CELL MEMBRANE PENETRATING CONJUGATES FOR GENE EDITING
20260062718 ยท 2026-03-05
Inventors
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N9/1029
CHEMISTRY; METALLURGY
C07K2319/07
CHEMISTRY; METALLURGY
C12Y203/01129
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
C12N15/90
CHEMISTRY; METALLURGY
International classification
C12N15/90
CHEMISTRY; METALLURGY
C12N15/10
CHEMISTRY; METALLURGY
C12N15/113
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
Abstract
A genome-editing complex for modifying a target polynucleotide comprising a recombinant helical protein linked to either one or more molecules of a genome-editing system or a plasmid encoding for one or more molecules of a genome-editing system, wherein the helical protein length is in the range of from 5 nm to 25 nm, and width is in the range of from 1 nm to 5 nm.
Claims
1. A genome-editing complex for modifying a target polynucleotide comprising a recombinant helical protein, wherein the recombinant helical protein is linked to a component selected from the group consisting of: one or more molecules of a genome-editing system and a plasmid that encodes one or more molecules of a genome-editing system, wherein the recombinant helical protein length is in the range of from 5 nm to 25 nm, and width is in the range of from 1 nm to 5 nm.
2. The genome-editing complex of claim 1, wherein the one or more molecules of a genome editing system are selected from the group consisting of: a an RNA-guided endonuclease and/or a guide RNA (gRNA); b. a zinc finger nuclease (ZFN); c. a transcriptor activator-like effector nuclease (TALEN); d. a DNA-guided endonuclease and/or a guide DNA; e. a homing endonuclease; f. an integrase.
3. The genome-editing complex of claim 2, wherein the one or more molecules of a genome editing system is an RNA-guided endonuclease and/or a guide RNA (gRNA).
4. The genome-editing complex of claim 2, wherein the RNA-guided endonuclease is Cas9.
5. The genome-editing complex of claim 1, wherein the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide.
6. The genome-editing complex of claim 1, wherein the helical protein has a generally quadrangular tip shape with a length in the range of from 5 nm to 25 nm, and a width in the range of from 1 nm to 5 nm.
7. The genome-editing complex of claim 1, wherein the helical protein comprises one or more amino acid ladder structures selected from the group consisting of an arginine ladder; a lysine ladder; an asparagine ladder; an aspartic acid ladder; and a glutamic acid ladder.
8. The genome-editing complex of claim 7, wherein when present, the arginine ladder comprises from 10 to 20 arginine residues; the lysine ladder comprises from 10 to 30 lysine residues; the asparagine ladder comprises from 10 to 40 asparagine residues; the aspartic acid ladder comprises from 10 to 40 aspartic acid residues; and the glutamic acid ladder comprises from 10 to 40 glutamic acid residues.
9. The genome-editing complex of claim 1, wherein the helical protein has a total charge that is less than zero.
10. The genome-editing complex of claim 1, wherein the helical protein has a helical structure with a stiffness parameter K (beta helix) 0.2 to 12 N/m.sup.2, as measured by atomic force microscopy.
11. The genome-editing complex of claim 1, wherein the helical protein is a pentapeptide-repeat protein.
12. The genome-editing complex of claim 1, wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof.
13. The genome-editing complex of claim 1, wherein the recombinant helical protein is linked to the one or more molecules of a genome-editing system, or the plasmid, by non-covalent interactions.
14. The genome-editing complex of claim 13, wherein the non-covalent interactions are selected from the group comprising hydrogen bonding, electrostatic interactions, van der Waal's interactions, hydrophobic interactions, or combinations thereof.
15. The genome-editing complex of claim 1, wherein the recombinant helical protein is linked to the one or more molecules of a genome-editing system, or the plasmid, via a linker molecule selected from the group consisting of: polyethyleneglycol (PEG); ethylene diamine; peptide; metal conjugate, drug-metal conjugate, DNA binding domain, nucleic acid intercalating molecule and combinations thereof.
16. The genome-editing complex of claim 15, wherein when the linker molecule is a peptide, the peptide comprises amino acids selected from the group consisting of: aliphatic amino acids; aromatic amino acids; and combinations thereof.
17. The genome-editing complex of claim 1, wherein the linker is linked to the recombinant helical protein by covalent bonds, non-covalent bonds, and combinations thereof; or wherein the recombinant helical protein is linked to the one or more molecules of a genome-editing system, or the plasmid, via by an ester linkage or an amide linkage.
18. The genome-editing complex of claim 1, wherein the genome-editing complex further comprises a signal sequence wherein the signal sequence directs the genome-editing complex to a particular cell or part of a cell.
19. The genome-editing complex of claim 18, wherein the signal sequence is selected from the group consisting of SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17.
20. The genome-editing complex of claim 1, wherein the genome-editing complex is used for genome editing.
Description
BRIEF DESCRIPTION OF ACCOMPANYING DRAWINGS
[0104] The following drawings form a part of the present specification and are included to further illustrate aspects of the present disclosure. The disclosure may be better understood by reference to the drawings in combination with the detailed description of the specific embodiments presented herein.
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
DETAILED DESCRIPTION OF THE INVENTION
[0137] Those skilled in the art will be aware that the present disclosure is subject to variations and modifications other than those specifically described. It is to be understood that the present disclosure includes all such variations and modifications. The disclosure also includes all such steps, features, compositions, and compounds referred to or indicated in this specification, individually or collectively, and any and all combinations of any or more of such steps or features.
Definitions
[0138] For convenience, before further description of the present disclosure, certain terms employed in the specification, and examples are delineated here. These definitions should be read in the light of the remainder of the disclosure and understood as by a person of skill in the art. The terms used herein have the meanings recognized and known to those of skill in the art, however, for convenience and completeness, particular terms and their meanings are set forth below.
[0139] Unless otherwise indicated, the practice of the present invention employs conventional techniques of chemistry, molecular biology, microbiology, recombinant DNA technology, and chemical methods, which are within the capabilities of a person of ordinary skill in the art. Such techniques are also explained in the literature, for example, M.R. Green, J. Sambrook, 2012, Molecular Cloning: A Laboratory Manual, Fourth Edition, Books 1-3, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY; Ausubel, F. M. et al. (1995 and periodic supplements; Current Protocols in Molecular Biology, ch. 9, 13, and 16, John Wiley & Sons, New York, N. Y.); B. Roc, J. Crabtree, and A. Kahn, 1996, DNA Isolation and Sequencing: Essential Techniques, John Wiley & Sons; J. M. Polak and James O'D. McGee, 1990, In Situ Hybridisation: Principles and Practice, Oxford University Press; M. J. Gait (Editor), 1984, Oligonucleotide Synthesis: A Practical Approach, IRL Press; and D. M. J. Lilley and J. E. Dahlberg, 1992, Methods of Enzymology: DNA Structure Part A: Synthesis and Physical Analysis of DNA Methods in Enzymology, Academic Press. Each of these general texts is herein incorporated by reference.
[0140] The articles a, an and the are used to refer to one or to more than one (i.e. to at least one) of the grammatical object of the article.
[0141] As used herein, the term comprising means any of the recited elements are necessarily included and other elements may optionally be included as well. Consisting essentially of means any recited elements are necessarily included, elements which would materially affect the basic and novel characteristics of the listed elements are excluded, and other elements may optionally be included. Consisting of means that all elements other than those listed are excluded. Embodiments defined by each of these terms are within the scope of this invention.
[0142] The term including is used to mean including but not limited to. Including and including but not limited to are used interchangeably.
[0143] As used herein, the term cell membrane is a biological membrane which is present in both prokaryotic and eukaryotic cells and separates the inner and outer environment of a cell. It acts as a semi-permeable barrier which checks the transport of substances in and out of the cell and is typically formed of a phospholipid bilayer. The membrane acts as a support and helps in maintaining the shape and structure of a cell.
[0144] As used herein the term helical protein means a protein forming a helical secondary structure. helical proteins are formed from a generally parallel association between adjacent strands of a peptide chain. A helical protein can be a right-handed helical or a left-handed B helical depending on the direction of coiling of the helix structure.
[0145] As used herein the term Pentapeptide-repeat protein (PRP) means helical proteins consisting of a tandemly repeated pentapeptide. In embodiments, the tandemly repeated pentapeptide has the consensus sequence (STAV).sub.1(DN).sub.2(LF).sub.3(STR).sub.4(G).sub.5. The PRP family has well over 500 members in the prokaryotic and eukaryotic kingdom.
[0146] As used herein the term functional molecule is any molecule that has a utility within a cell. Examples of functional molecules suitable for use in the present invention include dyes, drug molecules, proteins, enzymes, antibodies, and nucleic acids.
[0147] As used herein the term cell penetrating peptide or CPP relates to peptides sequences that facilitate cellular intake/uptake of various functional molecules. Cell penetrating peptides generally deliver the functional molecule directly through the cell membrane avoiding the need for endocytosis mediated pathways for cellular entry.
[0148] As used herein the term P-cadherin refers to a cell to cell adhesion molecule having a homeostatic function in normal tissues. The over expression of this molecule is associated with significant tumour promoting effects in the breast, ovarian, prostate, endometrial, skin, gastric, pancreas and colon neoplasms.
[0149] As used herein the term NHS-coumarin or NHSC refers to a fluorescent dye widely used in cell biology techniques. It is a common name for 7-(diethylamino) coumarin-3-carboxylic acid N-succinimidyl ester having a molecular weight of 358.35 g/mol. NHS-coumarin (NHSC) has an excitation wavelength of 445 nm and an emission wavelength at 482 nm. On observation under fluorescent microscopy, it emits green fluorescence indicating the location and quantification of the molecule conjugated along with this dye.
[0150] As used herein the term phosphatidyl choline defines a class of phospholipids molecules that incorporate a choline as a headgroup. Phosphatidyl choline may be used as a signalling molecule that facilitates selective binding and attachment with cell membranes.
[0151] As used herein the term Hoechst 33342 refers to a solution of fluorescent dye that is used for both fixed and live cell staining of DNA and nuclei in cellular imaging techniques. Hoechst 33342 is a cell-permeable DNA stain having an excitation wavelength of 460 nm and an emission wavelength of 490 nm and it preferentially binds to adenine (A)-thymine (T) region of DNA.
[0152] As used herein the term ATTO 520 or A-520, ATTO 390 or A-390 and ATTO 647N or A-647N refer respectively to fluorescent dyes developed by the ATTO-Tec GmbH and commercially available from Sigma Aldrich.
[0153] As used herein the term Ruthenium metal complex refers to the coordination complex of ruthenium metal which is known to possess anti-cancer activities. Octahedral ruthenium (III) and ruthenium (II) complexes display anti-neoplastic activities on many experimental tumours. Ruthenium metal complex is considered as an excellent alternative to circumvent the side-effects of platinum-based compounds. A non-limiting example of a ruthenium metal complex that has been demonstrated for use in the present invention is tricarbonyl dichloro ruthenium (II) (ex-Sigma Aldrich).
[0154] The term nucleic acid as used herein, is a single or double stranded covalently-linked sequence of nucleotides in which the 3 and 5 ends on each nucleotide are joined by phosphodiester bonds. The polynucleotide may be made up of deoxyribonucleotide bases or ribonucleotide bases. Nucleic acids may include DNA and RNA, and are typically manufactured synthetically, but may also be isolated from natural sources. Nucleic acids may further include modified DNA or RNA, for example DNA or RNA that has been methylated or that has been subject to chemical modification, for example 5-capping with 7-methylguanosine, 3-processing such as cleavage and polyadenylation, and splicing, or labelling with fluorophores or other compounds. Nucleic acids may also include synthetic nucleic acids (XNA), such as hexitol nucleic acid (HNA), cyclohexene nucleic acid (CeNA), threose nucleic acid (TNA), glycerol nucleic acid (GNA), locked nucleic acid (LNA) and peptide nucleic acid (PNA). Hence, where the terms DNA and RNA are used herein it should be understood that these terms are not limited to only include naturally occurring nucleotides. Sizes of nucleic acids, also referred to herein as polynucleotides are typically expressed as the number of base pairs (bp) for double stranded polynucleotides, or in the case of single stranded polynucleotides as the number of nucleotides (nt). One thousand bp or nt equal a kilobase (kb). Polynucleotides of less than around 100 nucleotides in length are typically called oligonucleotides.
[0155] As used herein, the terms 3 (3 prime) and 5 (5 prime) take their usual meanings in the art, i.e. to distinguish the ends of polynucleotides. A polynucleotide has a 5 and a 3 end and polynucleotide sequences are conventionally written in a 5 to 3 direction.
[0156] The term amino acid in the context of the present invention is used in its broadest sense and is meant to include naturally occurring L a-amino acids or residues. The commonly used one and three letter abbreviations for naturally occurring amino acids are used herein: A=Ala; C=Cys; D=Asp; E=Glu; F=Phe; G=Gly; H=His; I=Ile; K=Lys; L=Leu; M=Met; N=Asn; P=Pro; Q=Gln; R=Arg; S=Ser; T=Thr; V=Val; W=Trp; and Y=Tyr (Lechninger, A. L., (1975) Biochemistry, 2d ed., pp. 71-92, Worth Publishers, New York). The general term amino acid further includes D-amino acids, retro-inverso amino acids as well as chemically modified amino acids such as amino acid analogues, naturally occurring amino acids that are not usually incorporated into proteins such as norleucine, and chemically synthesised compounds having properties known in the art to be characteristic of an amino acid, such as -amino acids. For example, analogues or mimetics of phenylalanine or proline, which allow the same conformational restriction of the peptide compounds as do natural Phe or Pro, are included within the definition of amino acid. Such analogues and mimetics are referred to herein as functional equivalents of the respective amino acid. Other examples of amino acids are listed by Roberts and Vellaccio, The Peptides: Analysis, Synthesis, Biology, Gross and Meichofer, eds., Vol. 5 p. 341, Academic Press, Inc., N.Y. 1983, which is incorporated herein by reference.
[0157] A polypeptide is a polymer of amino acid residues joined by peptide bonds, whether produced naturally or in vitro by synthetic means. Polypeptides of less than around 12 amino acid residues in length are typically referred to as peptides and those between about 12 and about 30 amino acid residues in length may be referred to as oligopeptides. The term polypeptide as used herein denotes the product of a naturally occurring polypeptide, precursor form or proprotein. Polypeptides can also undergo maturation or post-translational modification processes that may include, but are not limited to: glycosylation, proteolytic cleavage, lipidization, signal peptide cleavage, propeptide cleavage, phosphorylation, and such like. The term protein is used herein to refer to a macromolecule comprising one or more polypeptide chains.
[0158] The term isolated, when applied to a polynucleotide or protein sequence, denotes that the sequence has been removed from its natural organism of origin and is, thus, free of extraneous or unwanted coding or regulatory sequences. The isolated sequence is suitable for use in assembly of compositions and nanostructures of the present invention. Such isolated sequences may include cDNAs and RNAs.
[0159] According to the present invention, homology to the nucleic acid or protein sequences described herein is not limited simply to 100% sequence identity. Any closely related nucleic acid or protein sequences to those specified herein that demonstrate functional and/or biochemical equivalence are considered within the scope of the present invention as defined by the claims.
[0160] The term signal sequence in the context of the present invention means nuclear localizing sequence or recognition sequences for different cell organelles or nucleic acid binding domains such as zinc finger binding proteins.
[0161] As used herein the term carrier means substances that serve as mechanisms to improve the delivery and the effectiveness of the drug.
[0162] As used herein the term diluent (also referred to as filler, dilutant, or thinner) means a diluting agent.
[0163] As used herein the term excipient refers to an inactive substance that serves as a vehicle or medium for a drug or other active substance. Excipients include colouring agents, humectants, preservatives, emollients and combinations thereof.
[0164] As used herein, the term RNA-guided endonuclease is meant a polypeptide which endonuclease activity and specificity dependent on its association with at least one guide RNA molecule. An example of RNA-guided endonuclease is Cas9 as part of the Cas9/CRISPR system.
[0165] As used herein the term CRISPR (clustered regularly interspaced short palindromic repeats) refers to a family of DNA sequences found within the genomes of prokaryotic organisms such as bacteria. The term may be used to refer to the techniques of gene editing that relies on the use of CRISPR associated proteins, for example Cas-9 (CRISPR-associated protein 9) that can associate with and then use CRISPR sequences as a guide to recognise and cleave specific strands of DNA that are complimentary to the CRISPR sequence. Cas9 nucleases together with CRISPR sequences form the basis of the CRISPR-Cas9 gene editing technique.
[0166] As used herein, the term Cas9 refers to the Cas9 endonuclease protein. Also named Csn1 (COG3513) Cas9 is a large protein that participates in both crRNA biogenesis and in the destruction of invading DNA. The term Cas9 is also meant to encompass an engineered endonuclease or a homologue of Cas9 which is capable of processing target nucleic acid sequence. Cas9 can induce a cleavage in the nucleic acid target sequence which can correspond to either a double-stranded break or a single-stranded break. The term Cas9 is intended to include variants that can be a Cas9 endonuclease that does not naturally exist in nature and that is obtained by protein engineering or by random mutagenesis provided such Cas9 variants remain functional, i.e. they retain the capacity of processing a target nucleic acid sequence.
[0167] As used herein the term CRISPR-RNP relates to a CRISPR ribonucleotide comprising a CRISPR endonuclease protein and one or more guide RNAs. The term CRISPRRNP-CPP use herein relates to conjugate of a CRISPR-RNP complex with a cell penetrating peptide of an embodiment of the present invention.
[0168] As used herein, the term guide RNA or gRNA refers to an RNA polynucleotide sequence comprising a guide sequence. In use, guide RNAs can be associated with an endonuclease that acts to cut a double stranded DNA at a site determined by the gRNA. The term guide sequence refers to a sequence preferably longer than 8 nucleic acid bases, more preferably longer than 10 nucleic acid bases, even more preferably longer than 12 nucleic acid bases, has the ability to specify a target sequence in the genome. In general, this RNA molecule has the ability to hybridize said target sequence and to mediate the endonuclease activity of said endonuclease.
[0169] As used herein the term wild type refers to the typical or naturally-occurring form of an organism, strain, gene or characteristic as distinguished from mutant or variant forms.
[0170] As used herein, the term non-naturally occurring or engineered are used interchangeably. The terms, when referring to nucleic acid molecules or polypeptides, mean that the nucleic acid molecule or the polypeptide differs from that found in nature and/or is at least substantially free from at least one other component with which they are naturally associated in nature.
[0171] As used herein, the term complementarity refers to the ability of a nucleic acid to associate with, for example a non-covalent interaction via hydrogen bond(s), with another nucleic acid sequence by either traditional Watson-Crick base pairing or other non-traditional types. A percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%/, 90%, and 100% complementary).
[0172] As used herein, the term expression refers to the process by which a polynucleotide is transcribed from a DNA template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins.
[0173] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the disclosure, the preferred methods, and materials are now described. All publications mentioned herein are incorporated herein by reference.
Sequences
TABLE-US-00001 SEQIDNO:1depictsaminoacidsequenceofAlbG protein. MPAKTLESKDYCGESFVSEDRSGQSLESIRFEDCTFRQCNFTEAELNRCK FRECEFVDCNLSLISIPQTSFMEVRFVDCKMLGVNWTSAQWPSVKMEGAL SFERCILNDSLFYGLYLAGVKMVECRIHDANFTEADCEDADFTQSDLKGS TFHNTKLTGASFIDAVNYHIDIFHNDIKRARFSLPEAASLLNSLDIELSD SEQIDNO:2depictsaminoacidsequenceofEfsQNR protein. GSHMKITYPLPPNLPEQLPLLTNCQLEDEAILENHLYQQIDLPNQEVRNL VFRDAVEDHLSLANGQFASFDCSNVRFEACDFSNVEWLSGSFHRVTFLRC NLTGTNFADSYLKDCLFEDCKADYASFRFANFNLVHFNQTRLVESEFFEV TWKKLLLEACDLTESNWLNTSLKGLDFSQNTFERLTFSPNYLSGLKVTPE QAIYLASALGLVIT SEQIDNO:3depictsaminoacidsequenceof anti-freezeproteinfromTenebriomolitor. QCTGGADCTSCTGACTGCGNCPNAVTCTNSQHCVKANTCTGSTDCNTAQT CTNSKDCFEANTCTDSTNCYKATACTNSSGCPGH SEQIDNO:4depictsaminoacidsequenceof anti-freezeproteinfromRhagiuminquisitor. GYSCRAVGVDGRAVTDIQGTCHAKATGAGAMASGTSEPGSTSTATATGRG ATARSTSTGRGTATTTATGTASATSNAIGQGTATTTATGSAGGRATGSAT TSSSASQPTQTQTITGPGFQTAKSFARNTATTTVTASHHHHHH SEQIDNO:5depictsaminoacidsequenceof anti-freezeproteinfromSpruceBudworm (Choristoneurafumiferana). DGSCTNTNSQLSANSKCEKSTLTNCYVDKSEVYGTTCTGSRFDGVTITTS TSTGSRISGPGCKISTCIITGGVPAPSAACKISGCTFSAN SEQIDNO:6depictsaminoacidsequenceof QNRB1protein. GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYD RESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFR GASFMNMITTRTWFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVL GATESGSDLSGGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLD NYQASLLMERLGIAVIG SEQIDNO:7depictsaminoacidsequenceof UDP-N-acetylglucosamineacyltransferaseprotein. MIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVV NGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHR GTVQGGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDF AIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIE GLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFT DFFARSTRGLIR SEQIDNO:8depictsaminoacidsequenceof NP275proteinfromNostocpunctiforme. MGSSHHHHHHSSGLVPRGSHMDVEKLRQLYAAGERDFSIVDLRGAVLENI NLSGAILHGAMLDEANLQQANLSRADLSGATLNGADLRGANLSKADLSDA ILDNAILEGAILDEAVLNQANLKAANLEQAILSHANIREADLSEANLEAA DLSGADLAIADLHQANLHQAALERANLTGANLEDANLEGTILEGGNNNLA T SEQIDNO:9depictsaminoacidsequenceof pectatelyaseC. ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDANGKKVKGGAY PLVITYTGNEDSLINAAAANICGQWSKDPRGVEIKEFTKGITIIGANGSS ANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNVWVDHNELFA ANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSD TGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQA LIENNWFEKAINPVTSRYDGKNFGTWVLKGNNITKPADESTYSITWTADT KPYVNADSWTSTGTFPTVAYNYSPVSAQCVKDKLPGYAGVGKNLATLTST ACK SEQIDNO:10depictsaminoacidsequenceof pectatelyasefromCaldicellulosiruptorbescii VGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKL EKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEV IGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLE DVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY SEQIDNO:11depictsaminoacidsequence ofcarbonicanhydrasefromMethanosarcina thermophila. QEITVDEFSNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANV MVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEV DGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVL EPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVY VNVHLAEGYKETS SEQIDNO:12depictsaminoacidsequenceof PectinlyaseAproteinfromAspergillusniger. VGVSGSAEGFAKGVTGGGSATPVYPDTIDELVSYLGDDEARVIVLTKTFD FTDSEGTTTGTGCAPWGTASACQVAIDQDDWCENYEPDAPSVSVEYYNAG TLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVTDINPKYV WGGDAITLDDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVS DYSATCDGYHYWAIYLDGDADLVTMKGNYIYHTSGRSPKVQDNTLLHAVN NYWYDISGHAFEIGEGGYVLAEGNVFQNVDTVLETYEGEAFTVPSSTAGE VCSTYLGRDCVINGFGSSGTFSEDSTSFLSDFEGKNIASASAYTSVASRV VANAGQGNL SEQIDNO:13depictsaminoacidsequence ofTtCuAprotein. AYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYV LAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVS TVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE SEQIDNO:14depictsasignalsequencefor targetingthenucleusofthecell. PAAKRVKCD SEQIDNO:15depictsasignalsequencefor targetingtheendoplasmicreticulum ofthecell. YPYDVPDYAKDEL SEQIDNO:16depictsasignalsequencefor targetingthemitochondriaofthecell. MLSLRQSIRFFKPATRTLCSSRYLL SEQIDNO:17depictsasignalsequencefor targetingtheP-cadherin-over expressingbreastcancercells. LSTAADMQGVVTDGMASGLDKDYLKPDD SEQIDNO:18depictsaconsensussequence inapentapeptide-repeatprotein. (STAV).sub.1(DN).sub.2(LF).sub.3(STR).sub.4(G).sub.5 SEQIDNO:19depictsanucleicacidsequence ofAlbGgene. ATGCCGGCGAAAACCCTGGAAAGCAAAGATTATTGCGGCGAAAGCTTTGT GAGCGAAGATCGCAGCGGCCAGAGCCTGGAAAGCATTCGCTTTGAAGATT GCACCTTTCGCCAGTGCAACTTTACCGAAGCGGAACTGAACCGCTGCAAA TTTCGCGAATGCGAATTTGTGGATTGCAACCTGAGCCTGATTAGCATTCC GCAGACCAGCTTTATGGAAGTGCGCTTTGTGGATTGCAAAATGCTGGGCG TGAACTGGACCAGCGCGCAGGCGGGCGCGCTGAGCTTTGAACGCTGCATT CTGAACGATAGCCTGTTTTATGGCCTGTATCTGGCGGGCGTGAAAATGGT GGAATGCCGCATTCATGATGCGAACTTTACCGAAGCGGATTGCGAAGATG CGGATTTTACCCAGAGCGATCTGAAAGGCAGCACCTTTCATAACACCAAA CTGACCGGCGCGAGCTTTATTGATGCGGTGAACTATCATATTGATATTTT TCATAACGATATTAAACGCGCGCGCTTTAGCCTGCCGGAAGCGGCGAGCC TGCTGAACAGCCTGGATATTGAACTGAGCGAT SEQIDNO:20depictsanucleicacidsequence ofEfsQNRgene. GGCAGCCATATGAAAATTACCTATCCGCTGCCGCCGAACCTGCCGGAACA GCTGCCGCTGCTGACCAACTGCCAGCTGGAAGATGAAGCGATTCTGGAAA ACCATCTGTATCAGCAGATTGATCTGCCGAACCAGGAAGTGCGCAACCTG GTGTTTCGCGATGCGGTGTTTGATCATCTGAGCCTGGCGAACGGCCAGTT TGCGAGCTTTGATTGCAGCAACGTGCGCTTTGAAGCGTGCGATTTTAGCA ACGTGGAATGGCTGAGCGGCAGCTTTCATCGCGTGACCTTTCTGCGCTGC AACCTGACCGGCACCAACTTTGCGGATAGCTATCTGAAAGATTGCCTGTT TGAAGATTGCAAAGCGGATTATGCGAGCTTTCGCTTTGCGAACTTTAACC TGGTGCATTTTAACCAGACCCGCCTGGTGGAAAGCGAATTTTTTGAAGTG ACCTGGAAAAAACTGCTGCTGGAAGCGTGCGATCTGACCGAAAGCAACTG GCTGAACACCAGCCTGAAAGGCCTGGATTTTAGCCAGAACACCTTTGAAC GCCTGACCTTTAGCCCGAACTATCTGAGCGGCCTGAAAGTGACCCCGGAA CAGGCGATTTATCTGGCGAGCGCGCTGGGCCTGGTGATTACC SEQIDNO:21depictsanucleicacidsequence ofTtCuAgene GCGTATACCCTGGCGACCCATACCGCGGGCGTGATTCCGGCGGGCAAACT GGAACGCGTGGATCCGACCACCGTGCGCCAGGAAGGCCCGTGGGCGGATC CGGCGCAGGCGGTGGTGCAGACCGGCCCGAACCAGTATACCGTGTATGTG CTGGCGTTTGCGTTTGGCTATCAGCCGAACCCGATTGAAGTGCCGCAGGG CGCGGAAATTGTGTTTAAAATTACCAGCCCGGATGTGATTCATGGCTTTC ATGTGGAAGGCACCAACATTAACGTGGAAGTGCTGCCGGGCGAAGTGAGC ACCGTGCGCTATACCTTTAAACGCCCGGGCGAATATCGCATTATTTGCAA CCAGTATTGCGGCCTGGGCCATCAGAACATGTTTGGCACCATTGTGGTGA AAGAA SEQIDNO:22depictsasignalsequencefor targetingtoactininthecell. GDVQKKRWLFETKPLD SEQIDNO:23depictsasignalsequencefor targetingtotubulininthecells. VQSKCGSKDNIKHVPGGG SEQIDNO.24:depictsanaminoacidsequence ofazincfingerprotein MERPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHL TTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKD SEQIDNO.25:depictsanucleicacidsequence ofmcherrygene. GTGAGCAAGGGCGAGGAGGATAACATGGCCATCATCAAGGAGTTCATGCG CTTCAAGGTGCACATGGAGGGCTCCGTGAACGGCCACGAGTTCGAGATCG AGGGCGAGGGCGAGGGCCGCCCCTACGAGGGCACCCAGACCGCCAAGCTG AAGGTGACCAAGGGTGGCCCCCTGCCCTTCGCCTGGGACATCCTGTCCCC TCAGTTCATGTACGGCTCCAAGGCCTACGTGAAGCACCCCGCCGACATCC CCGACTACTTGAAGCTGTCCTTCCCCGAGGGCTTCAAGTGGGAGCGCGTG ATGAACTTCGAGGACGGCGGCGTGGTGACCGTGACCCAGGACTCCTCCCT CCAGGACGGCGAGTTCATCTACAAGGTGAAGCTGCGCGGCACCAACTTCC CCTCCGACGGCCCCGTAATGCAGAAGAAGACCATGGGCTGGGAGGCCTCC TCCGAGCGGATGTACCCCGAGGACGGCGCCCTGAAGGGCGAGATCAAGCA GAGGCTGAAGCTGAAGGACGGCGGCCACTACGACGCTGAGGTCAAGACCA CCTACAAGGCCAAGAAGCCCGTGCAGCTGCCCGGCGCCTACAACGTCAAC ATCAAGTTGGACATCACCTCCCACAACGAGGACTACACCATCGTGGAACA GTACGAACGCGCCGAGGGCCGCCACTCCACCGGCGGCATGGACGAGCTGT ACAAGTAGTAATCTAGAGGGCCCTATTCTATAGTGTCACC. SEQIDNO.26:depictsanucleicacidsequence ofaprimerforPCRamplification oftheAlbGgene. ATCCCGCTCATATGCCGGCCAAGACCCTTG SEQIDNO.27:depictsanucleicacidsequence ofaprimerforPCRamplification oftheAlbGgene. ATCCCGCTCTCGAGTCAATCGGACAGCTCGATATC SEQIDNO.28:depictsanucleicacidsequence ofaprimerforPCRamplification oftheEfsQNRgene. ATCCCGCTCATATGAAAATAACTTATCCCTTGCCA SEQIDNO.29:depictsanucleicacidsequence ofaprimerforPCRamplification oftheEfsQNRgene. ATCCCGCTCTCGAGTTAGGTAATCACCAAACCAAGT
[0174] The present invention also provides for conjugates comprising a recombinant protein and a functional molecule for penetrating cellular membranes, and uses thereof that have substantially similar sequence identity or homology to that of SEQ ID NOs: 1 to 12. The term substantially similar sequence identity is used herein to denote a level of sequence similarity of from about 50%, 60%, 70%, 80%, 90%, 95% to about 99% identity. Percent sequence identity can be determined using conventional methods, for example those described in Henikoff and Henikoff Proc. Natl. Acad. Sci. USA 1992; 89:10915, and Altschul et al. Nucleic Acids Res. 1997; 25:3389-3402 for nucleic acids; and for proteins via comparison after alignment using systems such as BLAST.
Cell Penetrating Conjugate with Functional Molecules
[0175] Identifying novel drugs to cure or prevent life threatening diseases remains a highly active area of research. Most of such drugs tend to have targets inside the cells and to reach the target they would have to cross the semi permeable membrane which is not straightforward or efficient in many cases. Therefore, developing novel mechanisms to penetrate the cell membrane remains desirable. On the other hand, scientific investigations and studies aiming to unravel various cellular mechanisms are also seeking to find novel methods of penetrating cell membranes which can help in the labelling of the cell and its various organelles. Also, it would be highly useful in delivering the required materials inside cells for scientific experiments. Most of the cell penetrating molecules described in recent reports involve the endocytosis mechanism of cell entry.
[0176] To circumvent the disadvantages of the intake of molecules through endocytosis, for example the entrapment and degradation of drugs in different types of endosomal compartments which eventually fuse with degradative compartment of cells such as lysosomes, a cell membrane penetrating conjugate is disclosed herein which can penetrate the cell membrane to gain access to the inside the cells and can also be used to deliver various cargos including dyes, drugs, proteins, enzymes, antibodies, and nucleic acids inside the cells.
[0177] The present disclosure is not to be limited in scope by the specific embodiments described herein, which are intended for the purposes of exemplification only. Functionally-equivalent products, compositions, and methods are clearly within the scope of the disclosure, as described herein.
[0178] The present invention discloses a conjugate capable of penetrating a cell membrane. The conjugate comprises a recombinant helical protein, or a recombinant helical protein portion, linked to a functional molecule wherein the protein has a longest dimension, defined as its length, in the range of 5 nm-25 nm and a width or diameter, defined as the dimension of the protein structure substantially perpendicular to its length, in the range of 1 nm-5 nm. The dimension of the protein in defined as measured in the solid state (characterized by x-ray crystallography or atomic force microscopy) or in solution state (dynamic light scattering measurements).
[0179] In embodiments of the present invention, the protein structure of the conjugate may have a longest dimension or length greater than 5 nm, 7.5 nm, 10 nm, 11 nm, 12 nm, 13 nm or 14 nm. In embodiments, the protein structure of the conjugate may have a longest dimension or length less than 25 nm, 20 nm, 17.5 nm, 15 nm, 14 nm, 13 nm, 12 nm or 11 nm. Suitably the length is in the range of from 5 nm to 25 nm, more suitably from 10 nm to 15 nm, even more suitably from 11 nm to 14 nm or 12 nm to 13 nm. In embodiments, the protein structure of the conjugate may have a width or diameter, in a dimension substantially perpendicular to its length, of at least 1 nm, 1.1 nm, 1.2 nm, 1.3 nm, 1.4 nm, 1.5 nm, 1.6 nm, 1.7 nm, 1.8 nm, 1.9 nm or 2.0 nm. In embodiments, the protein structure of the conjugate may have a longest dimension or length less than 5.0 mm, 4.5 nm, 4.0 nm, 3.5 nm, 3.0 nm, 2.9 nm, 2.8 nm, 2.7 nm, 2.6 nm, 2.5 nm, 2.4 nm, 2.3 nm, 2.2 nm, 2.1 nm or 2.0 nm. Suitably the width is in the range of from 1 nm to 5 nm, more suitably from 1 nm to 3 nm, even more suitably from 1.5 nm to 2.5 nm. In an embodiment, the protein structure of the conjugate of the present invention may have tip shape that is generally quadrangular (four sides) in cross-section along a longitudinal axis. Suitably, the shape is rectangular. Suitably it is the tip or end of the protein structure that is quadrangular. The tip may be generally rectangular, i.e. not have precise right angled corners or the corners may be somewhat rounded. Suitably, the tip has a length in the range of from 5 nm to 25 nm, and a width in the range of from 1 nm to 5 nm. In embodiments, the tip may have dimensions as defined for the protein conjugate above.
[0180] A surrogate for or an alternative definition for the physical size of the protein portion of the conjugate of the present invention is the combination of its -helical structure along with its molecular weight. The definition of the size of the protein based on its physical dimensions or on its molecular weight may be used interchangeably. In embodiments of the present invention, the molecular weight of the protein portion may be at least 30 kDa. Suitably, the molecular weight of the protein portion may be at least 35 kDa, 40 kDa, 45 kDa or 50 kDa. In embodiments of the present invention, the molecular weight of the protein portion may be at most 100 kDa. Suitably, the molecular weight of the protein portion may be at most 90 kDa, 80 kDa, 70 kDa, 60 kDa, 55 kDa or 50 kDa. Suitably the molecular weight range of the protein portion of the conjugate of the present invention is in the range of 30-100 kDa, more suitably, 40-60 kDa, even more suitably 48-55 kDa.
[0181] Without wishing to be bound by theory, it is envisaged that the beneficial properties in cell penetration demonstrated by the conjugates of the present invention is due to the physical size of the protein portion, as defined by the dimensions or molecular weight outlined above. A further feature of the proteins is the rigidity that derives largely from the uncommon -helical secondary structure. Suitably the protein may be more rigid than the membrane to be penetrated. Typical cell membranes have a rigidity of 0.005 to 0.02 N/m.sup.2 (as measured by Atomic Force Microscopy; Hayashi, Tensile Properties and Local Stiffness of Cells; Mechanics of Biological Tissue, pp 137-152) depending on cell type. Suitably the proteins of the present invention have a rigidity, or high stiffness parameter (K) typical of a B-helix of 0.7 to 12 N/m.sup.2 (Keten et al., Cell Mol. Bioeng. 2009; 2; 66-74, which is incorporated herein by reference).
[0182] A further feature thought to be influential in the efficiency of cell penetration of the conjugates of the present invention is the charge profile and arrangement of the amino acids in the B-helical structure of the protein. Specifically, the presence of charged lysine, arginine asparagine, aspartic acid and/or glutamic acid ladders in the -helical protein structure facilitates penetration of the cell membrane, and the total negative charge of the protein sequence.
[0183] The term ladder in respect of amino acid residues in -helical protein structures is defined as a presence of alternatively arranged positively (lysine, arginine and/or asparagine) and negatively charged residues (aspartic acid and/or glutamic acid) along the length of the surface of the protein.
[0184] Without wishing to be bound by theory, the presence of charged ladder structures in the B-helical structure of the protein according to the present invention could be facilitating the interaction of the protein with the lipid molecules of the cell membrane (e.g. in forming hydrogen bond with the hydroxyl groups of the lipid molecules) and/or first attachment of the protein onto the negatively charged cell membrane.
[0185] The total negative charge of the protein according to the present invention due to the negatively charged residues could be facilitating the repulsion leading to angular motion of the protein to make it stand straight on the membrane and puncture the membrane.
[0186] In embodiments of the present invention, the protein of the conjugate comprises ladders of alternately arranged surface exposed positively and negatively charged amino acid residues. In embodiments, the protein comprises at least one of an arginine ladder (10-30 Arg residues), a lysine ladder (10-30 Lys residues), an asparagine ladder (10-40 Asn residues), aspartic acid (10-40 Asp residues) and glutamic acid (10-40 Glu residues).
[0187] In embodiments of the present invention, the total formal charge of the protein may be zero, or it may be non-zero. Suitably the total formal charge is non-zero, more suitably the total formal charge is below zero (negative). In embodiments the total formal charge of the protein is below (i.e. more negative than) 10. Suitably, the total formal charge of the protein is below 20, 25, 30, 35, 40, 45 or 50. More suitably the total form charge is below 20. In embodiments the total formal charge of the protein is above (i.e. less negative than) 80. Suitably, the total formal charge of the protein is above 70, 65, 60, 55, 50, 45, 40, 35, or 30. More suitably, the total formal charge is above 60. In embodiments, the total formal charge of the protein is in the range of from 10 to 80, more suitably from 20 to 60.
[0188] The efficiency of cell penetration and the mechanism of cell penetration may be modulated by optimizing the total formal charge of the conjugates by increasing the number of positively charged residues (e.g. arginine) along the surface of the protein and the sequences can be mutated at the N terminal with the signalling sequences (SEQ ID NOs: 14, 15, 16 or 17 and/or phosphatidyl choline) for attaining specificity of cellular organelles or specificity of particular cancer cells.
[0189] In an embodiment, the protein of the conjugate of the present invention suitable for direct cell penetration (i.e. non-endocytotic) may have one or more of the following structural parameters: [0190] Beta helical structure with stiffness parameter K (beta helix) 0.2 to 12 N/m.sup.2; [0191] Length between 5 nm to 25 nm; [0192] Diameter between 1 nm to 5 nm; [0193] Molecular weight between 25 KDa to 100 KDa; [0194] Alternatively arranged ladders of surface exposed positive and negative charge residues on the surface of the protein along the length: an arginine ladder (10-30 Arg residues), a lysine ladder (10-30 Lys residues), an asparagine ladder (10-40 Asn residues), aspartic acid (10-40 Asp residues) and glutamic acid (10-40 Glu residues); [0195] Total formal charge (20 to 60).
[0196] In embodiments of the present invention, the linker between the -helical protein and the functional molecule may be formed by a direct link between the -helical protein and the functional molecule, for example via an amide (or peptidic), or ester covalent linkage, or via metal coordination; or the linker may take the form of a linker molecule. Suitably the link is by covalent or non-covalent bonds or interactions. When the linker is a linker molecule the linker molecule may take any suitable form that reversibly connects the -helical protein and the functional molecule. In some embodiments, the linker molecule may be selected from the group consisting of a peptide or protein, PEG (polyethylene glycol) linker, organic molecule, metal conjugate, drug-metal conjugate, nucleic acid binding domains, and nucleic acid intercalating molecule.
[0197] In an embodiment, the present invention discloses a conjugate having a recombinant helical protein of length in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, wherein the helical protein has a specific sequence linked to a functional molecule. Suitably the specific sequence is a penta-peptide repeat. In an embodiment, the consensus sequence of the recombinant helical protein linked to a functional molecule is (STAV).sub.1(DN).sub.2(LF).sub.3(STR).sub.4(G).sub.5. Examples of pent-peptide repeat proteins are SEQ ID Nos: 1, 2, 6 and 8.
[0198] In embodiments of the present disclosure, the recombinant helical protein is selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12.
[0199] In embodiments of the present invention, the functional molecule can be any organic molecule (anticancer drugs, antibiotics, NSAIDS, pain relieving drugs or any other drug molecule, fluorescent dyes, insecticides, pesticides etc.), drug-metal complex, metal, antibody, protein, polysaccharide, nucleic acids, peptides, nuclear localising signal, quantum dots and nanoparticles.
[0200] The conjugate can be used to transfer a functional molecule inside the cells facilitated by the ability of the conjugate to penetrate the cell membrane. With appropriate localising signals associated with or integrated with the conjugate or the functional molecule or both, the conjugate of the present invention can be used to target the functional molecule to a specific part of the interior of the cell, for example, the organelles present inside the cells.
[0201] In an embodiment, the present invention also discloses a process for transferring a functional molecule inside the cells using the cell penetrating conjugate of the present invention. The process disclosed can further be used for cell labelling, cell penetration, and targeting of any functional molecule to cell organelles.
[0202] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm.
[0203] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the helical protein is a pentapeptide-repeat protein.
[0204] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the helical protein comprises tandemly repeated pentapeptide with consensus sequence (STAV) I (DN) 2 (LF) 3 (STR) 4 (G) 5.
[0205] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof.
[0206] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the helical protein is AlbG having a sequence as set forth in SEQ ID NO: 1.
[0207] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the helical protein is EfsQNR having a sequence as set forth in SEQ ID NO: 2.
[0208] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is an anti-freeze protein having a sequence as set forth in SEQ ID NO: 3.
[0209] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is an anti-freeze protein having a sequence as set forth in SEQ ID NO: 4.
[0210] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is an anti-freeze protein having a sequence as set forth in SEQ ID NO: 5.
[0211] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is QNRB1 having a sequence as set forth in SEQ ID NO: 6.
[0212] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is UDP N-acetylglucosamine acyltransferase having a sequence as set forth in SEQ ID NO: 7.
[0213] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is NP275 having a sequence as set forth in SEQ ID NO: 8.
[0214] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is pectate lyase C having a sequence as set forth in SEQ ID NO: 9.
[0215] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is a pectate lyase having a sequence as set forth in SEQ ID NO: 10.
[0216] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is carbonic anhydrase having a sequence as set forth in SEQ ID NO: 11.
[0217] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is Pectin Lyase A having a sequence as set forth in SEQ ID NO: 12.
[0218] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is selected from the group consisting of dyes, drugs, metal, drug-metal complex, proteins, enzymes, antibodies, nucleic acids, polysaccharides, nuclear localizing signals, nanoparticles, and combinations thereof.
[0219] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is a dye.
[0220] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is a drug.
[0221] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is a metal.
[0222] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is a drug-metal complex.
[0223] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is a protein.
[0224] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is an enzyme.
[0225] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is an antibody.
[0226] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is a nucleic acid.
[0227] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is a polysaccharide.
[0228] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is a nuclear localising signal.
[0229] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is a nanoparticle.
[0230] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is linked to the recombinant helical protein by covalent bonds, non-covalent bonds, and combinations thereof.
[0231] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is linked to the recombinant helical protein by covalent bonds.
[0232] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the functional molecule is linked to the recombinant helical protein by non-covalent bonds.
[0233] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule as described herein, wherein the complex further comprises a signal sequence.
[0234] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule as described herein, wherein the conjugate further comprises a phospholipid molecule.
[0235] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule as described herein, wherein the conjugate further comprises a signal sequence selected from the group consisting of SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17.
[0236] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule as described herein, wherein the conjugate further comprises a phosphatidyl choline molecule.
[0237] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule as described herein, wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 14.
[0238] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule as described herein, wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 15.
[0239] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule as described herein, wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 16.
[0240] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule as described herein, wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 17.
[0241] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to nucleus of the cell, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 14.
[0242] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to nucleus of the cell as described herein, wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof, and wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 14.
[0243] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to nucleus of the cell as described herein, wherein the functional molecule is selected from the group consisting of dyes, drugs, metal, drug-metal complex, proteins, enzymes, antibodies, nucleic acids, polysaccharides, nuclear localizing signals, nanoparticles, and combinations thereof.
[0244] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to endoplasmic reticulum of the cell, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 15.
[0245] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to endoplasmic reticulum of the cell as described herein, wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof, and wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 15.
[0246] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to endoplasmic reticulum of the cell as described herein, wherein the functional molecule is selected from the group consisting of dyes, drugs, metal, drug-metal complex, proteins, enzymes, antibodies, nucleic acids, polysaccharides, nuclear localizing signals, nanoparticles, and combinations thereof.
[0247] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to mitochondria of the cell, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 16.
[0248] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to mitochondria of the cell as described herein, wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof, and wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 16.
[0249] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to mitochondria of the cell as described herein, wherein the functional molecule is selected from the group consisting of dyes, drugs, metal, drug-metal complex, proteins, enzymes, antibodies, nucleic acids, polysaccharides, nuclear localizing signals, nanoparticles, and combinations thereof.
[0250] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to P-cadherin overexpressing breast cancer cells, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 17.
[0251] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to P-cadherin overexpressing breast cancer cells as described herein, wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof, and wherein the conjugate further comprises a signal sequence as set forth in SEQ ID NO: 17.
[0252] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to P-cadherin overexpressing breast cancer cells as described herein, wherein the functional molecule is selected from the group consisting of dyes, drugs, metal, drug-metal complex, proteins, enzymes, antibodies, nucleic acids, polysaccharides, nuclear localizing signals, nanoparticles, and combinations thereof.
[0253] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to membrane of the cell, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the conjugate further comprises a phosphatidyl choline molecule.
[0254] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to membrane of the cell as described herein, wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof, and wherein the conjugate further comprises a phosphatidyl choline molecule.
[0255] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate comprising a recombinant helical protein linked to a functional molecule for transferring the functional molecule to membrane of the cell as described herein, wherein the functional molecule is selected from the group consisting of dyes, drugs, metal, drug-metal complex, proteins, enzymes, antibodies, nucleic acids, polysaccharides, nuclear localizing signals, nanoparticles, and combinations thereof.
[0256] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell, said process comprising: (a) linking the functional molecule to a recombinant helical protein to obtain a conjugate; (b) contacting the conjugate with at least one cell wherein contacting the conjugate transfers the functional molecule into the cell, and wherein length of the helical protein is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm. In an embodiment, the process further comprises after step (c), step (d) detecting the transfer of the conjugate inside the cell.
[0257] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is a pentapeptide-repeat protein.
[0258] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein comprises tandemly repeated pentapeptide with consensus sequence (STAV) I (DN) 2 (LF) 3 (STR)+ (G) 5.
[0259] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof.
[0260] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is AlbG having a sequence as set forth in SEQ ID NO: 1.
[0261] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is EfsQNR having a sequence as set forth in SEQ ID NO: 2.
[0262] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is an anti-freeze protein having a sequence as set forth in SEQ ID NO: 3.
[0263] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is an anti-freeze protein having a sequence as set forth in SEQ ID NO: 4.
[0264] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is an anti-freeze protein having a sequence as set forth in SEQ ID NO: 5.
[0265] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is QNRB1 having a sequence as set forth in SEQ ID NO: 6.
[0266] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is UDP N acetylglucosamine acyltransferase having a sequence as set forth in SEQ ID NO: 7.
[0267] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is NP275 having a sequence is as set forth in SEQ ID NO: 8.
[0268] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is pectate lyase C having a sequence as set forth in SEQ ID NO: 9.
[0269] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is a pectate lyase having a sequence as set forth in SEQ ID NO: 10.
[0270] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is carbonic anhydrase having a sequence as set forth in SEQ ID NO: 11.
[0271] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein having a sequence is as set forth in SEQ ID NO: 12.
[0272] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is selected from the group consisting of dyes, drugs, metal, drug-metal complex, proteins, enzymes, antibodies, nucleic acids, polysaccharides, nuclear localizing signals, nanoparticles, and combinations thereof.
[0273] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is a dye.
[0274] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is a drug.
[0275] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is a metal.
[0276] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is a drug-metal complex.
[0277] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is a protein.
[0278] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is an enzyme.
[0279] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is an antibody.
[0280] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is a nucleic acid.
[0281] In an embodiment of the present disclosure, there is provided process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is a polysaccharide.
[0282] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is a nuclear localising signal.
[0283] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is a nanoparticle.
[0284] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the functional molecule is linked to the recombinant helical protein by covalent bonds, non-covalent bonds, and combinations thereof.
[0285] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the cell is selected from the group consisting of eukaryotic cells, prokaryotic cells, and combinations thereof.
[0286] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the cell is a prokaryotic cell.
[0287] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the cell is a eukaryotic cell.
[0288] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is represented by a sequence as set forth in SEQ ID NO: 1, and the functional molecule is NHS-coumarin dye.
[0289] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is represented by a sequence as set forth in SEQ ID NO: 2, and the functional molecule is NHS-coumarin dye.
[0290] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the helical protein is represented by a sequence as set forth in SEQ ID NO: 2, and the functional molecule is ruthenium metal complex.
[0291] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the process is used for cell-labelling.
[0292] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule into a cell as described herein, wherein the process is used for delivering the functional molecules into the cell.
[0293] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule to an organelle of a cell, said process comprising: (a) linking the functional molecule to a recombinant helical protein to obtain a conjugate; (b) further incorporating to the conjugate any one signal sequence selected from the group consisting of SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16; (c) contacting the conjugate of step (b) with at least one cell; wherein contacting the conjugate of step (b) transfers the functional molecule to the organelle inside the cell, wherein the organelle is selected from the group consisting of nucleus, endoplasmic reticulum, and mitochondria, and wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm. In an embodiment, the process further comprises after step (c), step (d) detecting the transfer of the conjugate inside the cell.
[0294] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule to an organelle of a cell as described herein, wherein the recombinant helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof.
[0295] In an embodiment of the present disclosure, there is provided a process for transferring the functional molecules to nucleus of the cell as described herein, wherein the signal sequence is as set forth in SEQ ID NO: 14.
[0296] In an embodiment of the present disclosure, there is provided a process for transferring the functional molecules to endoplasmic reticulum of the cell as described herein, wherein the signal sequence is as set forth in SEQ ID NO: 15.
[0297] In an embodiment of the present disclosure, there is provided a process for transferring the functional molecules to mitochondria of the cell as described herein, wherein the signal sequence is as set forth in SEQ ID NO: 16.
[0298] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule to an organelle of a cell as described herein, wherein the functional molecule is selected from the group consisting of dyes, drugs, metal, drug-metal complex, proteins, enzymes, antibodies, nucleic acids, polysaccharides, nuclear localizing signals, nanoparticles, and combinations thereof.
[0299] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule to P-cadherin-over expressing breast cancer cells, said process comprising: (a) linking the functional molecule to a recombinant helical protein to obtain a complex; (b) further incorporating a signal sequence as set forth in SEQ ID NO: 17 to the complex; (c) contacting the complex of step (b) with at least one P-cadherin-over expressing breast cancer cell; wherein contacting the complex of step (b) transfers the functional molecule into the P-cadherin-over expressing breast cancer cell, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm. In an embodiment, the process further comprises after step (c), step (d) detecting the transfer of the complex inside the cell.
[0300] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule to P-cadherin-over expressing breast cancer cells as described herein, wherein the recombinant helical protein having a sequence is selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12.
[0301] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule to P-cadherin-over expressing breast cancer cells as described herein, wherein the functional molecule is selected from the group consisting of dyes, drugs, metal, drug-metal complex, proteins, enzymes, antibodies, nucleic acids, polysaccharides, nuclear localizing signals, nanoparticles, and combinations thereof.
[0302] In an embodiment of the present disclosure, there is provided a process as described herein, wherein the process is used for targeted delivery of the functional molecule into the cell.
[0303] In an embodiment of the present disclosure, there is provided a process as described herein, wherein the process is used for labelling of the cell.
[0304] In an embodiment of the present disclosure, there is provided a process as described herein, wherein the process is used for targeted delivery of drugs in the cell.
[0305] In an embodiment of the present disclosure, there is provided a cell penetrating complex as described herein, wherein the recombinant helical protein is used for delivering the functional molecule into the cell, and wherein the functional molecule is selected from the group consisting of dyes, drugs, metal, drug-metal conjugate, proteins, enzymes, antibodies, nucleic acids, polysaccharides, nuclear localizing signals, nanoparticles, and combinations thereof.
[0306] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule to actin protein present in a cell, said process comprising: (a) linking the functional molecule to a recombinant helical protein to obtain a conjugate; (b) further incorporating a signal sequence as set forth in SEQ ID NO: 22 to the complex; (c) contacting the conjugate of step (b) with at least one cell; wherein contacting the conjugate of step (b) transfers the functional molecule into the cell, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm. In an embodiment, the process further comprises after step (c), step (d) detecting the transfer of the conjugate inside the cell.
[0307] In an embodiment of the present disclosure, there is provided a process for transferring a functional molecule to tubulin protein present in a cell, said process comprising: (a) linking the functional molecule to a recombinant helical protein to obtain a conjugate; (b) further incorporating a signal sequence as set forth in SEQ ID NO: 23 to the conjugate; (c) contacting the conjugate of step (b) with at least one cell; wherein contacting the conjugate of step (b) transfers the functional molecule into the P-cadherin-over expressing breast cancer cell, wherein the helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm. In an embodiment, the process further comprises after step (c), step (d) detecting the transfer of the conjugate inside the cell.
[0308] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the recombinant helical protein is used for cell penetration.
[0309] In an embodiment of the present disclosure, there is provided a cell penetrating conjugate as described herein, wherein the recombinant helical protein is used for cell labelling.
[0310] Cell penetrating molecule with nucleic acids
[0311] In an embodiment, the present invention provides a solution to the problem of delivery of nucleic acid fragments, as a functional molecule, that is faced by gene therapy or gene editing treatments. The present document discloses a conjugate comprising a recombinant helical protein linked to a nucleic acid molecule, for example a plasmid, such as an RNA- or DNA-plasmid, which can penetrate the cell membrane. In an embodiment, the recombinant helical protein linked may be linked to one or more nucleic acid molecules, suitably a single nucleic acid molecule or plasmid, by suitable interactive forces (such as electrostatic or hydrophobic forces) or via a linker element, molecule, portion or moiety.
[0312] The conjugate comprising recombinant helical protein, a linker and a plasmid is shown to successfully penetrate the cell membrane to establish the expression of a gene forming the part of the plasmid. The conjugate avoids the pathway of endocytosis and crosses the cell membrane by directly penetrating the membrane. The conjugate hence overcomes the problems faced by entry through endocytosis and at the same time effectively penetrating the cell membrane.
[0313] In an embodiment, the present invention discloses a conjugate capable of penetrating cell membrane. In some embodiments, the conjugate comprises a recombinant helical protein of length in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm linked to a nucleic acid molecule via a linker. In an embodiment, the recombinant helical protein can be a pentapeptide repeat protein have a consensus sequence (STAV).sub.1(DN).sub.2(LF).sub.3(STR).sub.4(G).sub.5. In another embodiment of the present disclosure, the recombinant helical protein is selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12.
[0314] According to the present disclosure, in an embodiment the recombinant helical protein is linked to a nucleic acid molecule by a linker element, molecule, portion or moiety. In embodiments, the linker element may be a direct link by covalent or non-covalent bonds. When the linker is a linker molecule it may be selected from the group consisting of protein, metal conjugate, drug-metal conjugate, DNA binding domain, and nucleic acid intercalating molecule. In an embodiment, the nucleic acid molecule comprising the part of the conjugate comprises at least one gene of interest. In an embodiment, the nucleic acid molecule is linked to a complex comprising the recombinant helical protein and the linker to form the conjugate as disclosed in the present invention. In an embodiment, the conjugate is able to enter the cell by penetrating the cell membrane and a gene forming a part of the nucleic acid molecule is able to express inside the cells.
[0315] The present invention also discloses a process for transferring a nucleic acid molecule inside the cells using the conjugate of the present invention. In an embodiment, the process disclosed can further be used for gene therapy techniques or gene-editing techniques for facilitating non-viral approaches for delivering the gene of interest in a cell, thereby effectively enabling editing of a defective gene, or compensating for a defective gene or protein, inside the cell.
[0316] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm.
[0317] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof.
[0318] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is a pentapeptide repeat protein.
[0319] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein comprises tandemly repeated pentapeptide with consensus sequence (STAV) I (DN) 2 (LF) 3 (STR)+ (G) 5.
[0320] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the linker is a linker molecule selected from the group consisting of protein, metal conjugate, drug-metal conjugate, DNA binding domain, nucleic acid intercalating molecule, and combinations thereof.
[0321] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof, and wherein the linker is a linker molecule selected from the group consisting of protein, metal conjugate, drug-metal conjugate, DNA binding domain, nucleic acid intercalating molecule, and combinations thereof.
[0322] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the linker is linked to the recombinant helical protein by covalent bonds, non-covalent bonds, and combinations thereof.
[0323] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the linker is a linker molecule selected from the group consisting of protein, metal conjugate, drug-metal conjugate, DNA binding domain, nucleic acid intercalating molecule and combinations thereof, and wherein the linker is linked to the recombinant helical protein by covalent bonds, non-covalent bonds, and combinations thereof.
[0324] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the nucleic acid molecule comprises at least one gene of interest.
[0325] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof, and wherein the nucleic acid molecule comprises at least one gene of interest.
[0326] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof, and wherein the linker is a linker molecule selected from the group consisting of protein, metal conjugate, drug-metal conjugate, DNA binding domain, nucleic acid intercalating molecule and combinations thereof, and wherein the nucleic acid molecule comprises at least one gene of interest.
[0327] In an embodiment, the present invention provides a solution to the problem of delivery of gene editing molecular machinery across cellular membranes and into a cell and/or compartments thereof by providing a means of transfecting a plasmid or nucleic acid encoding one or more molecules of a genome-editing system in to the cell. Once the plasmid or nucleic acid is in the cell, the one or more molecules of a genome-editing system in to the cell may be prepared using cellular processes and optionally combined with other required components of the genome-editing system, to provide a complete gene editing system within the cell.
[0328] In an embodiment of the present disclosure, the gene of interest in the nucleic acid, or plasmid, encodes one or more molecules of a genome-editing system. Suitably, the one or more molecules of the genome-editing system are selected from, but not limited to, the group consisting of: an RNA-guided endonuclease and/or a guide RNA (gRNA), for example Cas9; a zinc finger nuclease (ZFN); a transcriptor activator-like effector nuclease (TALEN); a DNA-guided endonuclease and/or a guide DNA; a homing endonuclease; an integrase; and any combination thereof.
[0329] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is AlbG having a sequence as set forth in SEQ ID NO: 1.
[0330] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is EfsQNR having a sequence as set forth in SEQ ID NO: 2.
[0331] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is an anti-freeze protein having a sequence as set forth in SEQ ID NO: 3.
[0332] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is an anti-freeze protein having a sequence as set forth in SEQ ID NO: 4.
[0333] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is an anti-freeze protein having a sequence as set forth in SEQ ID NO: 5.
[0334] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is QNRB1 having a sequence as set forth in SEQ ID NO: 6.
[0335] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is UDP N acetylglucosamine acyltransferase having a sequence as set forth in SEQ ID NO: 7.
[0336] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is NP275 having a sequence as set forth in SEQ ID NO: 8.
[0337] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is pectate lyase C having a sequence as set forth in SEQ ID NO: 9.
[0338] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is a pectate lyase having a sequence as set forth in SEQ ID NO: 10.
[0339] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is carbonic anhydrase having a sequence as set forth in SEQ ID NO: 11.
[0340] In an embodiment of the present disclosure, there is provided a conjugate comprising: (a) at least one recombinant helical protein; (b) at least one linker; and (c) at least one nucleic acid molecule, wherein the at least one recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm, and wherein the helical protein is Pectin Lyase A having a sequence as set forth in SEQ ID NO: 12.
[0341] In an embodiment of the present disclosure, there is provided a process for transferring a nucleic acid molecule, or plasmid, into a cell, said process comprising: (i) linking the nucleic acid molecule to a complex comprising: (a) at least one recombinant helical protein; and (b) at least one linker to obtain a conjugate; and (ii) contacting the conjugate to at least one cell, wherein contacting the conjugate transfers the nucleic acid molecule into the cell, and wherein the recombinant helical protein length is in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm.
[0342] In an embodiment of the present disclosure, there is provided a process for transferring a nucleic acid molecule, or plasmid, into a cell as described herein, wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof.
[0343] In an embodiment of the present disclosure, there is provided a process for transferring a nucleic acid molecule into a cell as described herein, wherein the helical protein is a pentapeptide repeat protein.
[0344] In an embodiment of the present disclosure, there is provided a process for transferring a nucleic acid molecule into a cell as described herein, wherein the helical protein comprises tandemly repeated pentapeptide with consensus sequence (STAV): (DN) 2 (LF) 3 (STR)+ (G) 5.
[0345] In an embodiment of the present disclosure, there is provided a process for transferring a nucleic acid molecule into a cell as described herein, wherein the linker is a linker molecule selected from the group consisting of protein, metal conjugate, drug-metal conjugate, DNA binding domain, nucleic acid intercalating molecule, and combinations thereof.
[0346] In an embodiment of the present disclosure, there is provided a process for transferring a nucleic acid molecule into a cell as described herein, wherein the helical protein is represented by a sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, and combinations thereof, and wherein the linker is a linker molecule selected from the group consisting of protein, metal conjugate, drug-metal conjugate, DNA binding domain, nucleic acid intercalating molecule, and combinations thereof.
[0347] In an embodiment of the present disclosure, there is provided a process for transferring a nucleic acid molecule into a cell as described herein, wherein the linker is linked to the recombinant helical protein by covalent bonds, non-covalent bonds, and combinations thereof.
[0348] In an embodiment of the present disclosure, there is provided a process for transferring a nucleic acid molecule into a cell as described herein, wherein the linker is a linker molecule selected from the group consisting of protein, metal conjugate, drug-metal conjugate, DNA binding domain, nucleic acid intercalating molecule and combinations thereof, and wherein the linker is linked to the recombinant helical protein by covalent bonds, non-covalent bonds, and combinations thereof.
[0349] In an embodiment of the present disclosure, there is provided a process for transferring a nucleic acid molecule into a cell as described herein, wherein the cell is either a prokaryotic cell or a eukaryotic cell.
[0350] In an embodiment of the present disclosure, there is provided a process for transferring a nucleic acid molecule into a cell as described herein, wherein the gene of interest in the nucleic acid, or plasmid, encodes one or more molecules of a genome-editing system. Suitably, the one or more molecules of the genome-editing system are selected from, but not limited to, the group consisting of: an RNA-guided endonuclease and/or a guide RNA (gRNA), for example Cas9; a zinc finger nuclease (ZFN); a transcriptor activator-like effector nuclease (TALEN); a DNA-guided endonuclease and/or a guide DNA; a homing endonuclease; an integrase; and any combination thereof.
Cell Penetrating Peptide for Efficient Transfer of Gene Editing Molecules Across Cell Membranes
[0351] The present invention provides a solution to the problem of delivery of gene editing molecular machinery across cellular membranes and into a cell and/or compartments thereof. The present document discloses a conjugate comprising a recombinant helical protein linked to at least one gene editing molecule or a gene editing complex which can efficiently penetrate the cell membrane. In an embodiment, the recombinant helical protein may be linked by non-covalent interactions to an endonuclease and one or more gRNA molecules. In one embodiment, the recombinant helical protein may be linked by non-covalent interactions to CRISPR gene editing molecules, for example Cas9 endonuclease or gRNAs and/or to a complex of Cas9 and one or more gRNA molecules.
[0352] The conjugate comprising recombinant helical protein and CRISPR gene editing molecules is shown to successfully penetrate the cell membrane to enable site-specific editing of the genome. Without wishing to be bound by theory, it is postulated that the conjugate avoids the pathway of endocytosis and crosses the cell membrane by directly penetrating the membrane. The conjugate hence overcomes the problems faced by entry through endocytosis and at the same time effectively penetrating the cell membrane.
[0353] In some embodiments, the conjugate comprises a recombinant helical protein of length in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm linked to a nucleic acid molecule via a linker. In an embodiment, the recombinant helical protein can be a pentapeptide repeat protein have a consensus sequence (STAV).sub.1(DN).sub.2(LF).sub.3(STR).sub.4(G).sub.5. In another embodiment of the present disclosure, the recombinant helical protein is selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12.
[0354] According to the present disclosure, in an embodiment the recombinant helical protein is linked to a nucleic acid molecule by a linker element, molecule, portion or moiety. In embodiments, the linker element may be a direct link by covalent or non-covalent bonds. When the linker is a linker molecule it may be selected from the group consisting of protein, metal conjugate, drug-metal conjugate, DNA binding domain, and nucleic acid intercalating molecule.
[0355] In an embodiment, the conjugate is able to enter the cell by penetrating the cell membrane and migrate to a relevant genome where site-specific editing can take place.
[0356] The present invention also discloses a process for transferring a CRISPR-RNP inside the cells using the conjugate of the present invention. In an embodiment, the process disclosed can further be used for gene editing techniques for facilitating non-viral approaches for allowing existing genes to be edited, removed and/or new ones added.
[0357] In an embodiment of the present disclosure, there is provided a process for transferring a CRISPR-RNP into a cell as described herein, wherein the cell is either a prokaryotic cell or a eukaryotic cell.
[0358] In an embodiment of the present disclosure, there is provided a conjugate as described herein, wherein the conjugate is used as a transfecting agent.
[0359] In an embodiment of the present disclosure, there is provided a conjugate as described herein, wherein the conjugate is used for gene therapy.
ExamplesCell Penetrating Molecule with Functional Molecules
[0360] The disclosure will now be illustrated with working examples, which is intended to illustrate the working of disclosure and not intended to take restrictively to imply any limitations on the scope of the present disclosure. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this disclosure belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice of the disclosed processes and compositions, the exemplary processes, devices and materials are described herein. It is to be understood that this disclosure is not limited to particular methods, and experimental conditions described, as such processes and conditions may vary.
[0361] In the following examples, methods and protocols for carrying out plasmid and protein studies have been provided. Also provided are the protocols for obtaining the conjugate, labelling of the protein, and methods of carrying out cell penetration studies using protein-drug conjugate and protein-label conjugate. The results section specifically describes the proof-of-concept of the cell penetration ability of the conjugate as disclosed in the present invention. The in-vitro labelling of different cell lines has been carried out using the conjugate of the present invention as per the method disclosed. The assay with a drug-protein conjugate have also been carried out to study the ability of the conjugate in enhancing the drug uptake by cell penetration.
Material and Methods
[0362] The dye Hoechst 33342 was procured from Invitrogen; NHS-coumarin, and ATTO 520-NHS, ATTO 390-NHS and ATTO 647N-NHS were procured from Sigma. The organic solvents and reagents used for UV-visual spectrophotometry and CD spectra were procured from Sigma and Merck. The reagents for studying the expression of plasmids and purification of proteins were procured from Sigma Aldrich and Merck. The reagents required for MTT assay were procured from MP Biomedicals. Ruthenium metal complex was procured from Sigma.
Example 1
[0363] Plasmid/Protein studiesThe plasmid containing AlbG gene as shown in SEQ ID NO: 19, was obtained by a method as published previously (Vetting et al. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2011: 67 (3): 296-302, the contents of which is incorporated herein by reference and specific details provided below).
[0364] The open reading frame of AlbG was amplified by standard PCR techniques using X albilineans (ATCC 29184; Pieretti et al., BMC Genomics, 2009, 10:616, 1-15) chromosomal DNA as AlbGF a template. The oligonucleotides (5-ATCCCGCTCATATGCCGGCCAAGACCCTTG-3) and AlbGR (5 ATCCCGCTCTCGAGTCAATCGGACAGCTCGATATC-3) containing NdeI and XhoI restriction sites, respectively, were used. The PCR fragment was cloned into pET-28a (+) and recombinant AlbG bearing a thrombin-cleavable N-terminal His6 tag was expressed in E. coli strain BL21 (DE3). For shake-flask growth, 1 liter of Luria broth medium supplemented with kanamycin (35 g/ml) was inoculated with 10 ml of an overnight culture and incubated at 37 C. The culture was grown to mid-log phase (A.sub.600 of 0.8), cooled to 20 C., induced with 0.5 mM IPTG and further incubated overnight at 20 C. All purification procedures were carried out at 4 C. The cells were collected by centrifugation at 3000g, re-suspended in buffer A [50 mM Tris-HCl pH 7.8 containing 300 mM NaCl, protease inhibitors, lysozyme (5 g/ml) and DNase I (0.1 g/ml)] and stirred for 20 min. The cells were then lysed by sonication and cell debris was removed by centrifugation at 10 000g for 30 min. The supernatant was loaded onto a nickel-nitrilotriacetic acid (Ni-NTA) column pre-equilibrated with buffer A and washed with ten column volumes of the same buffer. The bound proteins were eluted with a linear 0 to 0.3 M imidazole gradient and the peak fractions were pooled and concentrated.
[0365] The plasmid containing EfsQNR gene as shown in SEQ ID NO: 2 was obtained by a method as published previously (Hegde et al., Antimicrob. Agents Chemother. 2011 January; 55 (1): 110-117, the contents of which is incorporated herein by reference and details provided below).
[0366] The open reading frame of EfsQNR was amplified by standard PCR techniques using E. faecalis V583 (ATCC 700802; ENTFA 226185) chromosomal DNA as the template. The oligonucleotides (5-ATCCCGCTCATATGAAAATAACTTATCCCTTGCCA-3) and (5-ATCCCGCTCTCGAGTTAGGTAATCACCAAACCAAGT-3), containing NdeI and XhoI restriction sites, respectively, were used. The PCR fragment was cloned into pET-28a (+), and the recombinant EfsQNR bearing a thrombin-cleavable N-terminal His6 tag was expressed in E. coli strain BL21 (DE3). For shake flask growth, 1 liter of Luria broth medium supplemented with kanamycin (35 g/ml) was inoculated with 10 ml of an overnight culture and incubated at 37 C. The culture was grown to mid-log phase (A.sub.600 0.8), cooled to 20 C., induced with 0.5 mM isopropyl--d-thiogalactopyranoside (IPTG), and further incubated overnight at 20 C.
[0367] The cells were collected by centrifugation at 1,200g and re-suspended in buffer A (50 mM Tris-HCl [pH 7.8], 300 mM NaCl) containing protease inhibitors, lysozyme (5 g/ml), and DNase I (0.1 g/ml), and the mixture was stirred for 20 min. The cells then were lysed by sonication, and cell debris was removed by centrifugation at 10,000 g for 30 min. The supernatant was loaded onto a Ni-NTA column pre-equilibrated with buffer A and washed with 10 column volumes of the same buffer. The bound proteins were eluted with a linear 0 to 0.3 M imidazole gradient with fractions pooled and concentrated.
[0368] As a comparative example, a plasmid containing TtCuA gene as shown in SEQ ID NO: 13 was obtained by a method in Biochemistry, 2008, 47, 1309-1318, which is incorporated herein by reference.
Example 2
[0369] Toxicity assayThe industry-standard MTT assay (ex-Sigma Aldrich) was performed to analyse the toxicity of -helical protein-cytotoxic drug conjugates against mammalian cells, for example HeLa cells. The cells were cultured by using standard protocol. One million cells were seeded in confocal plates (1 cm dish), grown for 6-8h. A mixture of the cytotoxic drug and the EfsQNR protein (mixed at a ratio of 2:1) was added to the cells and incubated at room temperature for 15 minutes to 24 h to 72h. After the incubation, the cells were washed with PBS and treated with MTT and further incubated for 24 hours. The cells were then washed and analysed for absorbance values at 570 nm. Viable cells with active metabolism convert MTT into a purple coloured formazan product with an absorbance maximum near 570 nm. Dead cells cannot convert MTT into formazan therefore, by analysing the absorbance values at 570 nm percentage of viable cells can be calculated for a given protein or any other molecule.
Example 3
[0370] Labelling of proteins with fluorescent dyesFluorescent dyes were considered as an example of a functional molecule for investigating the cell membrane penetration ability of the conjugate. Labelling of the recombinant protein with a dye was carried out by performing a series of reaction in dark conditions. The protein to be labelled was collected in PBS buffer (1 and pH 7.3) and the dye was collected at two to three times higher concentration to that of the protein. The protein was added to 0.1M sodium carbonate buffer (pH 8.5) followed by the dye. The dye was added very slowly (3 l each time) to the buffer containing the protein kept on ice accompanied by occasional shaking. The resulting solution was wrapped with aluminium foil to keep away any light. The solution was stirred for 1 hour at room temperature and was then purified by gel filtration, i.e. passed through a desalting column or a PD 10 column with 1PBS buffer. The resulting labelled protein was characterized using UV-visual spectrophotometry to determine dye: protein ratio.
Example 4
[0371] Cellular uptake of labelled proteinsThe uptake of labelled proteins was checked by treating mammalian cells with different labelled proteins such as AlbG (SEQ ID NO: 1), EfsQNR (SEQ ID NO: 2) and, as a comparative example, TtCuA (SEQ ID NO: 13). TtCuA is a cytochrome oxidase c protein from the organism Thermus thermophilus. It is represented by the amino acid sequence as set forth in SEQ ID NO: 13. The cells were seeded at a concentration of one million in confocal plates (1 cm dish) and allowed to grow for 6-8 hours. Subsequently, the labelled proteins were added to the cells at different concentrations and incubated under standard conditions of 5% CO.sub.2 and 37 C. The cells were then washed twice, after 3 hours and 24 hours with HBSS (Hanks blank salt solution) or PBS and observed under fluorescence microscopy and/or confocal laser scanning microscope.
[0372] The uptake of labelled proteins was checked by treating E-Coli and yeast (Kluveromyces) cells with different labelled proteins such as AlbG (SEQ ID NO: 1), EfsQNR (SEQ ID NO: 2). E coli or Kluveromyces cells were inoculated and grown overnight until OD reached 0.6. The cells were diluted to 50 times and 3 micromolar labelled protein (conjugate) was added. The cells were further grown under standard growth condition (37 C. shaking condition) for 24 h. The treated cells were then centrifuged and washed in PBS for 3-4 times. Then the cells were dispersed in 100 microliter PBS and then imaged in fluorescence/confocal microscope.
[0373] In addition, different proteins such as AlbG (SEQ ID NO: 1), EfsQNR (SEQ ID NO: 2) labelled with a green fluorescent dye (A-520) were found to be taken up into several drug resistant strains of bacteria (Pseudovibrio sp. Ad37/5/13/14 and Enterobacter, wherein the strain Enterobacter sp. is resistant to antibiotics such as erythromycin, chloramphenicol, tetracycline, nalidixic acid, kanamycin and penicillin), yeast cells (Saccharomyces cerevisiae, Kluveromyces marxianus and Candida albicans), plant cells (Arabidopsis), zebrafish embryos and drosophila embryos as observed by confocal laser scanning microscopy.
[0374] Protocol for uptake in bacteria and yeast cells: [0375] Respective bacteria and yeast strains were inoculated the day before the experiment and allowed to grow overnight; [0376] The cells were centrifuged and 2 ml fresh media was added; [0377] 100-200 L of cells were added to the mixture; [0378] 10 M of green labelled CPP was added; [0379] Fresh media was added to bring the volume to 1 mL; [0380] After 24 hours the treated cells were centrifuged and washed in PBS 3-4 times; [0381] the cells were dispersed in 100 microliter PBS and then imaged in fluorescence/confocal microscope (
[0382] Protocol for uptake in plant cells (Arabidopsis): [0383] Plants were grown for 7 days prior to the experiment; [0384] 20 M of different cell-penetrating proteins such as AlbG (SEQ ID NO: 1), EfsQNR (SEQ ID NO: 2) labelled with a green fluorescent dye (A-520) were added to the plants in buffer [3 plants grown for 7 days] in 500 L PBS; [0385] The mixture was placed in a growth room for 24 hours under standard growth conditions (kept static in a room of continuous supply of light and 23 C. temperature); [0386] The plants were washed with PBS 3 times and fresh PBS was then added and cells visualized under microscope. Non-coloured cells such as the cells of the roots and stems were chosen for visualisation to avoid interference (
[0387] Protocols for uptake in zebrafish embryo and drosophila embryo: [0388] Embryos of zebrafish and drosophila were collected and washed in PBS [0389] 10 M of different cell-penetrating proteins such as AlbG (SEQ ID NO: 1), EfsQNR (SEQ ID NO: 2) labelled with a green fluorescent dye (A-520) were added into the vial containing the embryos and incubated for 2h; [0390] The embryos were collected washed with PBS three times and dispersed in PBS and put on glass cover slips and visualized under microscope (
[0391] These results give an indication that the CPP of the present invention can transfer cargoes into the cytoplasm of a wide variety of cell types by crossing the cell membrane and/or cell wall. This opens the prospect of conjugating the CPP with antibiotics such as Ciprofloxacin and Penicillin or any other antibiotic by using the activated acid coupling chemistry (EDC/NHS) to conjugate the carboxylate (COOH) groups of the drugs and amine groups of the CPP (from the lysine residues). These reactions are well known in the literature and text book (Reference: Bioconjugate Techniques page 264-265 by Greg T Hermansen). Use of linkers such as adipic acid dihydrazide, succinimidyl 6-hydrazinonicotinate acetone hydrazine, C6-succinimidyl 6-hydrazinonicotinate acetone hydrazine, succinimidyl hydraziniumnicotinate hydrochloride to conjugate CPP with antibiotics. These linkers are known to be hydrolysable under intracellular conditions to release the antibiotics inside the cells.
[0392] Antibiotic-CPP conjugate would improve the efficiency of cellular uptake when compared to the unconjugated antibiotic and reduce or eliminate drug expulsion through cellular mechanisms, such as glycoproteins. The binding site of glycoproteins is in the region of <1 kDa whereas CPP-drug conjugates are of the size 48 KDa. This could help in improving old antibiotics and contribute to addressing the issue of antimicrobial drug resistance. Similarly the technique can be used to improve the efficiency of antibiotics/pesticides/nutrients delivery in fishes and plants.
Example 5
[0393] Cellular uptake of drug-Hela cells were used for determining the enhanced uptake of the drug using the cell penetrating conjugate of the present invention. HeLa cells were seeded at a concentration of 10,000 in a 96-well plate and allowed to grow for 6-8 hours. Ruthenium metal complex and EfsQNR were mixed in different ratios of 1:1, 1:2, and 1:3 to form a conjugate, which was subsequently added to the cells. The conjugate formed of ruthenium to EfsQNR in a ratio of 1:2 yielded an enhanced result. The cell death after 24 hours was monitored by MTT assay as described previously and was correlated to the percentage uptake of ruthenium-EfsQNR conjugate by HeLa cells.
Results of Examples 1 to 5
Characterization of Proteins and Conjugates
[0394] Structural specificityThe size of the AlbG protein was determined from the published crystal structure pdb id:2xt2.pdb. By measuring the end to end atom distance of dimeric structure in Pymol, the length was determined to be 10.7 nm, and the width (diameter) to be 2.6 nm. The total formal charge was-27. There are alternatively arranged positive and negative charge residues: Presence of an arginine ladder (total of 20 Arg residues), Lysine (14 residues) and aspartic acid (30 Asp residues) and glutamic acid (31 Glu residues). Asparagine (20 Asn residues) ladder along the surface of the protein.
[0395] The size of the EfsQNR protein was determined from the published crystal structure pdb id: 2w7z.pdb. By measuring the end to end atom distance of the dimeric structure in Pymol, the length of the protein was determined to be 10.9 nm, and the width (diameter) to be 2.8 nm. Total formal charge-41. Alternatively arranged positive and negative charge residues: Presence of an arginine ladder (total of 16 Arg residues), Lysine (12 residues) and aspartic acid (25 Asp residues) and glutamic acid (33 Glu residues). Asparagine (33 Asn residues) ladder along the surface of the protein.
[0396] For comparison, the size of the TtCuA protein was determined from the published crystal structure pdb id: 2CuA.pdb. By measuring the end to end atom distance of structure in Pymol, the length was determined to be 3.3 nm, and the width (diameter) to be 1.9 nm. The structure comprises 5 Arginine residues, 4 Lysine residues, 9 Glutamic acid residues and 6 Asparagine residues with a total charge of 3.
[0397]
[0398]
[0399]
[0400]
Cytotoxicity Studies
[0401] MTT assay as described previously was employed to study toxicity of AlbG and EfsQNR proteins against HeLa cells. For the toxicity assay, samples of Placebo, control, AlbG (30 M) and EfsQNR (30 M) were used in triplicates. Table 1 depicts the absorbance values at 570 nm of each sample after treatment with MTT. On observing the values, it can be appreciated that the cells treated with 30 M of AlbG and 30 M of EfsQNR display 95% viability as compared to the control cells. This clearly suggests that the tested protein at the tested concentration is not toxic for HeLa cells and hence is a safe concentration to use in further experiments.
[0402] Table 1 presented here depicts the absorbance values at 570 nm in MTT assay for evaluating toxicity of the proteins:
TABLE-US-00002 TABLE 1 1 2 3 4 5 6 7 8 9 10 11 12 PLACEBO CONTROL EfsQNR AlbG 0.049 0.05 0.046 1.341 1.348 1.413 0.901 1.111 0.971 1.002 1.03 0.932
[0403] The placebo for this experiment was 20 mM Tris buffer of pH 8.0, whereas, the control considered was only HeLa cells without adding any protein or other substrate.
Labelling Studies
[0404]
Cellular Penetration Studies
[0405]
[0406] In
[0407] On comparing panels C and D, it can be observed that EfsQNR-NHSC conjugate is able to penetrate the membrane more efficiently as compared to the AlbG-NHSC conjugate. Therefore, the cell penetration ability of the three conjugates can be summarised in an increasing order of cell uptake as TtCuA-NHSC<AlbG-NHSC<EfsQNR-NHSC. This further proves the cell penetrating ability of the conjugate comprising a recombinant helical protein of length and breadth in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm respectively. The conjugates independently comprising AlbG and EfsQNR are able to show enhanced cell permeability as compared to the conjugate comprising TtCuA.
[0408] Since the conjugate comprising EfsQNR protein displayed the highest ability to penetrate cell membrane, EfsQNR protein was further studied with different dyes for enhanced labelling of mammalian cells.
[0409]
Labelling of Mammalian Cells
[0410]
[0411]
[0412]
[0413]
[0414]
[0415]
Labelling of Non-Mammalian Cells
[0416]
FACS Sorting of Hela Cells Treated with the Conjugate
[0417]
Drug Uptake Studies
[0418]
[0419]
[0420] It is noted that in all experiments where tested, similar results were obtained when the EfsQNR protein was replaced with the AlbG protein.
Advantages
[0421] Overall, it can be concluded that a conjugate comprising a recombinant helical protein of specific length and width, and a functional molecule can act as a highly efficient cell membrane penetrating conjugate. The ability of the conjugate to directly penetrate the cell membrane provides advantages as compared to the endocytotic entry mechanism. Working examples of the AlbG-NHSC and EfsQNR-NHSC conjugates are provided in the present disclosure which demonstrate their ability to penetrate the cell membrane. The EfsQNR-dye conjugate is shown to enhance the ability of labelling of a variety of mammalian and non-mammalian cells because of its ability to effectively penetrate the cell membrane. The conjugate comprising EfsQNR and/or AlbG has been shown to increase the cellular uptake of drugs including ruthenium metal complexes and Cisplatin in HeLa and HepG2 cells. This ability can be further exploited to elevate the uptake of different anti-cancer drugs by cancer cells which can facilitate the treatment by selectively targeting the cancerous cells in an efficient manner and simultaneously with a reduced requirement of the drug. Reduction in the dose of anti-cancer drug can also circumvent the side-effects associated with administration of such drugs.
ExamplesCell Penetrating Molecule with Nucleic Acid
[0422] In the following paragraphs, working examples have been provided for delivering a nucleic acid, such as a plasmid, having a gene of interest inside the cell by penetrating the cell membrane. The delivery is made possible because of the use of a conjugate (a cell penetrating peptide as described herein), further comprising a nucleic acid molecule or plasmid. The examples also depict the expression of the gene of interest after penetrating the cell membrane to enter inside the cell.
[0423] A first example describes transfection of a gene of interest into a cell using an embodiment of the conjugate of the present invention, wherein the gene of interest is mcherry coding for RFP (Red Fluorescent Protein). The plasmid containing mcherry gene is linked to a protein to form a conjugate, wherein the conjugate comprises EfsQNR protein and copper [II] phenanthroline. The conjugate is used to transfect Hela cells. The successful expression of mcherry gene in HeLa cells is shown as a proof-of-concept to establish the ability of the conjugate to penetrate the cell membrane and transfect the cells.
Material and Methods
[0424] Copper phenanthroline complex was commercially procured.
Example 6
[0425] Protein studies-Studies governing the expression of EfsQNR plasmid, conditions of incubation, and purification were followed as published previously (Hegde et al. Antimicrob. Agents and Chemother. 2011: 55 (1): 110-7 which is incorporated herein by reference) to obtain EfsQNR protein. The SDS-PAGE (polyacrylamide gel electrophoresis) was done using the Bio-Rad kit and the protein bands were visualised using 12% polyacrylamide gel.
Example 7
Preparation of a Plasmid ConjugateCopper [II] Phenanthroline Linkage
[0426] As is disclosed in the present invention, a conjugate is prepared for transfecting cells, the conjugate comprising EfsQNR (SEQ ID NO: 2), copper [II] phenanthroline, and a plasmid having a gene of interest.
[0427]
[0428] EfsQNR protein obtained by governing the expression of EfsQNR plasmid was complexed with copper [II] phenanthroline complex to obtain a complex comprising EfsQNR and copper [II] phenanthroline. The obtained complex was further reacted with plasmid having mcherry gene to obtain a conjugate in accordance with an embodiment of the present invention. The obtained conjugate was used to transfect HeLa cells.
[0429]
[0430] Scheme 2 suggests the use of a DNA binding protein as a linker which forms a complex with a protein. The obtained complex is further reacted with a plasmid having a gene of interest to obtain the conjugate to be used for transfection.
[0431] In the present example, copper [II] phenanthroline is used as a linker to form a complex and a recombinant helical protein-EfsQNR (SEQ ID NO: 2) is used along with a plasmid containing mcherry gene. The following protocol was used for preparing the complex and the conjugate:
[0432] The protein EfsQNR was mixed with copper [II] phenanthroline in a 1:2 molar ratio and incubated for 30 minutes as room temperature to obtain the complex. Plasmid containing mcherry gene was mixed with the complex obtained in previous step and incubated for 30 minutes at 4 C. to obtain the conjugate. The conjugate so obtained was used to transfect HeLa cells.
Example 8
Transfection of HeLa Cells Using the Conjugate of Example 7
[0433]
[0434] The conjugate comprising the mcherry plasmid as obtained in Example 7 (A) was added to HeLa cells (8 hours after seeding). The cells were allowed to grow by incubating at 37 C. and 5% CO.sub.2 conditions for 48 hours. After the incubation, the cells were observed under confocal microscopy.
[0435]
Example 9
Preparation of a Plasmid ConjugateEthylene Diamine Linkage
[0436] As is further disclosed in the present invention, a conjugate was prepared for transfecting cells with a plasmid typical for encoding for one or more gene editing molecules. The conjugate comprised EfsQNR (SEQ ID NO: 2), an ethylene diamine linker, and a plasmid. The conjugate was prepared in accordance with a known protocol (Ref: Bioconjugate Techniques; Greg T. Hermansen; Academic Press; 3.sup.rd edition; 2013; pp 264-265) which is incorporated herein by reference). The plasmid used was a red labelled circular plasmid DNA of 2.7 kb (Label IT Plasmid Delivery Control Cy3 (Product code MIR 7904), obtained from Mirus Bio).
Example 10
Transfection of MCF7 Cells Using the Conjugate of Example 9
[0437] The conjugate comprising the plasmid [Label IT Plasmid Delivery Control Cy3 (Product code MIR 7904) as obtained in Example 9 was added to MCF-7 cells (8 hours after seeding). The cells were allowed to grow by incubating at 37 C. and 5% CO.sub.2 conditions for 12-16 hours. After the incubation, the cells were observed under confocal microscopy.
[0438]
[0439] In the maximum projection images (i), it can be clearly seen that the plasmid is able to spread throughout the cell far better when conjugated to the EfsQNR protein. This shows the efficiency of conjugate to carry and localize target nucleic acids, such as plasmids, in the cells.
[0440] From the intensity plots (iii) it is clear that the plasmid was able to enter the cells by the aid of protein and the spread is homogenous and widespread.
[0441] Although the examples as presented herein show the use of protein EfsQNR (SEQ ID NO: 2) in the preparation of a conjugate for transfection, the proteins having amino acid sequence as depicted in SEQ ID NO: 1 and SEQ ID NO: 3 to SEQ ID NO: 12 can also be used effectively to form the conjugate. Also, recombinant helical proteins having a penta-peptide repeat sequence as depicted in SEQ ID NO: 18 and having a length in the range of 5 nm-25 nm, suitably, 10 nm-15 nm and width is in the range of 1 nm-5 nm, suitably 1 nm-3 nm can be used for preparing the conjugate as described in the present disclosure. Similarly, the present example depicts the use of copper [II] phenanthroline or ethylene diamine as a linker but other molecules like DNA binding protein, metal conjugate, drug metal conjugate, and other nucleic acid intercalating molecule can also be used in the formation of a conjugate to be used effectively as a transfecting agent. One class of a DNA binding protein namely, zinc finger protein having a molecular weight of less than 12 kDa can also be used to form the conjugate. One such zinc finger protein that can be used as a linker has been depicted in SEQ ID NO: 24. In the present disclosure, a plasmid (
Advantages
[0442] The present disclosure provides with a conjugate comprising a nucleic acid or plasmid comprising a gene of interest which possess the ability of penetrating cell membrane and expressing the gene of interest. Hence, the conjugate can be used for transfection and has immense potential to be used in gene therapy and gene editing. As is known that delivery of nucleic acids and plasmids comprising the gene to the cells is a major challenge in the field of gene therapy and gene editing, the disclosed conjugate opens new avenue in this field. The disclosed conjugate is simple to prepare and can be complexed with wide variety of nucleic acids and plasmids comprising genes to be used for gene therapy and gene editing.
Example 11
Transfection of Gene Editing Molecular Machinery with a CPP of the Present Invention
[0443] A transfection experiment was conducted in mammalian cells using the conjugate obtained in Example 1 (EfsQNR: SEQ ID No. 2) and a gene editing complex, CRISPR-RNP based on the endonuclease Cas9. The results provided in Table 2 are depicted in
TABLE-US-00003 TABLE 2 CRISPR-RNP-CPP in reaction Control CRISPR-RNP-CPP in PBS buffer 1 0.99 0.9 1 0.94 0.7
[0444] In an embodiment of the present invention, the following conditions were used for performing the transfection experiment.
[0445] Strategy: Gene editing in cells has been reported via a number of different methods. One particularly relevant example delivers the ribonucleoprotein (RNP) complex of the endonuclease, such as Cas9, and gRNA into cells. This methodology is particularly attractive as no intermediate intra-cellular synthesis of the gene editing machinery is required.
[0446] Currently several methods such as electroporation, microinjection, nanoparticles and cationic lipid mediated delivery are used to introduce the gene editing machinery into the cytoplasm of the cell, from where it can migrate to the genome.
[0447] In an embodiment, the present invention uses electrostatic interactions between Cas9, gRNA and CPP to carry the Cas9-gRNA RNP (CRISPR-RNP) into the cells. The use of a conjugate wherein the various components are linked by covalent and/or non-covalent interactions is also contemplated.
[0448] Cells (HEK 293) expressing eGFP are transfected with CRISPR-RNP that has gRNA specific to eGFP. Uptake of the CRISPR-RNP will be mediated by the CPP of the present invention, which can transport cargo efficiently into cells (Example 4). Following cellular uptake, either dissociated from, or uninhibited by the CPP, the Cas9 will be directed by the gRNA to its target DNA sequence eGFP. Knockout of this gene, and thus loss of fluorescence in cells is evidence of an efficient and effective delivery method for the gene editing complex.
[0449] To obtain a stable eGFP expressing cell line, a selection process using the G418 antibiotic is used. Cells expressing eGFP, and thus having taken up the eGFP plasmid, will also confer G418 antibiotic resistance. Cells which have not taken up the eGFP plasmid, do not have resistance to G418 and thus over a period of time will die when kept in selection media.
[0450] Experimental: Cells (HEK 293) expressing eGFP (enhanced Green Fluorescent Protein) are obtained by transfecting HEK293 cells with eGFP by using lipofectamine based commercial reagents. The cells are grown for 48 hours to obtain 70-80% cells transfected by the eGFP. The cells are sub-cultured and grown in selection media containing G418 antibiotic to make the HEK 293 cells stably expressing eGFP before using it for the gene editing experiments.
[0451] Approximately 5000 cells are seeded into 96 well plate and grown overnight on day 1.
[0452] On day 2 the Cas9-gRNA-CPP (CRISPRRNP-CPP) complex was formed in two steps:
[0453] Step 1: Cas9 was mixed with gRNA in i) phosphate buffer saline (PBS) or ii) in the reaction buffer that was supplied with the commercially available Cas9 (Genaxxon Biosciences: Cas9-NLS-tagRFP Streptococcus (S.) pyogenes Cas9 protein NLS followed by a C-terminal red-fluorescent protein (tagRFP) tag sequence; Product number: S5306.0010; HS-No.: 35040090). The reaction buffer acts to stabilize the Cas9 and RNP complex. The mixture was then incubated at room temperature for 25 minutes to form the CRISPR-RNP complex;
[0454] Step 2:1 microM CPP in PBS was added to the Cas9-gRNA mixture obtained in step 1 and incubated at room temperature for another 30 minutes to form the CRISPRRNP-CPP complex;
[0455] Step 3: The CRISPRRNP-CPP complex obtained in step 2 is added to the cells in media (Dulbecco's Modified Eagle Medium (DMEM), with or without serum; ex. Sigma) and the cells are cultured for 4 h. After 4h, media (DMEM with serum) was added to the cells and left growing under standard cell growth condition (37 C. temperature and 5% CO.sub.2) for 48 h. After 48 h the cells were washed with PBS and fresh medium (DMEM with serum) was added and fluorescence intensity due to eGFP was measured in a fluorescence plate reader.
Results in Mammalian Kidney HEK293 Cells
[0456] The CPP of the present invention assists in the delivery of CRISPR-RNP into the cell efficiently. Following cellular uptake, the Cas9 is directed by the gRNA to its target DNA sequence of eGFP. Knockout of this gene by Cas9 lead to loss of fluorescence in cells.
[0457] Use of a serum free media in step 3 and a reaction buffer in step 1 (as provided in the commercial source for dissolving Genaxxon Cas9 and gRNA; Product no. S5306.0010) resulted in a 30% reduction in fluorescence indicating efficient transfer of the CRISPR-RNP to the interior of the cell.
[0458] When PBS (phosphate buffer saline) is used to dissolve the CRISPR-RNP complex no significant change in fluorescence intensity was observed.
[0459] Without wishing to be bound by theory, it is postulated that PBS is not able to stabilize the complex formation between CRISPR-RNP and the CPP.
Example 12
Transfection of Fluorescently Labelled Endonuclease Cas9 with a Recombinant -Helical Protein of the Present Invention
[0460]
[0461] The conjugate obtained in Example 1 (EfsQNR: SEQ ID No. 2) was mixed with cas9 (ex. Eupheria Biotech) conjugated with either red fluorescent protein or green fluorescent dye ATTO 520 (Sigma product 77810) in 1:1 ratio and incubated at room temperature for 30 minutes.
[0462] The solution obtained was added to the cells and incubated with the cells for 12-16h.
[0463]
[0464] In both the maximum projection images (A), it can be clearly seen that cas9 is successfully transfected and able to spread throughout the cell irrespective of the labelling dye. This shows the efficiency of conjugate of the present invention to carry and localize target proteins in the cells.
[0465] From the intensity plots (B) it is clear that cas9, irrespective of the companion dye, was able to enter the cells through use of the conjugate. The spread is throughout the cell and homogenous.
[0466] The 3D depth images (C) shows that the Cas9 cargo is spread throughout the cell. The depth analysis and 3D representation has shown it is present in all the planes.
Example 13
Transfection of Fluorescently Labelled gRNA with a Recombinant -Helical Protein of the Present Invention
[0467] As is further disclosed in the present invention, a conjugate was prepared for transfecting cells with a gRNA typical for use in gene editing with the CRISPR-cas9 gene-editing system. The conjugate comprised EfsQNR (SEQ ID NO: 2), an ethylene diamine linker, and a gRNA (ex. Eupheria Biotech: esiCRISPR Kit-wt) tagged with green fluorescent dye MFP488. The conjugate was prepared in accordance with a known protocol (Ref: Bioconjugate Techniques; Greg T. Hermansen; Academic Press; 3.sup.rd edition; 2013; pp 264-265 which is incorporated herein by reference).
[0468]
[0469] The images clearly show that the intensity and homogeneity of gRNA inside the cells is significantly less for the control compared to the cells incubated with gRNA and the conjugate. This suggests that the conjugate is able to carry gRNA into the cells. The maximum projection images, intensity plots and 3D depth images for the control shows that most of the gRNA is localized in the cell membrane whereas with the conjugate, distribution is clearly observed mainly in the cytoplasm.
[0470] CRISPR components were obtained from two different commercial sources namely Eupheria Biotech and Genaxxon.
[0471] Genaxxon Biosciences: GFP-targeting guide RNA for CRISPR; Product number: P2008.0010, Purified gRNA targets sequences encoding enhanced GFP; HS-No.: 29349990).
[0472] Genaxxon Biosciences: Cas9-NLS-tagRFP Streptococcus (S.) pyogenes Cas9 protein NLS followed by a C-terminal red-fluorescent protein (tagRFP) tag sequence; Product number: S5306.0010; HS-No.: 35040090).
[0473] Eupheria Biotech: esiCRISPR Kit-wt, a kit comprising: [0474] 20 g Streptococcus pyogenes Cas9-NLS (650 ng/l) [0475] 15 g custom guide (g) RNA (400 ng/l) [0476] 35 l CRISPRfectionTM transfection reagent (a proprietary lipid-based transfection reagent suitable for the delivery of single guide (g) RNA-loaded Cas9 proteins into most adherent cells) [0477] 1 ml CRISPRfection buffer (diluent for CRISPRfection) [0478] 5 g of NoTarget gRNA (in man, mouse, rat) as a negative control. [0479] Reaction buffers to perform indel analysis of PCR products derived from DNA isolated from transfected cells. [0480] Positive-control reagents to confirm Cas9-NLS protein and gRNA performance: control target DNA, control gRNA, reaction buffers. [0481] Application manual with protocols for transfection, indel analysis, and Cas9 activity assay.
[www.eupheria.com/products/crisprcas9/esicrispr-kits/; accessed 25 Feb. 2019]
Strategies to Confirm that the Cells Still Retain the Plasmid but with Edited Non Fluorescent eGFP
[0482] A m-cherry construct that expresses both eGFP and RFPgreen & red fluorescence. Transfection of mammalian cells with this plasmid will allow us to determine whether cells are expressing eGFP and have successfully been delivered. Cells fluorescing red, but not green would indicate eGFP deletion conferred by gene editing following CRISPRRNP-CPP delivery.
Strategies to Improve the Cellular Uptake and Gene Editing (Deletion, Replacement or Mutagenesis)
[0483] Optimisation of conditions for successful delivery of the CPP-Cas9-gRNA complex may be achieved by a number of strategies:
[0484] Strategy 1: It is postulated that a specific tailored buffer may enhance interactions between CPP and CRISPR-RNP. The following variations are contemplated to increase the efficiency of intracellular delivery: [0485] i) Addition of crowding agents (PEG 4000, cholesterol) to promote the complex formation of CRISPRRNP-CPP; [0486] ii) Addition of specific small lipids (1,2-dioleoyl-3-trimethylammonium-propane, 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine) to promote the complex formation of CRISPR-RNP-CPP by facilitating hydrophobic interactions; [0487] iii) Small molecules like Phorbol 12-myristate 13-acetate (to enhance the micropinocytosis process in cell) [0488] iv) Alteration in pH and ionic strength (to promote the electrostatic interaction between CPP-Cas9-gRNA)
[0489] Strategy 2: CPP could be functionalized with 3-(N-succinimidyloxyglutaryl) aminopropyl, polyethyleneglycol-carbamyl distearoylphosphatidyl-ethanolamine and/or N-(aminopropyl polyethyleneglycol) carbamyl-distearoylphosphatidyl-ethanolamine. This functionalization may enhance the interaction of CPP with the lipid molecules of the cell membrane and facilitate the cell entry of the CRISPRRNP-CPP complex of an embodiment of the present invention.
[0490] Strategy 3: it is postulated that the same approach as used with the CRISPR endonuclease may be used with other gene editing endonuclease systems such as ZFNs and TALENs.
[0491] It should be understood that the different embodiments of the invention described herein can be combined where appropriate and that features of the embodiments of the invention can be used interchangeably with other embodiments where appropriate.
[0492] Although particular embodiments of the invention have been disclosed herein in detail, this has been done by way of example and for the purposes of illustration only. The aforementioned embodiments are not intended to be limiting with respect to the scope of the appended claims, which follow. It is contemplated by the inventors that various substitutions, alterations, and modifications may be made to the invention without departing from the scope of the invention as defined by the claims.
TABLE-US-00004 TABLE3 Listofsequences SEQID Sequences SEQIDNO:1-Protein MPAKTLESKDYCGESFVSEDRSGQSLESIRFEDCTFRQCN FTEAELNRCKFRECEFVDCNLSLISIPQTSFMEVRFVDCK MLGVNWTSAQWPSVKMEGALSFERCILNDSLFYGLYLAGV KMVECRIHDANFTEADCEDADFTQSDLKGSTFHNTKLTGA SFIDAVNYHIDIFHNDIKRARFSLPEAASLLNSLDIELSD SEQIDNO:2-Protein GSHMKITYPLPPNLPEQLPLLTNCQLEDEAILENHLYQQI DLPNQEVRNLVFRDAVFDHLSLANGQFASFDCSNVRFEAC DFSNVEWLSGSFHRVTFLRCNLTGTNFADSYLKDCLFEDC KADYASFRFANFNLVHFNQTRLVESEFFEVTWKKLLLEAC DLTESNWLNTSLKGLDFSQNTFERLTFSPNYLSGLKVTPE QAIYLASALGLVIT SEQIDNO:3-Protein QCTGGADCTSCTGACTGCGNCPNAVTCTNSQHCVKANTCT GSTDCNTAQTCTNSKDCFEANTCTDSTNCYKATACTNSSG CPGH SEQIDNO:4-Protein GYSCRAVGVDGRAVTDIQGTCHAKATGAGAMASGTSEPGS TSTATATGRGATARSTSTGRGTATTTATGTASATSNAIGQ GTATTTATGSAGGRATGSATTSSSASQPTQTQTITGPGFQ TAKSFARNTATTTVTASHHHHHH SEQIDNO:5-Protein DGSCTNTNSQLSANSKCEKSTLTNCYVDKSEVYGTTCTGS RFDGVTITTSTSTGSRISGPGCKISTCIITGGVPAPSAAC KISGCTFSAN SEQIDNO:6-Protein GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSG TEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFR NSSALGIEIRHCRAQGADFRGASFMNMITTRTWFCSAYIT NTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLS GGEFSTFDWRAANFTHCDLTNSELGDLDIRGVDLQGVKLD NYQASLLMERLGIAVIG SEQIDNO:7-Protein MIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGE GTVLKSHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGE PTRVEIGDRNRIRESVTIHRGTVQGGGLTKVGSDNLLMIN AHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVH QFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIE GLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELA ETYPEVKAFTDFFARSTRGLIR SEQIDNO:8-Protein MGSSHHHHHHSSGLVPRGSHMDVEKLRQLYAAGERDFSIV DLRGAVLENINLSGAILHGAMLDEANLQQANLSRADLSGA TLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLNQA NLKAANLEQAILSHANIREADLSEANLEAADLSGADLAIA DLHQANLHQAALERANLTGANLEDANLEGTILEGGNNNLA T SEQIDNO:9-Protein ATDTGGYAATAGGNVTGAVSKTATSMQDIVNIIDAARLDA NGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPR GVEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRI GYLPGGAKDGDMIRVDDSPNVWVDHNELFAANHECDGTPD NDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSD TGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGS GLNVRQNGQALIENNWFEKAINPVTSRYDGKNFGTWVLKG NNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTVAY NYSPVSAQCVKDKLPGYAGVGKNLATLTSTACK SEQIDNO:10-Protein VGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQ SENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENV VWEDVGEDALTVKSEGVVEVIGGSAKEAADKVFQLNAPCT FKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSC VAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY SEQIDNO:11-Protein QEITVDEFSNIRENPVTPWNPEPSAPVIDPTAYIDPQASV IGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVL HALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQ VHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVT IPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVY VNVHLAEGYKETS SEQIDNO:12-Protein VGVSGSAEGFAKGVTGGGSATPVYPDTIDELVSYLGDDEA RVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDD WCENYEPDAPSVSVEYYNAGTLGITVTSNKSLIGEGSSGA IKGKGLRIVSGAENIIIQNIAVTDINPKYVWGGDAITLDD CDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVS DYSATCDGYHYWAIYLDGDADLVTMKGNYIYHTSGRSPKV QDNTLLHAVNNYWYDISGHAFEIGEGGYVLAEGNVFQNVD TVLETYEGEAFTVPSSTAGEVCSTYLGRDCVINGFGSSGT FSEDSTSFLSDFEGKNIASASAYTSVASRVVANAGOGNL SEQIDNO:13-Protein AYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQ TGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVI HGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYC GLGHQNMFGTIVVKE SEQIDNO:14-Peptide PAAKRVKCD SEQIDNO:15-Peptide YPYDVPDYAKDEL SEQIDNO:16-Peptide MLSLRQSIRFFKPATRTLCSSRYLL SEQIDNO:17-Peptide LSTAADMQGVVTDGMASGLDKDYLKPDD SEQIDNO:18-consensus (STAV).sub.1(DN).sub.2(LF).sub.3(STR).sub.4(G).sub.5 sequence SEQIDNO:19-DNA ATGCCGGCGAAAACCCTGGAAAGCAAAGATTATTGCGGCG AAAGCTTTGTGAGCGAAGATCGCAGCGGCCAGAGCCTGGA AAGCATTCGCTTTGAAGATTGCACCTTTCGCCAGTGCAAC TTTACCGAAGCGGAACTGAACCGCTGCAAATTTCGCGAAT GCGAATTTGTGGATTGCAACCTGAGCCTGATTAGCATTCC GCAGACCAGCTTTATGGAAGTGCGCTTTGTGGATTGCAAA ATGCTGGGCGTGAACTGGACCAGCGCGCAGGCGGGCGCGC TGAGCTTTGAACGCTGCATTCTGAACGATAGCCTGTTTTA TGGCCTGTATCTGGCGGGCGTGAAAATGGTGGAATGCCGC ATTCATGATGCGAACTTTACCGAAGCGGATTGCGAAGATG CGGATTTTACCCAGAGCGATCTGAAAGGCAGCACCTTTCA TAACACCAAACTGACCGGCGCGAGCTTTATTGATGCGGTG AACTATCATATTGATATTTTTCATAACGATATTAAACGCG CGCGCTTTAGCCTGCCGGAAGCGGCGAGCCTGCTGAACAG CCTGGATATTGAACTGAGCGAT SEQIDNO:20-DNA GGCAGCCATATGAAAATTACCTATCCGCTGCCGCCGAACC TGCCGGAACAGCTGCCGCTGCTGACCAACTGCCAGCTGGA AGATGAAGCGATTCTGGAAAACCATCTGTATCAGCAGATT GATCTGCCGAACCAGGAAGTGCGCAACCTGGTGTTTCGCG ATGCGGTGTTTGATCATCTGAGCCTGGCGAACGGCCAGTT TGCGAGCTTTGATTGCAGCAACGTGCGCTTTGAAGCGTGC GATTTTAGCAACGTGGAATGGCTGAGCGGCAGCTTTCATC GCGTGACCTTTCTGCGCTGCAACCTGACCGGCACCAACTT TGCGGATAGCTATCTGAAAGATTGCCTGTTTGAAGATTGC AAAGCGGATTATGCGAGCTTTCGCTTTGCGAACTTTAACC TGGTGCATTTTAACCAGACCCGCCTGGTGGAAAGCGAATT TTTTGAAGTGACCTGGAAAAAACTGCTGCTGGAAGCGTGC GATCTGACCGAAAGCAACTGGCTGAACACCAGCCTGAAAG GCCTGGATTTTAGCCAGAACACCTTTGAACGCCTGACCTT TAGCCCGAACTATCTGAGCGGCCTGAAAGTGACCCCGGAA CAGGCGATTTATCTGGCGAGCGCGCTGGGCCTGGTGATTA CC SEQIDNO:21-DNA GCGTATACCCTGGCGACCCATACCGCGGGCGTGATTCCGG CGGGCAAACTGGAACGCGTGGATCCGACCACCGTGCGCCA GGAAGGCCCGTGGGCGGATCCGGCGCAGGCGGTGGTGCAG ACCGGCCCGAACCAGTATACCGTGTATGTGCTGGCGTTTG CGTTTGGCTATCAGCCGAACCCGATTGAAGTGCCGCAGGG CGCGGAAATTGTGTTTAAAATTACCAGCCCGGATGTGATT CATGGCTTTCATGTGGAAGGCACCAACATTAACGTGGAAG TGCTGCCGGGCGAAGTGAGCACCGTGCGCTATACCTTTAA ACGCCCGGGCGAATATCGCATTATTTGCAACCAGTATTGC GGCCTGGGCCATCAGAACATGTTTGGCACCATTGTGGTGA AAGAA SEQIDNO:22-peptide GDVQKKRWLFETKPLD SEQIDNO:23-peptide VQSKCGSKDNIKHVPGGG SEQIDNO:24-peptide MERPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRIC MRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKR HTKIHLRQKD SEQIDNO:25-peptide GTGAGCAAGGGCGAGGAGGATAACATGGCCATCATCAAGG AGTTCATGCGCTTCAAGGTGCACATGGAGGGCTCCGTGAA CGGCCACGAGTTCGAGATCGAGGGCGAGGGCGAGGGCCGC CCCTACGAGGGCACCCAGACCGCCAAGCTGAAGGTGACCA AGGGTGGCCCCCTGCCCTTCGCCTGGGACATCCTGTCCCC TCAGTTCATGTACGGCTCCAAGGCCTACGTGAAGCACCCC GCCGACATCCCCGACTACTTGAAGCTGTCCTTCCCCGAGG GCTTCAAGTGGGAGCGCGTGATGAACTTCGAGGACGGCGG CGTGGTGACCGTGACCCAGGACTCCTCCCTCCAGGACGGC GAGTTCATCTACAAGGTGAAGCTGCGCGGCACCAACTTCC CCTCCGACGGCCCCGTAATGCAGAAGAAGACCATGGGCTG GGAGGCCTCCTCCGAGCGGATGTACCCCGAGGACGGCGCC CTGAAGGGCGAGATCAAGCAGAGGCTGAAGCTGAAGGACG GCGGCCACTACGACGCTGAGGTCAAGACCACCTACAAGGC CAAGAAGCCCGTGCAGCTGCCCGGCGCCTACAACGTCAAC ATCAAGTTGGACATCACCTCCCACAACGAGGACTACACCA TCGTGGAACAGTACGAACGCGCCGAGGGCCGCCACTCCAC CGGCGGCATGGACGAGCTGTACAAGTAGTAATCTAGAGGG CCCTATTCTATAGTGTCACC SEQIDNO:26-DNA ATCCCGCTCATATGCCGGCCAAGACCCTTG SEQIDNO:27-DNA ATCCCGCTCTCGAGTCAATCGGACAGCTCGATATC SEQIDNO:28-DNA ATCCCGCTCATATGAAAATAACTTATCCCTTGCCA SEQIDNO:29-DNA ATCCCGCTCTCGAGTTAGGTAATCACCAAACCAAGT