DNA Plasmid Delivery in 293T Cells

    [0307] ADGN-peptides were evaluated for cellular delivery of pGL4 plasmid DNA expressing Luciferase in 293T cells. Luc pGL4 plasmid (0.15 μg) in sterile water (GIBCO) were mixed with ADGN-100, ADGN-100RI, ADGN-106, ADGN-106RI, ADGN-100 Stearyl, ADGN-100Hydro1, ADGN-100Hydro2, ADGN-100Hydro4, ADGN-100Hydro3, ADGN-100Hydro5 and ADGN-100Hydro6. ADGN-peptide/mRNA complexes were filtered with 0.45 μm PES filter. In order to evaluate the stability of the ADGN/pGL4 plasmid complexes in high serum and cell culture conditions, the complexes were incubated for 3 hrs in the presence of either 25% serum or heparan sulfate prior transfection, then 293T cells were transfected and Luciferase expression was monitored at 72 hrs.

    [0308] As reported in FIGS. 2A and 2B, filtration does not affect ADGN particle efficiency. In the absence of serum or of heparan sulfate treatments, high level of luciferase expression was obtained with ADGN-100 and ADGN-100 variant peptides. The presence of Hydro1, 2, 3, 4, 5 motifs reduced by 20 to 40% ADGN-100 efficiency. In contrast, Stearyl, retro inverso and Hydro 6 modifications do not affected ADGN-100 efficiency. As shown in FIGS. 2A and B, poor luciferase expression was monitored using ADGN-106 and ADGN-106RI in the absence or presence of serum, which correlated well with the large size and a the poor stability of ADGN-106/plasmid DNA particles. The presence of serum or of heparan sulfate reduced the stability of the ADGN/pGL4 plasmid complexes, which is correlated with a significant decrease in luciferase expression. ADGN-100 efficiency is reduced by 90% in the presence of serum and 50% in heparan sulfate. The presence of Stearyl or Hydro-1, Hydro-5 and Hydro-6 motifs stabilized ADGN/pGL4 particles and luciferase expression is reduced by only 30-40% in serum and 10-20% in heparan sulfate. In contrast, Hydro-2, Hydro-3 and hydro-4 modification do not significantly improved transfection in the presence of serum and upon heparan treatment. Introducing Retro-inverso modification strongly stabilized the ADGN-Plasmid DNA complexes in particularly in the presence of serum and heparan sulfate. ADGN-100RI mediated luciferase expression is reduced by 25% in the presence of serum and by less than 10% with heparan sulfate.

    [0309] We have evaluated the impact of combining ADGN-100 with PeGylated ADGN-100 on the transfection efficiency, pGL4 luc plasmid (0.15 μg) were associated to ADGN-100 solution containing 5 to 50% of ADGN-100-PEG or to ADGN-100PEG. As reported in FIG. 2C, combining ADGN-100 with 10% or 20% of pegylated ADGN-100 significantly stabilized complexes. Transfection efficiency is increased in the presence of 25% serum, by 2.3 and 2.4 folds. In contrast, using 50% and 100% ADGN-100 PEG reduced by 50% and 80% level of Luciferase expression.

    [0310] The results demonstrated that ADGN-100 promote efficient delivery of plasmid DNA in 293T cells. Filtration can be used to clarify nanoparticle preparation without affecting efficiency. The results showed than using stearylation, retro-inverso or Hydro-6 modification of ADGN peptides, or combining 10% to 20% of pegylated-ADGN peptide within the ADGN/Plasmid particles strongly stabilize the complexes in the presence of high serum conditions.

    Example 6: ADGN-Peptide Variants Improve siRNA Delivery in A375/Luc Cells

    [0311] ADGN-peptides were evaluated for cellular delivery of siRNA duplex targeting Luciferase in A375/Luc cells, siRNA targeting luciferase (10 and 25 nM) in sterile water (GIBCO) were mixed with ADGN-100, ADGN-100RI, ADGN-106, ADGN-106RI, ADGN-100 Stearyl, ADGN-100Hydro1, ADGN-100Hydro2, ADGN-10k)Hydro4, ADGN-100Hydro3, ADGN-100Hydro5 and ADGN-100Hydro6. ADGN-peptide/siRNA complexes were filtered with 0.45 μm PES filter. In order to evaluate the stability of the ADGN/siRNA complexes in high serum conditions, the complexes were incubated for 3 hrs in the presence of 25% serum, then A375/Luc cells were transfected and Luciferase expression was monitored at 48 hrs.

    [0312] As reported in FIGS. 3A and 3B, In the absence of serum treatment, high level of siRNA mediated luciferase silencing was obtained with both ADGN-100 and ADGN-106 peptides. Level of luciferase ix reduced by 78% using 10 nM siRNA and 93% using 25 nM siRNA. The presence of Hydro1, 2, 3, 4, 5 motifs reduced by 50 to 90% ADGN-100 or ADGN-106 efficiency. In contrast, Stearyl, retro inverso and Hydro 6 modifications do not affected ADGN-100 and ADGN-106 efficiency. The presence of serum reduced the stability of the ADGN/siRNA complexes, which is correlated with a significant decrease in siRNA mediated luciferase silencing. ADGN-100 and ADGN-106 efficiency are reduced by 90% in the presence of serum. The presence of Stearyl and Hydro-6 motifs stabilized ADGN/siRNA particles and siRNA mediated luciferase silencing is reduced by only 20% in serum. Introducing Retro-inverso modification strongly stabilized the ADGN/siRNA complexes. As reported in FIGS. 3A and 3B, when using ADGN-100RI or ADGN-106RI, siRNA mediated luciferase silencing is not affected by the presence of serum and luciferase expression level is reduced of 77% with 10 nM siRNA and 95% with 25 nM siRNA.

    [0313] We have evaluated the impact of combining ADGN-100 with PeGylated ADGN-100 on the siRNA transfection efficiency, siRNA targeting luciferase (10 nM and 25 nM) were associated to ADGN-100 solution containing 5 to 50% of ADGN-100-PEG or to ADGN-100PEG. As reported in FIG. 3C, combining ADGN-100 with 10% or 20% of pegylated ADGN-100 significantly stabilized complexes. Luciferase expression is reduced by 75% and 81% using 10% and 20% of pegylated ADGN-100, respectively. In contrast, using 50% and 100% ADGN-100 PEG reduced by 50% and 80% transfection efficiency.

    [0314] The results demonstrated that ADGN-100 and ADGN-106 promote efficient delivery of siRNA in A375/Luc cells. The results showed than using stearylation, retro-inverso or Hydro-6 modification of ADGN peptides, or combining 10% to 20% of pegylated-ADGN peptide within the ADGN/siRNA particles strongly stabilize the complexes in the presence of high serum conditions.

    Example 7: ADGN-Peptide Variant Improve Carto Delivery In Vivo

    [0315] Stable ADGN-peptides/mRNA were evaluated for in vivo delivery of Luciferase mRNA via intravenous and intramuscular administrations. Animals were treated with single dose of 5 moU modified Luc mRNA of 5 μg. 5 moU modified Luc mRNA (5 μg) in sterile water (GIBCO) were mixed with ADGN peptide (sterile water), volume for each sample was adjusted to 100 μl, with sterile water containing 5% Sucrose. Samples were mixed gently with vortex for 1 minute at low speed and incubated for 30 min at room temperature. Samples were filtered on 0.45 μm PES filters prior administration. For IV administration Mice received 100 μl intravenous (IV) injection of either ADGN-106/mRNA, ADGN-100/mRNA, ADGN-106RI/mRNA, ADGN-100-stearyl/mRNA, ADGN-100Hydro1/mRNA, ADGN-100Hydro2 or ADGN/mRNA complexes containing 10% of ADGN-100PEG (3 animals per group). As control, mice from group 3 (2 animals per group) received IV injection of 100 μl of naked 5 moU modified Luc mRNA (5 μg). For IM administration, mice received 25 μl (5 μg mRNA) IV injection of either ADGN-100/mRNA, ADGN-106/mRNA, ADGN-106RI/mRNA or ADGN/mRNA complexes containing 10% or 20% of ADGN-100PEG (2 animals per group). As control, mice from group 3 (2 animals per group) received IV injection of 25 μl of naked 5 moU modified Luc mRNA (5 μg).

    [0316] mRNA Luc expression was monitored by bioluminescence. Bioluminescence imaging was performed after 12, 24, 48 and 72 hrs. Mice received an i.p. injection of 150 μg/g luciferin for noninvasive bioluminescence imaging (IVIS Kinetic; PerkinElmer, Waltham, Mass., USA). Results were then expressed as values relative to day 0 and shown in FIGS. 4A-4D and FIG. 5.

    [0317] As shown in FIG. 4A; ADGN-106, ADGN-106RI, ADGN-100 and ADGN-100 Stearyl mediated in vivo cargo delivery and mRNA expression was mainly observed in the liver and at lower level in the lung and the kidney. ADGN-106 is 2 and 4 folds more efficient than ADGN-100 stearyl and ADGN-100, respectively. ADGN-106RI modification increased by 2 fold ADGN-106 efficiency in all the tissues. In contrast, negligible luciferase expression was obtained using ADGN-100 hydrol or ADGN-100Hydro2.

    [0318] As shown in FIGS. 4A and 4B, combining ADGN-106 with 10% ADGN-100PEG improved by 3-6 fold luciferase expression in the different tissues. Moreover, the presence of 10% ADGN-100PEG in the ADGN106/mRNA complex promotes mRNA targeting in the brain, lymph node and in the spleen.

    [0319] As shown in FIGS. 4C and 4D kinetic of luciferase expression in the liver and the lung, started after 12 h with optimal expression at 48 h and remains stable at least 72 hr.

    [0320] As shown in FIGS. 4C and 4D kinetic of luciferase expression in the liver and the lung, started after 12 h with optimal expression at 48 h and remains stable at least 72 hr.

    [0321] As shown in FIGS. 5A and 5B, ADGN-106, ADGN106-Hydro-6, ADGN-106RI and ADGN-106/ADGN-100P mediated Luciferase expression following intramuscular (IM) administration. ADGN-106RI and hydro-6 modifications increased by 6 and 4 fold ADGN-106 efficiency. Combining ADGN-106 with 10% or 20% of ADGN-100 PEG improves by 8 to 12 folds luciferase expression in the muscle. In contrast, no significant expression was observed using ADGN-100 and combining ADGN-100 with 10% of ADGN-100PEG improves by 3-fold luciferase expression in comparison to ADGN-106. As reported in FIG. 5A, of luciferase expression started after 12 h with optimal expression at 24 h and remains stable at least 48 hr.

    [0322] The results demonstrated that ADGN-106 promotes significantly higher delivery of mRNA in vivo following IV administration as compared to ADGN-100. Introducing retro-inverso modification on ADGN-106 increased complex stability and cargo delivery in vivo. The results demonstrated than combining pegylated-ADGN peptide within the ADGN-106/mRNA particles strongly stabilize the complexes for both IM and IV administrations. Pegylated ADGN significantly improves luciferase expression in vivo and tissues distribution.

    Example 8: ADGN-Peptide Variant Improve Plasmid DNA Delivery In Vivo

    [0323] Stable ADGN-peptides/pGL4.11 DNA were evaluated for in vivo delivery of Luciferase mRNA via intravenous and intramuscular administrations. Animals were treated with single dose of pGL4.11 plasmid DNA of 5 μg, via IV and 2.5 μg via intramuscular administration.

    [0324] pGL4.11 DNA plasmid (5 μg) in sterile water (GIBCO) were mixed with ADGN peptide (sterile water), volume for each sample was adjusted to 100 μl, with sterile water containing 5% Sucrose. Samples were mixed gently with vortex for 1 minute at low speed and incubated for 30 min at room temperature. Samples were filtered on 0.45 μm PES filters prior administration. For IV administration Mice received 100 μl IV injection of either ADGN-106/pGL4, ADGN-100/pGL4, ADGN-100RL/pGL4, ADGN-100-stearyL/PGL4, ADGN-100Hydro1/PGL4, ADGN-100Hydro2/PGL4, ADGN100 Hydro6/PGL4 or ADGN/PGL4 complexes containing 10% or 20% of ADGN-100PEG (3 animals per group). As control, mice from group 3 (2 animals per group) received IV injection of 100 μl of naked pGL4 plasmids (5 μg).

    [0325] For IM administration, mice received 25 μl (2.5 μg of pGL4 plasmid) IV injection of either ADGN-100/PGL4, ADGN-106/PGL4, ADGN-100RU/PGL4, ADGN-100hydrol/PGL4, ADGN-100hydro6/PGL4, ADGN-100 stearyl/PGL4 or ADGN-100/PGL4 complexes containing 10% or 20% of ADGN-100PEG (2 animals per group). As control, mice from group 3 (2 animals per group) received IV injection of 25 μl of naked PGL4 plasmid (2.5 μg).

    [0326] Luciferase expression was monitored by bioluminescence. Bioluminescence imaging was performed after 12, 24, 48 and 72 hrs. Mice received an i.p. injection of 150 μg/g luciferin for noninvasive bioluminescence imaging (IVIS Kinetic: PerkinElmer, Waltham, Mass., USA). Results were then expressed as values relative to day 0 and shown in FIG. 6 and FIG. 7.

    [0327] As shown in FIG. 6A; after IV injection, ADGN-100, ADGN-100RI, ADGN-100-Hydro6 and ADGN-100 Stearyl mediated in vivo plasmid delivery and luciferase expression was mainly observed in the liver and at lower level in the lung and the kidney. In contrast, no or minimal expression was observed with ADGN-106. Retro inverso, stearylation and Hydro-6 modifications increased by 4, 2.7 and 3.4 fold, ADGN-100 efficiency in all the tissues, respectively. In contrast, negligible luciferase expression was obtained using ADGN-100 hydrol or ADGN-100Hydro2.

    [0328] As shown in FIGS. 6A and 6B, combining ADGN-100 with 10% ADGN-100PEG improved by 5-6 fold luciferase expression in the different tissues. As shown in FIG. 6B kinetic of luciferase expression in the liver, started after 12 h with optimal expression at 48 h and remains stable at least 72 hr.

    [0329] As shown in FIGS. 7A and 7B, ADGN-100, ADGN-100RI, ADGN-100 HYDRO6 and ADGN-100/ADGN-100P mediated Luciferase expression following IM administration. ADGN-100RI modification increased by 6 fold ADGN-100 efficiency. Stearyl and Hydro-6 modification increased by 3-4 fold ADGN-100 efficiency. Combining ADGN-100 with 10% or 20% of ADGN-100 PEG improves by 10 to 12 folds luciferase expression in the muscle. In contrast, no significant expression was observed using ADGN-106 and Hydro-1 or hydro-2 modification. As reported in FIG. 7A, of luciferase expression started after 12 h with optimal expression at 24 h and remains stable at least 48 hr.

    [0330] The results demonstrated that ADGN-100 promotes significantly higher delivery of plasmid DNA in vivo following IV administration as compared to ADGN-106. Introducing retro-inverso, stearyl or hydro-6 modifications on ADGN-100, increased complex stability as previously observed on cultured cells and plasmid DNA delivery in vivo. The results demonstrated than combining pegylated-ADGN peptide within the ADGN-100/pGL4 plasmid particles strongly stabilize the complexes for both IM and IV administrations. Pegylated ADGN significantly improves luciferase expression in vivo and tissues distribution.

    Example 9. ADGN-Peptide Variant Improve Cargo Delivery In Vivo

    [0331] Stable ADGN-peptides/mRNA were evaluated for in vivo delivery of Luciferase mRNA via intravenous administrations. Animals were treated with single dose of 5 moU modified Luc mRNA of 5 μg. 5 moU modified Luc mRNA (5 μg) in sterile water (GIBCO) were mixed with ADGN peptide (sterile water), volume for each sample was adjusted to 100 μl, with sterile water containing 5% Sucrose. 5 moU modified Luc mRNA (5 μg) was prepared in sterile water at room temperature in a glass vial (1-4 ml). ADGN-peptide solution was added dropwise (1 drop/sec) under magnetic agitation at 400 rpm and incubated for 30 min at room temperature. Prior to IV administration ADGN-peptides/mRNA complexes were diluted in sucrose 5% solution and mixed under magnetic agitation at 400 rpm for 1 minute. Samples were filtered on 0.45 μm PES filters prior administration.

    [0332] For IV administration Mice received 100 μl intravenous (IV) injection of either ADGN-103C/mRNA, ADGN-104/mRNA, ADGN-105/mRNA ADGN-106 TB/mRNA, ADGN-109/mRNA, ADGN-109D/mRNA, ADGN-109b/mRNA, ADGN-101/mRNA, ADGN-102/mRNA; ADGN-100GALNAC/mRNA, ADGN-106GALNAC/mRNA, ADGN-106TC/mRNA, ADGN-106TD/mRNA, ADGN-106/mRNA, ADGN-100/mRNA, ADGN-106hydro8/mRNA and ADGN-100-Hydro8. (3 animals per group). As control, mice from group 3 (2 animals per group) received IV injection of 100 μl of naked 5 moU modified Luc mRNA (5 μg).

    [0333] mRNA Luc expression was monitored by bioluminescence. Bioluminescence imaging was performed after 12, 24, 48 and 72 hours. Mice received an i.p. injection of 150 μg/g luciferin for noninvasive bioluminescence imaging (IVIS Kinetic; PerkinElmer, Waltham, Mass., USA). Results were then expressed as values relative to day 0 and shown in FIGS. 11A-11C.

    [0334] As shown in FIGS. 11A and 11B ADGN-100GALNAC and ADGN-106GALNAC mediated mRNA accumulation in the liver with an increase of mRNA expression by 10- to 20-folds in comparison to ADGN-106 or ADGN-100.

    [0335] As shown in FIGS. 11A and 11B, ADGN-100 hydro 8 modification increased by 22 and 4 folds ADGN-100 efficiency in the lung and kidney, respectively. ADGN-106 Hydro8 modification increased by 5folds ADGN-106 peptides efficiency in the lung and muscle and by 2 folds in the liver.

    [0336] As shown in FIG. 11A, ADGN-101 modification improved by 6 fold luciferase expression in the lung and promoted target delivery and expression of mRNA in heart and muscles. ADGN-102 modification improved by 3 fold luciferase expression in the lung and promoted target delivery and expression of mRNA in the brain.

    [0337] As shown in FIG. 11B, ADGN-106 modification improved by 2-3 fold luciferase expression in the lung. ADGN-106 TB and ADGN-106 TC modifications promoted target delivery and expression of mRNA in the brain. ADGN-106 TD modification promoted target delivery and expression of mRNA in heart and muscles.

    [0338] As shown in FIG. 11C. ADGN-104, ADGN105, ADGN-109, ADGN-109D, ADGN-109B mediated Luciferase expression following intravenous administration. ADGN-104 promoted target delivery and expression of mRNA in heart and muscles and at lower level in the liver. ADGN-105 promoted target delivery and expression of mRNA in the brain and at lower level in liver, lung and lymphnode. ADGN-109 and ADGN-109D promoted target delivery and expression of mRNA in the brain and lymphnode and at lower level in liver and kidney. ADGN-109B promoted target delivery and expression of mRNA in the lung, heart and muscles. In contrast, negligible luciferase expression was obtained using ADGN-103C.

    Example 10

    [0339] Table I lists a summary of cell-penetrating peptides that have been proven successful in delivering various cargo molecules to on or more targeted organ (e.g., by intravenous (IV), intramuscular (IM), or subcutaneous (SQ) administration, or intratraccheal instillation or nebulization (NB)) in mice or rat models.

    TABLE-US-00003 TABLE 1 Code Targeted Peptide Sequences Cargoes Route Organ VEPEP-3a beta-AKWFERWFREWPRKRR AAV/Mrna/ IV Kidney/Pancreas protien:peptide VEPEP-3C ASSLNIA-Ava- peptide/ IV/IM Muscle KWWERWWREWPRKRR protein/PNA VEPEP-3D LSSRLDA Ava- PNA/oligo/ IV Heart Muscle KWWERWWREWPRKRR mRNA VEPEP-3E Ac-SYTSSTM-ava- siRNA/mRNA IV Brain KWWERWWREWPRKRR VEPEP-9 beta- AAV/Peptide/ IV/IM Brain/Liver/ ALRWWLRWASRWFSRWA Oligo/plasmid Lung/Kidney/ WWR VEPEP-9A KSYDTY-ava- siRNA/mRNA IV Brain/Lymphnode ALRWLRWASRWFSRWAWR VEPEP-9B ac- Oligo IV Heart CKRAVRWWLRWASRWFSR WAWWR VEPEP-9C beta- AAV/Peptide/ IV Liver/Lung/ RWWLRWASRVVFSRWAWR Oligo/plasmid Kidney/Brain VEPEP-9D KSYDTYAAETRRWASRWFS siRNA/Peptide IV Brain/Lymphnode RWAWWR ADGN- beta- Plasmid/ IV/IM/ Lung/Liver/ 100a AKWRSAGWRWRLWRVRS peptide:siRNA/ SQ/NB Kidney/Pancreas WSR CRISPR/mRNA ADGN- beta- Plasmid/ IV/IM/SQ Lung/Liver/ 100b AKWRSALYRWRLWRVRSW peptide:siRNA/ Kidney/Pancreas SR CRISPR/mRNA ADGN-101 Ac- siRNA/mRNA IV Heart/Lung CARPARWRSAGWRWRLWR VRSWSR-NH2 ADGN-102 TGNYKALHPDHNGWRSALR siRNA/mRNA IV Brain/Lung WRLWRWSR-NH2 ADGN-100 Stearyl-A- plasmid/mRNA/ IV/IM/SQ Lung/Liver/ Stearyl KWRSALWRWRLWRVRSWS siRNA Kidney/Pancreas R-NH2 ADGN-100 Ac- Plasmid/mRNA/ IV/SQ Liver GALNAC KWRSA(GALNAC)LWRWRL CRISPR WRVRSWSR-NH2 ADGN-100- RSWSRVRWLRWRWGASRW Plasmid/mRNA IV/IM Liver/Lung/ RI K Kidney/Spleen ADON-100- Ac-YIGSR-A- Plasmid/mRNA IV/IM Lung/Kidney Hydro KWRSALWRWRLWRVRSWS R-NH2 ADGN-100- Ac-YIGSR-(G)4- Plasmid/mRNA IV/IM Lung/Kidney/ Hydro-1 KWRSALWRWRLWRVRSWS Liver R-NH2 ADGN-100- Ac-YIGSR-Ava- Plasmid/mRNA/ IV/IM Tumor/Lung Hydro-3 KWRSALWRWRLWRVRSWS CRISPR R-NH2 ADGN-100 Ac-GYVS-Ava- mRNA IV/IM Liver/Lung/ hydro-4 KWRSALWRWRLWRVRSWS Kidney/Spleen R-NH2 ADGN-100 Ac-YIGSR-Ahx- mRNA/CRISPR IV/IM Tumor/Lung Hydro-7 KWRSALWRWRLWRVRSWS R-NH2 ADGN-100- Ac-(PEG)2-A- mRNA/CRISPR IV/IM Lung:Liver/ PEG2 KWRSALWRWRLWRVRSWS Spleen R-NH2 ADGN-100- Ac-YIGSR-(PEG)2-βA- mRNA/CRISPR IV/IM Lung HYPEG2 KWRSALWRWRLWRVRSWS R-NH2 ADGN-100- Ac-YIGSR-(PEG)4-βA- mRNA IV/IM Lung HYPEG4 KWRSALWRWRLWRVRSWS R-NH2 VEPEP-6 beta- mRNA/siRNA/ IV/IM/ Liver/Lung (ADGN- ALWRALWRLWRSLWRLLW CRISPR NB/SQ 106) KA ADGN-106 Stearyl-βA- mRNA/siRNA IV/IM Liver/Spleen Stearyl ALWRALWRLWRSLWRLLW KA-NH2 ADGN-106 ALWRA(GalNac)LWRLWRSL mRNA/siRNA IV/IM/SQ Liver gaLnaC WRLLWKA-NH2 ADGN-106- AKWLLRWLSRWLRWLARW mRNA/siRNA IV/IM Liver/Lung RI LR ADGN-106- Ac-YIGSR-Ava- mRNA/siRNA/ IV/IM Tumor/Muscle Hydro-3: ALWRALWRLWRSLWRLLW CRISPR KA-NH2 ADGN-106 Ac-GYVS-Ava- mRNA/siRNA/ IV/IM Brain/Kidney hydro-4 ALWRALWRLWRSLWRLLW CRISPR KA-NH2 ADGN-106- Ac-YIGSR-Aun- mRNA/siRNA/ IV/IM Tumor/Lung/ Hydro-5 ALWRALWRLWRSLWRLLW CRISPR Pancreas/Liver KA-NH2 ADGN-106 Ac-GYVS-Aun- mRNA/siRNA/ IV/IM Tumor/Pancreas/ hydro-6 ALWRALWRLWRSLWRLLW CRISPR Lung KA-NH2 ADGN-106 Ac-YIGSR-Ahx- mRNA/siRNA IV/IM Lung/Tumor hydro-7 ALWRALWRLWRSLWRLLW CRISPR KA-NH2 ADGN-106- Ac-(PEG)2- mRNA/siRNA/ IV/IM Lung/Kidney/ PEG2 βALWRALWRLWRSLWRLL CRISPR Spleen WKA-NH2 ADGN-106- Ac-YIGSR-(PEG)2- mRNA/siRNA/ IV/IM Tumor/Lung HYPEG2 βALWRALWRLWRSLWRLL CRISPR WKA-NH2 ADGN-106- Ac-YIGSR-(PEG)4- mRNA/siRNA/ IV/IM Tumor/Lung HYPEG4 βALWRALWRLWRSLWRLL CRISPR WKA-NH2 ADGN-106- Ac-SYTSSTM-ava- mRNA/siRNA/ IV/IM Brain/Liver TB βALWRALWRLWRSLWRLL CRISPR WKA-NH2 ADGN-106- Ac- mRNA/siRNA/ IV/IM Brain TC THRPPNWSPVWPRALWRLW CRISPR RSLWRLRWKA-NH2 ADGN-106- Ac- mRNA/siRNA/ IV/IM Muscle/Heart TD CKTRRVPWRALWRLWRSL CRISPR WRLLWKA-NH2

    TABLE-US-00004 SEQUENCE LISTING SEQ ID Sequence Annotations 1. X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.2X.sub.3X.sub.4X.sub.6X.sub.7X.sub.3X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12X.sub.13 VEPEP-3 X.sub.1 is beta-A or S, X.sub.2 is K, R or L, X.sub.3 is F or W, X.sub.4 is F, W or Y, X.sub.5 is E, R or S, X.sub.6 is R, T or S, X.sub.7 is E, R, or S, X.sub.8 is none, F or W, X.sub.9 is P or R, X.sub.10 is R or L, X.sub.11 is K, W or R, X.sub.12 is R or F, and X.sub.13 is R or K 2. X.sub.1X.sub.2WX.sub.4EX.sub.2WX.sub.4X.sub.6X.sub.7X.sub.3PRX.sub.11RX.sub.13 VEPEP-3 1 X.sub.1 is beta-A or S, X.sub.2 is R or K, X.sub.3 is W or F, X.sub.4 is F, W, or Y, X.sub.6 is T or R, X.sub.7 is E or R, X.sub.11 is R or K, and X.sub.13 is R or K 3. X.sub.1KWFERWFREWPRKRR VEPEP-3 1a X.sub.1 is beta-A or S 4. X.sub.1KWWERWWREWPRKRR VEPEP-3 1b X.sub.1 is beta-A or S 5. X.sub.1KWWERWWREWPRKRK VEPEP-3 1c X.sub.1 is beta-A or S 6. X.sub.1RWWEKWWTRWPRKRK VEPEP-3 1d X.sub.1 is beta-A or S 7. X.sub.1RWYEKWYTEFPFRRR VEPEP-3 1e X.sub.1 is beta-A or S 8. X.sub.1KX.sub.14WWERWWRX.sub.14WPRKRK VEPEP-3 1S X.sub.1 is beta-A or S and X.sub.14 is a non-natural amino acid, and wherein there is a hydrocarbon linkage between the two non- natural amino acids 9. X.sub.1X.sub.2X.sub.3WX.sub.5X.sub.10X.sub.3WX.sub.6X.sub.7WX.sub.8X.sub.9X.sub.10WX.sub.12R VEPEP-3 2 X.sub.1 is beta-A or S, X.sub.2 is K, R or L, X.sub.3 is F or W, X.sub.5 is R or S, X.sub.6 is R or S, X.sub.7 is R or S, X.sub.8 is F or W, X.sub.9 is R or P, X.sub.10 is L or R, and X.sub.12 is R or F 10. X.sub.1RWWRLWWRSWFRLWRR VEPEP-3 2a X.sub.1 is beta-A or S 11. X.sub.1LWWRRWWSRWWPRWRR VEPEP-3 2b X.sub.1 is beta-A or S 12. X.sub.1LWWSRWWRSWFRLWFR VEPEP-3 2c X.sub.1 is beta-A or S 13. X.sub.1KFWSRFWRSWFRLWRR VEPEP-3 2d X.sub.1 is beta-A or S 14. X.sub.1RWWX.sub.14LWWRSWX.sub.14RLWRR VEPEP-3 2S X.sub.1 is a beta-alanine or a serine and X.sub.14 is a non-natural amino acid, and wherein there is a hydrocarbon linkage between the two non-natural amino acids 15. X.sub.1LX.sub.2RALWX.sub.9LX.sub.3X.sub.9X.sub.4LWX.sub.9LX.sub.5X.sub.6X.sub.7X.sub.8 VEPEP-6 1 X.sub.1 is beta-A or S, X.sub.2 is F or W, X.sub.3 is L, W, C or I, X.sub.4 is S, A, N or T, X.sub.5 is L or W, X.sub.6 is W or R, X.sub.7 is K or R, X.sub.8 is A or none, and X.sub.9 is R or S 16. X.sub.1LX.sub.2LARWX.sub.9LX.sub.3X.sub.9X.sub.4LWX.sub.9LX.sub.5X.sub.6X.sub.7X.sub.8 VEPEP-6 2 X.sub.1 is beta-A or S, X.sub.2 is F or W, X.sub.3 is L, W, C or I, X.sub.4 is S, A, N or T, X.sub.5 is L or W, X.sub.6 is W or R, X.sub.7 is K or R, X.sub.8 is A or none, and X.sub.9 is R or S 17. X.sub.1LX.sub.2ARLWX.sub.9LX.sub.3X.sub.9X.sub.4LWX.sub.9LX.sub.5X.sub.6X.sub.7X.sub.8 VEPEP-6 3 X.sub.1 is beta-A or S, X.sub.2 is F or W, X.sub.3 is L, W, C or I, X.sub.4 is S, A, N or T, X.sub.5 is L or W, X.sub.6 is W or R, X.sub.7 is K or R, X.sub.8 is A or none, and X.sub.9 is R or S 18. X.sub.1LX.sub.2RALWRLX.sub.3RX.sub.4LWRLX.sub.5X.sub.6X.sub.7X.sub.8 VEPEP-6 4 X.sub.1 is beta-A or S, X.sub.2 is F or W, X.sub.3 is L, W, C or I, X.sub.4 is S, A, N or T, X.sub.5 is L or W, X.sub.6 is W or R, X.sub.7 is K or R, and X.sub.8 is A or none 19. X.sub.1LX.sub.2RALWRLX.sub.3RX.sub.4LWRLX.sub.5X.sub.6KX.sub.7 VEPEP-6 5 X.sub.1 is beta-A or S, X.sub.2 is F or NV, X.sub.3 is L or W, X.sub.4 is S, A or N, X.sub.5 is L or W, X.sub.6 is W or R, X.sub.7 is A or none 20. X.sub.1LFRALWRLLRX.sub.2LWRLLWX.sub.3 VEPEP-6 6 X.sub.1 is beta-A or S, X.sub.2 is S or T, and X.sub.3 is K or R 21. X.sub.1LWRALWRLWRX.sub.2LWRLLWX.sub.3A VEPEP-6 7 X.sub.1 is beta-A or S, X.sub.2is S or T, and X.sub.3is K or R 22. X.sub.1LWRALWRLX.sub.4RX.sub.2LWRLWRX.sub.3A VEPEP-6 8 X.sub.1 is beta-A or S, X.sub.2is S or T, X.sub.3 is K or R, and X.sub.4is L, C or I 23. X.sub.1LWRALWRLWRX.sub.2LWRLWRX.sub.3A VEPEP-6 9 X.sub.1 is beta-A or S, X.sub.2 is S or T, and X.sub.3 is K or R 24. X.sub.1LWRALWRLX.sub.5RALWRLLWX.sub.3A VEPEP-6 10 X.sub.1 is beta-A or 5, X.sub.3 is K or R, and X.sub.5is L or I 25. X.sub.1LWRALWRLX.sub.4RNLWRLLWX.sub.3A VEPEP-6 11 X.sub.1 is beta-A or S, X.sub.3 is K or R, and X.sub.4 is L, C or I 26. Ac-X.sub.1LFRALWRLLRSLWRLLWK-cysteamide VEPEP-6a X.sub.1 is beta-A or S 27. Ac-X.sub.1LWRALWRLWRSLWRLLWKA-cysteamide VEPEP-6b X.sub.1 is beta-A or S 28. Ac-X.sub.1LWRALWRLLRSLWRLWRKA-cysteamide VEPEP-6c X.sub.1 is beta-A or S 29. Ac-X.sub.1LWRALWRLWRSLWRLWRKA-cysteamide VEPEP-6d X.sub.1 is beta-A or S 30. Ac-X.sub.1LWRALWRLLRALWRLLLWKA-cysteamide VEPEP-6e X.sub.1 is beta-A or S 31. Ac-X.sub.1LWRALWRLLRNLWRLLWKA-cysteamide VEPEP-6f X.sub.1 is beta-A or S 32. Ac-X.sub.1LFRALWR.sub.sLLRS.sub.sLWRLLWK-cysteamide ST-VEPEP-6a X.sub.1 is beta-A or S and the residues followed by an inferior “s” are linked by a hydrocarbon linkage 33. Ac-X.sub.1LFLARWR.sub.sLLRS.sub.sLWRLLWK-cysteatmide ST-VEPEP-6aa X.sub.1 is beta-A or S and the residues followed by an inferior “s” are linked by a hydrocarbon linkage 34. Ac-X.sub.1LFRALWS.sub.sLLRS.sub.sLWRLLWK-cysteamide ST-VEPEP-6ab X.sub.1 is beta-A or S and the residues followed by an inferior “s” are linked by a hydrocarbon linage 35. Ac-X.sub.1LFLARWS.sub.sLLRS.sub.sLWRLLWK-cysteamide ST-VEPEP-6ad X.sub.1 is beta-A or S and the residues followed by an inferior “s” are linked by a hydrocarbon linkage 36. Ac-X.sub.1LFRALWRLLR.sub.sSLWS.sub.sLLWK-cysteamide ST-VEPEP-6b X.sub.1 is beta-A or S and the residues followed by an inferior “s” are linked by a hydrocarbon linkage 37. Ac-X.sub.1LFLARWRLLR.sub.sSLWS.sub.sLLWK-cysteamide ST-VEPEP-6ba X.sub.1 is beta-A or S and the residues followed by an inferior “s” are linked by a hydrocarbon linkage 38. Ac-X.sub.1LFRALWRLLS.sub.sSLWS.sub.sLLWK-cysteamide ST-VEPEP-6bb X.sub.1 is beta-A or S and the residues followed by an inferior “s” are linked by a hydrocarbon linkage 39. Ac-X.sub.1LFLARWRLLS.sub.sSLWS.sub.sLLWK-cysteamide ST-VEREP-6bd X.sub.1 is beta-A or S and the residues followed by an inferior “s” are linked by a hydrocarbon linkage 40. Ac-X.sub.1LFAR.sub.sLWRLLRS.sub.sLWRLLWK-cysteamide ST-VEPEP-6c X.sub.1 is beta-A or S and the residues followed by an inferior “s” are linked by a hydrocarbon linkage 41. X.sub.1X.sub.2X.sub.3WWX.sub.4X.sub.5WAX.sub.6X.sub.3X.sub.7X.sub.8X.sub.9X.sub.10X.sub.11X.sub.12WX.sub.13R VEPEP-9 1 X.sub.1 is beta-A or S, X.sub.2 is L or none, X.sub.3 is R or none, X.sub.4 is L, R or G, X.sub.5 is R, W or S, X.sub.6 is S, P or T, X.sub.7 is W or P, X.sub.8 is F, A or R, X.sub.9 is S, L, P or R, X.sub.10 is R or S, X.sub.11 is W or none, X.sub.12 is A, R or none and X.sub.13 is W or F, and wherein if X.sub.3 is none, then X.sub.2, X.sub.11 and X.sub.12 are none as well 42. X.sub.1X.sub.2RWWLRWAX.sub.6RWX.sub.8X.sub.9X.sub.10WX.sub.12WX.sub.13R VEPEP-9 2 X.sub.1 is beta-A or S, X.sub.2 is L or none, X.sub.6 is S or P, X.sub.8 is F or A, X.sub.9 is S, L or P, X.sub.10 is R or S, X.sub.12 is A or R, and X.sub.13 is W Or F 43. X.sub.1LRWWLRWASRWFSRWAWWR VEPEP9a1 X.sub.1 is beta-A or S 44. X.sub.1LRWWLRWASRWASRWAWFR VEPEP9a2 X.sub.1 is beta-A or S 45. X.sub.1RWWLRWASRWALSWRWWR VEPEP9b1 X.sub.1 is beta-A or S 46. X.sub.1RWWLRWASRWFLSWRWWR VEPEP9b2 X.sub.1 is beta-A or S 47. X.sub.1RWWLRWAPRWFPSWRWWR VEPEP9c1 X.sub.1 is beta-A or S 48. X.sub.1RWWLRWASRWAPSWRWWR VEPEP9c2 X.sub.1 is beta-A or S 49. X.sub.1WWX.sub.4X.sub.5WAX.sub.6X.sub.7X.sub.8RX.sub.10WWR VEPEP-9 3 X.sub.1 is beta-A or S 50. X.sub.1WWRWWASWARSWWR VEPEP9d X.sub.1 is beta-A or S 51. X.sub.1WWGSWATPRRRWWR VEPEP9e X.sub.1 is beta-A or S 52. X.sub.1WWRWWAPWARSWWR VEPEP9f X.sub.1 is beta-A or S 53. X.sub.1KWRSX.sub.2X.sub.3X.sub.4RWRLWRX.sub.5X.sub.6X.sub.7X.sub.8SR ADGN-100 X.sub.1is any amino acid or none, and X.sub.2-X.sub.8 are any amino acid 54. X.sub.1KWRSX.sub.2X.sub.3X.sub.4RWRLWRX.sub.5X.sub.6X.sub.7X.sub.8SR ADGN-100 1 X.sub.1 is βA, S, or none, X.sub.2 is A or V, X.sub.3 is G or L, X.sub.4 is W or Y, X.sub.5 is V or S, X.sub.6 is R, V, or A, X.sub.7 is S or L, and X.sub.8 is W or Y 55. KWRSAGWRWRLWRVRSWSR ADGN-100a 56. KWRSALYRWRLWRVRSWSR ADGN-100b 57. KWRSALYRWRLWRSRSWSR ADGN-100c 58. KWRSALYRWRLWRSALYSR ADGN-100d 59. KWRS.sub.SAGWR.sub.SWRLWRVRSWSR ADGN-100 aa the residues marked with a subscript “S” are linked by a hydrocarbon linkage 60. KWR.sub.SSAGWRWR.sub.SLWRVRSWSR ADGN-100 ab the residues marked with a subscript “S” are linked by a hydrocarbon linkage 61. KWRSAGWR.sub.SWRIAVRVR.sub.SSWSR ADGN-100 ac the residues marked with a subscript “S” are linked by a hydrocarbon linkage 62. KWRS.sub.SALYR.sub.SWRLWRSRSWSR ADGN-100 ba the residues marked with a subscript “S” are linked by a hydrocarbon linkage 63. KWR.sub.SSALYRWR.sub.SLWRSRSWSR ADGN-100 bb the residues marked with a subscript “S” are linked by a hydrocarbon linkage 64. KWRSALYR.sub.SWRLWRSR.sub.SSWSR ADGN-100 bc the residues marked with a subscript “S” are linked by a hydrocarbon linkage 65. KWRSALYRWR.sub.SLWRS.sub.SRSWSR ADGN-100 bd the residues marked with a subscript “5” are linked by a hydrocarbon linkage 66. KWRSALYRWRLWRS.sub.SRSWS.sub.SR ADGN-100 be the residues marked with a subscript “S” are linked by a hydrocarbon linkage 67. KWR.sub.SSALYRWR.sub.SLWRSALYSR ADGN-100 ca the residues marked with a subscript “S” are linked by a hydrocarbon linkage 68. KWRS.sub.SALYR.sub.SWRLWRSALYSR ADGN-100 cb the residues marked with a subscript “S” are linked by a hydrocarbon linkage 69. KWRSALYRWR.sub.SLWRS.sub.SALYSR ADGN-100 cc the residues marked with a subscript “S” are linked by a hydrocarbon linkage 70. KWRSALYRWRLWRS.sub.SALYS.sub.SR ADGN-100 cd the residues marked with a subscript “S” are linked by a hydrocarbon linkage 71. KETWWETWWTEWSQPKKKRKV PEP-1 72. KETWFETWFFEWSQPKKKRKV PEP-2 73. KWFETWFTEWPKKRK PEP-3 74. GALFLGFLGAAGSTMGAWSQPKKKRKV MPG 75. beta-AKWFERWFREWPRKRR VEPEP-3a 76. beta-AKWWERWWREWPRKRR VEPEP-3b 77. beta-ALWRALWRLWRSLWRLLWKA VEPEP-6 (ADGN-106) 78. beta-ALRWWLRWASRWFSRWAWWR VEPEP-9 79. beta-AKWRSAGWRWRLWRVRSWSR ADGN-100a (ADGN -100) 80. beta-AKWRSALYRWRLWRVRSWSR ADGN-100b 81. GLWRALWRLLRSLWRLLWKV CADY 82. RQIKIWFQNRRMKWKKC pANT 83. CRRRQRRKKRGGDIMGEWGNEIFGAIAGFLG TAT-HA2 84. KKALLALALHHLAHLALHLALALKKAC LAH4 85. AKWLLRWLSRWLRWLARWLR ADGN-106-RI 86. RSWSRVRWLRWRWGASRWK ADGN-100-RI 87. Ac-(PEG)7-bA-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100-PEG 88. Ac-YIGSR-(G)4-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100- Hydro-1 89. Ac-GYVS-(G)4-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100 hydro-2 90. Stearyl-βA-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100 Stearyl 91. Ac-(PEG)2-βA-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100- PEG-2 92. Ac-(PEG)7-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-106- PEG7 93. Ac-(PEG)2-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-106- PEG2 94. Ac-YIGSR-(G)4-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106- Hydro-1 95. Ac-GYVS-(G)4-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106 hydro-2 96. Ac-YIGSR-Ava-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106- Ava is 5-amino pentanoic acid Hydro-3: 97. Ac-GYVS-Ava-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106 Ava is 5-amino pentanoic acid hydro-4 98. Ac-YIGSR-Aun-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106- Aun is 11-amino-undecanoic acid Hydro-5 99. Ac-GYVS-Aun-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106 Aun is 11-amino-undecanoic acid hydro-6 100. Stearyl-βA-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106 Stearyl 101. Ac-YIGSR-Ava-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100- Ava is 5-amino pentanoic acid Hydro-3 102. Ac-GYVS-AVa-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100 Ava is 5-amino pentanoic acid hydro-4 103. Ac-YIGSR-Aun-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100- Aun is 11-amino-undecanoic acid Hydro-5 104. Ac-GYVS-Aun-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100 Aun is 11-amino-undecanoic acid hydro-6 105. Ac-YIGSR-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-106- Hydro 106. Ac-YIGSR-βA-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100- Hydro 107. Ac-YIGSR-(PEG)2-βALWRALWRLWRSLWRLLWKA- ADGN-106- NH2 HYPEG2 108. Ac-YIGSR-(PEG)4-βALWRALWRLWRSLWRLLWKA- ADGN-106- NH2 HYPEG4 109. Ac-YIGSR-(PEG)7-βALWRALWRLWRSLWRLLWKA- ADGN-106- NH2 HYPEG7 110. Ac-YIGSR-(PEG)2-βA-KWRSALWRWRLWRVRSWSR- ADGN -100- NH2 HYPEG2 111. Ac-YIGSR-(PEG)4-βA-KWRSALWRWRLWRVRSWSR- ADGN-100- NH2 HYPEG4 112. Ac-YIGSR-(PEG)7-βA-KWRSALWRWRLWRVRSWSR- ADGN-100- NH2 HYPEG7 113. ASSLNIA-Ava-KWWERWWREWPRKRR VEPEP-3C 114. LSSRLDA-Ava-KWWERWWREWPRKRR VEPEP-3D 115. Ac-SYTSSTM-ava-KWWERWWREWPRKRR VEPEP-3E 116. KSYDTY-ava-ALRWLRWASRWFSRWAWR VEPEP-9A 117. Ac-CKRAVRWWLRWASRWFSRWAWWR VEPEP-9B 118. beta-RWWLRWASRWFSRWAWR VEPEP-9C 119. KSYDTYAAETRRWASRWFSRWAWWR VEPEP-9D 120. KWWERWWREWPRKRR VEPEP-9 121. Ac-CARPARWRSAGWRWRLWRVRSWSR-NH2 ADGN-101 122. TGNYKALHPDHNGWRSALRWRLWRWSR-NH2 ADGN-102 123. Ac-TGNYKALHPDHNG-ava-WRSALRWRLWRWSR-NH2 124. Ac-KWRSA(GALNAC)LWRWRLWRVRSWSR-NH2 ADGN-100 GALNAC 125. Ac-YIGSR-Ahx-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100 Hydro-7 126. Ac-YIGSR-Ahx-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100- Hydro-7 127. Ac-GYVS-Ahx-KWRSALWRWRLWRVRSWSR-NH2 ADGN-100 hydro-8 128. Ac-SYTSSTM-ava-KWRSALWRWRLWRVRSWSR-NH2 129. ALWIRA(GalNac)LWRLWRSLWRLLWKA-NH2 ADGN-106 gaLnaC 130. Ac-YIGSR-Ahx-ALWRALWRLWRSLWRLLWKA-NHX ADGN-106 hydro-7 131. Ac-SYTSSTM-ava-βALWRALWRLWRSLWRLLWKA-NH2 ADGN-106-TB 132. Ac-SYTSSTM-ava-βALWRALWRLWRSLWRLLWK-NH2 133. Ac-THRPPNWSPVWPRALWRLWRSLWRLRWKA-NH2 ADGN-106-TC 134. Ac-CKTRRVPWRALWRLWRSLWRLLWKA-NH2 ADGN-106-TD 135. Ac-YIGSR-Ahx-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106- Hydro-7 136. Ac-GYVS-Ahx-ALWRALWRLWRSLWRLLWKA-NH2 ADGN-106 hydro-8 137. Ac-CKTRRVP-aya-WRALWRLWRSLWRLLWKA-NH2 138. Ac-THRPPNWSPV-ava-WRALWRLWRSLWRLRWK- NH2 139. Ac-CARPAR-ava-WRALWRLWRSLWRLLWK-NH2 140. XWXRLXXXXXX VEPEP-4 X in position 1 is beta-A or S; X in positions 3, 9 and 10 are, independently from each other, W or F; X in position 6 is R if X in position 8 is S, and X in position 6 is S if X in position 8 is R; X in position 7 is L or none; X in position 11 is R or none, and X in position 7 is L if X in position 11 is none 141. X.sub.1WWRLSLRWW VEPEP-4 X.sub.1 is beta-A or S 142. X.sub.1WFRLSLRFWR VEPEP-4 X.sub.1 is beta-A or S 143. X.sub.1WWRLRSWFR VEPEP-4 X.sub.1 is beta-A or S 144. X.sub.1WFRLSLRFW VEPEP-4 X.sub.1 is beta-A or S 145. RXWXRLWXRLR VEPEP-5 X in position 2 is R or S; and X in positions 4 and 8 are, independently from each other, W or F 146. X.sub.1WWRLWWRLR VEPEP-5 X.sub.1 is beta-A or S 147. X.sub.1WFRLWFRLR VEPEP-5 X.sub.1 is beta-A or S 148. X.sub.1WFRLWWRLR VEPEP-5 X.sub.1 is beta-A or S 149. XHD 1WWRLWFRLR VEPEP-5 X.sub.1 is beta-A or S 150. X.sub.1RWWRLWWRL VEPEP-5 X.sub.1 is beta-A or S 151. X.sub.1RSWFRLWFR VEPEP-5 X.sub.1 is beta-A or S 152. SYTSSTM Targeting sequence 153. CKTRRVP Targeting sequence 154. THRPPNWSPV Targeting sequence 155. TGNYKALHPDHNG Targeting sequence 156. CARPAR Targeting sequence 157. YIGSR Targeting sequence 158. GYVS Targeting sequence 159. ASSLNIA Targeting sequence 160. LSSRLDA Targeting sequence 161. KSYDTY Targeting sequence 162. CKRAV Targeting sequence 163. PKKKRKV NLS sequence 164. KRPAATKKAGQAKKKK NLS sequence 165. PAAKRVKLD NLS sequence 166. RQRRNELKRSP NLS sequence 167. NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGG NLS sequence Y 168. RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILK NLS sequence RRNV 169. VSRKRPRP NLS sequence 170. PPKKARED NLS sequence 171. PQPKKKPL NLS sequence 172. SALIKKKKKMAP NLS sequence 173. DRLRR NLS sequence 174. PKQKKRK NLS sequence 175. RKLKKKIKKL NLS sequence 176. REKKKFLKRR NLS sequence 177. KRKGDEVDGVDEVAKKKSKK NLS sequence 178. RKCLQAGMNLEARKTKK NLS sequence 179. 5′-GUUGGAGCUUGUGGCGUAGTT-3′ KRAS siRNA targeting G12C mutaton (sense) 180. 5′-CUACGCCACCAGCUCCAACTT-3′ KRAS siRNA targeting G12C mutation (anti- sense) 181. 5′-GATGAGGCTATTCATGATGATT-3′ Factor VIII siRNA (sense) 182. 5′-GAAGUGCAUACACCGAGACTT-3′ KRAS siRNA targeting Q61K mutation (sense) 183. 5′-GUCUCGGUGUAGCACUUCTT-3′ KRAS siRNA targeting Q61K mutation (anti- sense) 184. 5′-GUUGGAGCUGUUGGCGUAGTT-3′ KRAS siRNA targeting G12D mutation (sense) 185. 5′-CUACGCCAACAGCUCCAACTT-3′ KRAS siRNA targeting G12D mutation (anti- sense)