Pretreatment drug for T cell infusion therapy for immune-checkpoint inhibitor-resistant tumor

12569562 ยท 2026-03-10

Assignee

Inventors

Cpc classification

International classification

Abstract

An antigen-loaded nanogel is formed by loading or encapsulating one or more long peptide antigens or one or more protein antigens in a hydrophobized polysaccharide. The long peptide antigen(s) or protein antigen(s) contains (or each contain) one or more CD8+ cytotoxic T cell recognition epitopes and/or one or more CD4+ helper T cell recognition epitopes, which is/are derived from the antigen. The antigen-loaded nanogel is administered at least one day prior to administration of antigen-specific T cells to improve the efficacy of a T cell infusion therapy against an immune checkpoint inhibitor-resistant tumor. The hydrophobized polysaccharide may be pullulan having cholesteryl groups bound thereto. An immune-enhancing agent also may be administered in or with the antigen-loaded nanogel.

Claims

1. A method for treating an immune checkpoint inhibitor-resistant tumor in a patient in need thereof, comprising: administering to the patient a therapeutically effective amount of an antigen-loaded nanogel comprising a long peptide antigen or a protein antigen composed of 23 to 120 amino acid residues loaded in a hydrophobized polysaccharide, the long peptide antigen or protein antigen containing a CD8+ cytotoxic T cell recognition epitope and/or a CD4+ helper T cell recognition epitope, which is/are derived from a tumor-specific antigen protein or a tumor stroma-specific antigen protein; and at least 1 day thereafter, administering to the patient a therapeutically effective amount of antigen-specific T cells that bind to an antigen of the immune checkpoint inhibitor-resistant tumor.

2. The method according to claim 1, further comprising administering an immune-enhancing agent with the antigen-loaded nanogel, wherein the immune-enhancing agent is at least one selected from the group consisting of TLR (Toll-like receptor) agonists, STING agonists or RLR (RIG-I-like receptors) agonists.

3. The method according to claim 2, wherein the immune-enhancing agent is contained in the antigen-loaded nanogel.

4. The method according to claim 1, wherein the antigen-specific T cell is a T cell that expresses a T cell receptor that recognizes the antigen or a chimeric antigen receptor that recognizes the antigen.

5. The method according to claim 1, wherein the long peptide antigen or protein antigen comprises a sequence selected from the group consisting of 2 to 10 tyrosines, 2 to 10 threonines, 2 to 10 histidines, 2 to 10 glutamines and 2 to 10 asparagines between the T cell recognition epitopes in the long chain peptide antigen.

6. The method according to claim 1, wherein the hydrophobized polysaccharide comprises pullulan and cholesteryl groups.

7. The method according to claim 1, wherein the CD8+ cytotoxic T cell recognition epitope and/or the CD4+ helper T cell recognition epitope is/are derived from a tumor-specific antigen protein.

8. The method according to claim 1, wherein the antigen-loaded nanogel is administered according to an administration route selected from the group consisting of subcutaneous, intradermal, intramuscular, intratumoral and intravenous.

9. The method according to claim 1, wherein the antigen-loaded nanogel has a particle size of 80 nm or less and the hydrophobized polysaccharide contains pullulan and cholesteryl groups.

10. The method according to claim 9, wherein the antigen-loaded nanogel is administered according to an administration route selected from the group consisting of subcutaneous, intradermal, intramuscular, intratumoral and intravenous.

11. The method according to claim 10, wherein the antigen-specific T cell is a T cell that expresses a T cell receptor that recognizes the antigen or a chimeric antigen receptor that recognizes the antigen.

12. The method according to claim 11, further comprising administering an immune-enhancing agent with the antigen-loaded nanogel, wherein the immune-enhancing agent is at least one selected from the group consisting of TLR (Toll-like receptor) agonists, STING agonists or RLR (RIG-I-like receptors) agonists.

13. The method according to claim 12, wherein the long peptide antigen or protein antigen comprises a sequence selected from the group consisting of 2 to 10 tyrosines, 2 to 10 threonines, 2 to 10 histidines, 2 to 10 glutamines and 2 to 10 asparagines between the T cell recognition epitopes in the long chain peptide antigen.

14. The method according to claim 13, wherein the immune-enhancing agent is at least one selected from the group consisting of TLR (Toll-like receptor) agonists, STING agonists or RLR (RIG-I-like receptors) agonists.

15. The method according to claim 14, wherein the CD8+ cytotoxic T cell recognition epitope and/or the CD4+ helper T cell recognition epitope is/are derived from a tumor-specific antigen protein.

16. The method according to claim 15, wherein the long peptide antigen or protein antigen is derived from human NY-ESO-1.

17. The method according to claim 1, wherein the therapeutically effective amount of the antigen-specific T cells that bind to an antigen of the immune checkpoint inhibitor-resistant tumor are administered between 1 day and 2 weeks after the administration of the antigen-loaded nanogel.

18. The method according to claim 14, wherein the immune-enhancing agent is TLR (Toll-like receptor) agonists selected from the group consisting of CpG oligoDNA or poly-IC RNA.

19. The method according to claim 2, wherein the immune-enhancing agent is TLR (Toll-like receptor) agonists selected from the group consisting of CpG oligoDNA or poly-IC RNA.

20. The method according to claim 10, wherein the long peptide antigen or a protein antigen is composed of 23 to 80 amino acid residues.

Description

BRIEF DESCRIPTION OF THE FIGURES

(1) FIGS. 1(A)-1(C) show data indicating the expression of PD-L1 and PD-1, and the numbers of tumor-infiltrating CD8+ T cells for various mouse tumors implanted subcutaneously and engrafted into BALB/c mice. FIG. 1(A) contains four photomicrographs showing the results of analyzing the expression of PD-L1 molecules in tumors locally after 7 days from being implanted, FIG. 1(B) is a graph showing the results of analyzing the PD-1 expression of CD3+ T cells localized in each tumor by flow cytometry, and FIG. 1(C) is a graph showing the results of the analysis of the number of CD8+ T cells that infiltrated into each tumor.

(2) FIG. 2 depicts four graphs showing the results of examining the susceptibility to immune checkpoint inhibitors of various mouse tumors implanted subcutaneously and engrafted into BALB/c mice.

(3) FIGS. 3(A)-3(C) depict three graphs showing the results of the therapeutic efficacy of antigen-specific T cell infusion on BALB/c mice that were subcutaneously transplanted with fibrosarcoma CMS5a tumors using a pretreatment drug that contains a long chain peptide antigen-loaded cholesteryl pullulan (CHP) nanogel and an immune-enhancing agent. FIG. 3(A) is a graph showing that antigen-specific T cell infusion after subcutaneous administration of the long chain peptide antigen-loaded CHP nanogel and CpG oligo DNA can heal CMS5a tumors, and that incomplete Freund's adjuvant (IFA), instead of the nanogel as the delivery system, can not heal CMS5a tumors, FIG. 3(B) is a graph showing that antigen-specific T cell infusion after intravenous administration of the long chain peptide antigen-loaded CHP nanogel and CpG oligo DNA can heal CMS5a tumors, and that intravenous administration of the antigen-loaded nanogel of the present invention has the same effect as subcutaneous administration, and FIG. 3(C) is a graph showing that antigen-specific T cell infusion after the administration of the long chain peptide antigen-loaded CHP nanogel and poly-IC RNA can heal CMS5a tumors, and that poly-IC RNA used as an immune-enhancing agent exhibits the same effect as CpG oligo DNA.

(4) FIGS. 4(A)-4(C) depict three graphs showing the results of the therapeutic efficacy of antigen-specific T cell infusion on BALB/c mice that were subcutaneously transplanted with CMS5a tumors using a pretreatment drug that contains a long chain peptide antigen loaded CHP nanogel and an immune-enhancing agent. FIG. 4(A) is a graph showing that antigen-specific T cell infusion after the administration of the long chain peptide antigen loaded CHP nanogel and CpG oligo DNA can heal CMS5a tumors, and that CpG oligo DNA without the long chain peptide antigen-loaded CHP nanogel cannot heal CMS5a tumors, FIG. 4(B) is a graph showing that antigen-specific T cell infusion after the administration of the long chain peptide antigen-loaded CHP nanogel and CpG oligo DNA can heal CMS5a tumors, and that the long chain peptide antigen-loaded CHP nanogel without CpG oligo DNA can not heal CMS5a tumors, and FIG. 4(C) is a graph showing that antigen-specific T cell infusion after the administration of the long chain peptide antigen-loaded CHP nanogel and CpG oligo DNA can heal CMS5a tumors, and that the long chain peptide antigen-loaded CHP nanogel and CpG oligo DNA without the antigen-specific T cell infusion can not heal CMS5a tumors.

(5) FIG. 5 depicts data showing the results of an uptake assay of CHP nanogels into tumor-associated immune cells when the CHP nanogel was administered intravenously to BALB/c mice in which CMS5a tumors were implanted subcutaneously.

(6) FIG. 6 depicts data showing the results of analysis of antigen presenting activity of tumor-associated macrophages when the long chain antigen-loaded CHP nanogels and CpG oligo DNA were administered to BALB/c mice in which CMS5a tumors were implanted subcutaneously.

DETAILED DESCRIPTION

Embodiments of the Pretreatment Drug

(7) Pretreatment drugs of the present teachings may comprise one or more immune-enhancing agents and a pharmaceutical composition, which contains a hydrophobized polysaccharide-based nanogel as a delivery system in which one or more synthetic long chain peptide antigens or recombinant protein antigens is (are) loaded, wherein the long chain peptide antigen(s) or the protein antigen(s) concurrently contains CD8+ cytotoxic T cell recognition epitope(s) and/or CD4+ helper T cell recognition epitope(s), which is (are) derived from a tumor-specific antigen protein or a tumor stroma-specific antigen.

(8) The synthetic long chain peptide antigen preferably contains 23 to 120 amino acid residues and at least two T cell recognition epitopes. The synthetic long chain peptide antigen preferably contains 23 to 80 amino acids and at least two T cell recognition epitopes. The synthetic long chain peptide antigen preferably contains 23 to 60 amino acids and at least two T cell recognition epitopes.

(9) The recombinant protein antigen preferably contains two or more T cell recognition epitopes and a tag sequence for purification if necessary, and is a full-length or partial-length antigen protein produced in E. coli., insect cells or mammalian cells.

(10) The CD8+ cytotoxic T cell recognition epitope(s) is (are) preferably (a) portion(s) of the amino acid sequence of a tumor-specific antigen protein or a tumor stroma-specific antigen protein. The CD4+ helper T cell recognition epitope(s) is (are) preferably (a) portion(s) of the amino acid sequence of a tumor-specific antigen protein or a tumor stroma-specific antigen protein.

(11) The tumor-specific antigen protein is preferably selected from the group consisting of the MAGE family, NY-ESO-1/LAGE, SAGE, XAGE, HER2, PRAME, Ras, 5T4, WT1, p53, MUC-1, hTERT, RHAMM, Survivin, EGFRvIII, HPV E6, MART-1, gp100, CEA, IDO, Brachyury, Mesothelin, PSA and PSMA. The tumor stroma-specific antigen protein is preferably selected from the group consisting of FAP, the VEGFR family and TEM1.

(12) The polysaccharide constituting the hydrophobized polysaccharide-based nanogel is preferably a pullulan or a mannan. The hydrophobic group(s) of the hydrophobized polysaccharide-based nanogel is (are) preferably cholesterol. The hydrophobized polysaccharide-based nanogel is preferably non-ionic. The particle size of the hydrophobized polysaccharide-based nanogel is preferably 80 nm or less.

(13) The immune-enhancing agent preferably includes a soluble TLR agonist, a soluble STING agonist or a soluble RLR agonist. As the soluble TLR agonist, CpG oligo DNA or poly-IC RNA are exemplified. As the soluble STING agonist, cyclic dinucleotides, such as CdGMP, and xanthenone-derivatives, such as DMXAA, are exemplified. As the soluble RLR agonist, 5-phosphorylated double-stranded RNA is exemplified.

(14) In the present invention, the synthetic long chain peptide antigen or the recombinant protein antigen is characterized in that it comprises at least two or more T cell recognition epitopes contained in a tumor-specific antigen protein and/or in a tumor stroma-specific antigen protein. T cell recognition epitopes are preferably those contained in a tumor-specific antigen protein or a tumor stroma-specific antigen protein. As such, they may be selected from MAGE family molecules such as MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A5, MAGE-A6, MAGE-A8, MAGE-A9, MAGE-A10, MAGE-A11, MAGE-A12, MAGE-B1 and MAGE-B2, or T cell recognition epitopes contained in a tumor-specific antigen protein such as NY-ESO-1/LAGE molecule, SAGE, XAGE, HER2, PRAME, Ras, 5T4, WT1, p53, MUC-1, hTERT, RHAMM, Survivin, EGFRvIII, HPV E6, MART-1, gp100, CEA, IDO, Brachyury, Mesothelin, PSA and PSMA, or T cell recognition epitopes contained in tumor stroma-specific antigen proteins such as FAP, VEGFR family and TEM1. In T cell recognition epitopes, there are CTL epitopes recognized by CD8+ cytotoxic T cells and Th epitopes recognized by CD4+ helper T cells. The synthetic long chain peptide antigen or the recombinant protein antigen in the present invention preferably concurrently contains more than one each of the CTL epitopes and the Th epitopes. A long chain peptide antigen containing (a) CTL epitope(s) and a long chain peptide antigen containing (a) Th epitope(s) can be used alone or in combination.

(15) The hydrophobized polysaccharide used in the present invention can be prepared by known methods. With regard to the polysaccharides in the hydrophobized polysaccharides, polymers in which sugar residues are glycosidically bound can be used without limitation. The sugar residues constituting the polysaccharide may be derived, for example, from monosaccharides, such as glucose, mannose, galactose, and fucose, or from disaccharides or oligosaccharides. The sugar residues may have 1,2-, 1,3-, 1,4- or 1,6-glycosidic bonds, and the bonds may be either -type bonds or -type bonds. The polysaccharide may be linear or branched. Glucose residues may be preferably used as the sugar residues; pullulan, dextran, amylose, amylopectin, or mannan of natural or synthetic origin may be used as the polysaccharide; preferably mannan or pullulan can be used. The average molecular weight of the polysaccharide can range from 50,000 to 150,000.

(16) As the hydrophobic group, for example, in a single-stranded and double-stranded chain, alkyl or sterol residues which are introduced at a rate of 1 to 5 per 100 monosaccharides (less than 5% by weight) are preferably used, at a rate of 1 to 3 per 100 monosaccharides (less than 3% by weight) are more preferably used. As the hydrophobic group, the alkyl groups or sterol residues are not limited; other residues can be used with good efficiency depending on the molecular weight or the isoelectric point of the encapsulated antigen. As the sterol residue, cholesterol, stigmasterol, beta-sitosterol, lanosterol and ergosterol residues are exemplified. Preferably, a cholesterol residue is used. As the alkyl group, ones having 20 or less carbon atoms are preferably used; ones having 10 to 18 carbon atoms are more preferably used. The alkyl group may be used in either a linear chain or a branched chain.

(17) As the hydrophobized polysaccharide, one in which 1-5 primary hydroxyl groups per 100 sugars are linked to a polysaccharide of the following formula (I): O(CH.sub.2).sub.mCONH(CH.sub.2).sub.nNHCOOR (I) (wherein R represents an alkyl group or a sterol residue; m represents 0 or 1; n represents any positive integer) is used preferably. As the alkyl group or the sterol residue, n is preferably 1 to 8.

(18) As the hydrophobized polysaccharide, one that is linked via a linker can be used.

(19) As the hydrophobized polysaccharide, a non-ionic one is preferably used. The zeta potential of the hydrophobized polysaccharide-based nanogel particles in which the synthetic long chain peptide antigen or the recombinant protein antigen is loaded is preferably from 2.0 mV to +2.0 mV under physiological conditions. The particle size of the hydrophobized polysaccharide-based nanogel in which the synthetic long chain peptide antigen or the recombinant protein antigen is loaded is preferably 80 nm or less.

(20) The pretreatment drug of the present invention that comprises an immune-enhancing agent and a pharmaceutical composition, which contains a hydrophobized polysaccharide-based nanogel as the delivery system in which a synthetic long chain peptide antigen or a recombinant protein antigen is loaded, may be administered in various ways. Suitable non-oral administered routes, such as intravenous, intraperitoneal, subcutaneous, intradermal, adipose tissue, mammary gland tissue, inhalation or intramuscular, or mucosal route in the form of nasal drops, are preferably used.

(21) The pretreatment drug of the present invention is typically prepared as a kit that contains the antigen-loaded nanogel mixed with an immune-enhancing agent or the antigen-loaded nanogel and an immune-enhancing agent separately. The agent may be prepared in a suitable dosage form for subcutaneous, intravenous, or intramuscular administration. The dose of the antigen-loaded nanogel necessary to induce the desired immunity can be appropriately determined. For example, the usual dose can be used in an amount of about 0.1 mg/administration to 10 mg/administration, as the synthetic long chain peptide antigen or the recombinant protein antigen. The number of times of administration is suitably 2 to 20 times. The administration interval between the pretreatment drug and the antigen-specific T cell infusion is selected between 1 day to 2 weeks.

(22) Also disclosed herein is a therapeutic agent, which contains a cell population comprising antigen-specific T cells as the active ingredient, that may be used in combination with any of the pretreatment drugs according to the present teachings. The cell population suitable for the treatment of a patient is administered, for example, by intravenous injection or infusion, intraarterially, subcutaneously, or intraperitoneally. The cell population can be prepared as a drip infusion or injection according to methods known in the pharmaceutical field by mixing excipients, stabilizers, etc. with a known organic or inorganic carrier that is suited for non-oral administration. The content, the dose and other conditions of the cell population may be appropriately determined according to known immunotherapy. The content of the cell population in the pharmaceutical, without limitation, is preferably 110.sup.3 to 110.sup.11 cells/mL, more preferably 110.sup.4 to 110.sup.10 cells/mL, more preferably 110.sup.5 to 210.sup.9 cells/mL. The dosage of the therapeutic agent containing the cell population as the active ingredient, without limitation, is preferably 110.sup.6 to 110.sup.12 cells/day per adult, more preferably 110.sup.7 to 510.sup.11 cells/day per adult, more preferably 110.sup.8 to 210.sup.11 cells/day per adult. A step of introducing a foreign gene into the cell population can be included the manufacturing method of the cell population. A foreign gene means a gene that is artificially introduced into the cell population containing the target T cells, and also encompasses genes from the same species of the target cells. The means for introducing a foreign gene is not limited, and can be appropriately selected and used according to known gene introduction methods. Gene transfer can be carried out with a viral vector or without a viral vector. Many papers have been previously reported concerning these methods.

(23) As the viral vector, without limitation, known viral vectors used for gene transfer, for example, such as retroviral vectors, lentiviral vectors, adenoviral vectors, adeno-associated virus vectors, simian viral vectors, vaccinia virus vectors, or Sendai viral vectors or the like, can be used. Retroviral vector or lentiviral vector, which can stably incorporate a foreign gene into a chromosomal DNA in targeted cells, preferably can be used. As the viral vector, those that lack replication ability preferably can be used so that they can not self-replicate in an infected cell. When a gene is transferred, a reagent for improving the gene transfer efficiency, such as RetroNectin (Takara Bio), can be used. As for gene introduction methods without using viral vectors, methods using carriers such as liposomes or ligand-polylysine, calcium phosphate method, electroporation methods, or particle gun methods and the like can be used. In this case, a foreign gene integrated in plasmid DNA, in a linear DNA or in an RNA is introduced.

(24) The foreign gene that is introduced is not particularly limited; any foreign genes can be used (for example, enzymes, cytokines, chemokines, or antigen receptors such as T-cell receptors (TCR) or chimeric antigen receptors (CAR), genes encoding proteins such as a receptor of a co-stimulant or ligand, antisense nucleic acids, siRNA, miRNA, ribozymes, and genes encoding aptamers). Foreign genes, for example, can be used by inserting into a vector or plasmid so as to be expressed under the control of a suitable promoter. Regulatory sequences such as enhancer sequences or terminator sequences can be incorporated within the vector.

(25) A target of a therapeutic agent using an antigen-loaded nanogel, an immune-enhancing agents, and an antigen-specific T cell infusion is a human who has a tumor that is resistant to immune checkpoint inhibitors. Tumors types, such as prostate cancer, colon cancer, melanoma, head and neck cancer, esophageal cancer, stomach cancer, colorectal cancer, liver cancer, gallbladder-bile duct cancer, pancreatic cancer, lung cancer, breast cancer, ovarian cancer, bladder cancer, kidney cancer, testicular cancer, bone and soft tissue sarcoma, malignant lymphoma, leukemia, cervical cancer, skin cancer, brain tumors and the like, are exemplified without limitation.

(26) Next, embodiments of the present invention will be explained in detail with reference to the figures. The technical scope of the invention is not limited by these examples and can be carried out in various forms without changing the gist of the invention.

Example 1

1. Materials and Methods

(27) Anti-mouse CD16/CD32 antibody (clone 93), PE-labeled anti-mouse PD-L1 antibody (clone 9G2), APC-Cy7-labeled anti-CD45 antibody (clone 30-F11), and PE-Cy7-labeled anti-PD-1 antibody (clone 29F.1A12) were purchased from Biolegend. V450-labeled anti-CD8 antibody (clone 53-6.7) was purchased from eBioscience. Fetal bovine serum (FBS) was purchased from Bio-West. RPMI1640 medium (containing 2-mercaptoethanol) was purchased from the Cell Science Institute. Erythrocyte hemolysis solution (0.15 M NH.sub.4Cl/10 mM KHCO.sub.3/0.1 mM EDTA.Math.Na.sub.2 pH 7.2) was prepared at Mie University. Mouse colon cancer CT26 cell line (CRL-2638) was purchased from ATCC and was used as subcultured at Mie University. Mouse fibrosarcoma CMS7 cell line and murine fibrosarcoma CMS5a cell line were obtained from Memorial Sloan-Kettering Cancer Institute and were used as subcultured at Mie University. Human NY-ESO-1 antigen gene was obtained from Memorial Sloan-Kettering Cancer Institute. CMS5a-NY cell line, which is a CMS5a cell line stably transfected with human NY-ESO-1 antigen gene, was produced at Mie University, and was used as subcultured. Female BALB/c mice from 6-weeks-old to 12-weeks-old were purchased from Japan SLC and housed at the Mie University School of Medicine Animal Center. Protocols for animal experiments were approved by the ethics committee of the Mie University School of Medicine.

(28) The mouse colon cancer CT26 cell line, BALB/c mice fibrosarcoma CMS7 cell line, mouse fibrosarcoma CMS5a cell line, and CMS5a-NY cell line were cultured in 10% FBS-containing RPMI1640 medium using T75 culture flasks (Corning). Each cell line was detached from the flasks using 0.5% trypsin-containing phosphate-buffered saline (PBS), and suspended in 10% FBS-containing RPMI1640 medium. The suspensions were centrifuged (400g, 5 min, 4 C.) to remove the supernatants. The cells were washed twice with RPMI1640 medium and suspended in RPMI1640 medium at a concentration of 110.sup.6/100 L. The suspensions were subcutaneously implanted into the backs of the BALB/c mice at a dose of 100 L/individual (3 mice per group).

(29) Each cell line was implanted subcutaneously, and tumors were recovered after 1 week. Tumors were stained immunohistochemically in the following manner. Tumors embedded in O.C.T. compound (Sakura Finetech) were frozen and sliced into 3 m thicknesses. The sliced tumor sections were air dried for 2 hours. Dried tumor sections were fixed with ice cold acetone for 15 minutes and used for immunostaining. After the tumor sections were washed 3 times with PBS, they were immersed in blocking solution (1% bovine serum albumin (BSA) and 5% Blocking One Histo (Nacalai Tesque) containing PBS) at 4 C. Anti-mouse CD16/CD32 antibody was diluted in blocking solution at a concentration of 1 g/mL. The tumor sections were treated with the antibody solution for 30 minutes at room temperature in a humidified box to block Fc receptors. Next, the tumor sections were stained with PE-labeled anti-mouse PD-L1 antibody diluted at a concentration of 1 g/mL in blocking solution for 1 hour at room temperature in a humidified box. After the tumor sections were washed three times with 0.02% Tween20-containing PBS, they were immersed in Prolong Gold antifade reagent with DAPI (Life Technologies). The tumor sections were observed with a fluorescent microscope BX53F (Olympus) or confocal laser scanning microscope LSM780 (Carl Zeiss). The microscopic images were processed using Photoshop Element (Adobe Systems).

(30) Each cell line was implanted subcutaneously; after 1 week, immune cells that infiltrated the tumors were separated in the following manner. Tumors were isolated from the mice, crushed using gentleMACS (Miltenyi), and suspended in RPMI1640 medium. At this time, separated cells from 3 mice in a group were pooled. Collagenase D (final concentration 2 mg/mL, Roche) was added to the suspended cells, reacted for 30 minutes at 37 C., and the cells were crushed again using gentleMACS. The cells were filtered with a filter (22-m pore size, BD Biosciences) and centrifuged (400g, 5 min, 4 C.); the supernatant was removed and 2 mL of erythrocyte hemolysis solution was added to the cells. After one minute, 18 mL of RPMI1640 medium was added, and the cells were centrifuged (400g, 5 min, 4 C.). After the supernatant was removed, the cells were suspended in RPMI1640 medium. After counting the number of cells, they were suspended in staining buffer (0.5% BSA-containing PBS) to yield a cell concentration of 310.sup.7 cells/mL. Per well, 50 L of the cell suspensions were transferred to a 96-well V-bottom microplate (Nunc). The microplate was centrifuged (2000 rpm, 1 min, 4 C.). After removing the supernatant, the cells were suspended in 50 L of staining buffer per well. APC-Cy7-labeled anti-mouse CD45 antibody, V450-labeled anti-mouse CD8 antibody, and PE-Cy7-labeled anti-mouse PD-1 antibody were added to the cells at the recommended usage concentrations of the manufacturer of each antibody. After mixing gently, they were allowed to stand in the dark for 15 minutes at 4 C. The cells were washed twice with 200 L of staining buffer, suspended in 200 L of staining buffer, and transferred to round-bottomed polystyrene tubes (BD Biosciences). The cells were analyzed using a flow cytometer FACS Canto II (BD Biosciences) and data analysis software FlowJo (Tree Star). The frequency of PD-1 expression was determined as expression frequencies (%) in the cell populations of CD45+ and CD8+. The frequency of CD8+ T cells was determined as the frequency (%) of CD8+ cells in the CD45+ cell population.

2. Results

(31) Immune checkpoint inhibitor-resistant human tumors exhibit the characteristics in that there is an expression-deficiency of immune checkpoint molecules and tumor-infiltration of CD8+ T cells is not observed (Non-patent Document 5). To search for a mouse tumor exhibiting the same characteristics, after various mouse cancer cell lines were implanted subcutaneously in BALB/c mice, tumors were harvested; expression of immune checkpoint molecules PD-L1 and PD-1 and the number of infiltrating CD+ T cells were measured. FIG. 1(A) shows the results of the expression of PD-L1 molecules in CT26 tumors, CMS7 tumors, CMS5a-NY tumors and CMS5a tumors analyzed by immunostaining. Many cells expressing PD-L1 were observed in CT26 tumors, CMS7 tumors and CMS5a-NY tumors, whereas the number of PD-L1-expressing cells in CMS5a tumors was extremely small. FIG. 1(B) shows the results of the expression frequency of PD-1 in CD3+ T cells in tumor sites of tumors according to flow cytometry. Compared to the other tumors, the percentage of PD-1 expressing CD3+ T cells in CMS5a tumors was the lowest. FIG. 1(C) shows the frequency of CD8+ T cells that infiltrated into the tumor site of each tumor. Compared to other tumors, in CMS5a tumors the frequency of tumor-site-infiltrating CD8+ T cells was remarkably low. From these results, mouse tumor fibrosarcoma formed by implantation of the CMS5a cell line subcutaneously in mice was found to exhibit the same characteristics as immune checkpoint inhibitor-resistant human tumors.

Example 2

1. Materials and Methods

(32) A hybridoma that expresses anti-mouse CTLA-4 antibody (clone 9D9) was obtained from Dr. James P. Allison at the MD Anderson Cancer Center, and antibody was prepared at Mie University. A hybridoma that expresses anti-mouse GITR antibody (clone DTA-1) was obtained from Dr. Shimon Sakaguchi at Osaka University, and antibody was prepared at Mie University. Anti-mouse-PD-1 antibody (clone RMP1-14) was obtained from Dr. Hideo Yagita at Juntendo University. Fetal bovine serum (FBS) was purchased from Bio-West. RPMI1640 medium (containing 2-mercaptoethanol) was purchased from the Cell Science Institute. Mouse colon cancer CT26 cell line (CRL-2638) was purchased from ATCC and was used as subcultured at Mie University. Mouse fibrosarcoma CMS7 cell line and murine fibrosarcoma CMS5a cell line were obtained from Memorial Sloan-Kettering Cancer Institute and were used as subcultured at Mie University. Human NY-ESO-1 antigen gene was obtained from Memorial Sloan-Kettering Cancer Institute. CMS5a-NY cell line, which is a CMS5a cell line stably transfected with human NY-ESO-1 antigen, was produced at Mie University, and was used as subcultured. Female BALB/c mice from 6-weeks-old to 12-weeks-old were purchased from Japan SLC and housed at the Mie University School of Medicine Animal Center. Protocols for animal experiments were approved by the ethics committee of the Mie University School of Medicine.

(33) The CT26 cell line, CMS7 cell line, CMS5a cell line, and CMS5a-NY cell line were cultured in 10% FBS-containing RPMI1640 medium using T75 culture flasks (Corning). Each cell line was detached from the flasks using 0.5% trypsin-containing phosphate buffer saline (PBS), and suspended in 10% FBS-containing RPMI1640 medium. The suspensions were centrifuged (400g, 5 min, 4 C.) to remove the supernatants. The cells were washed twice with RPMI1640 medium and suspended in RPMI1640 medium at a concentration of 110.sup.6/100 L. The suspensions were subcutaneously implanted in the backs of the BALB/c mice at a dose of 100 L/individual (4 mice per group). Anti-mouse PD-1 antibody diluted in PBS (150 g), anti-mouse CTLA-4 antibody diluted in PBS (100 g) and anti-mouse GITR antibody diluted in PBS (100 g) were intraperitoneally administered as immune checkpoint inhibitors simultaneously at 7, 9 and 11 days after the tumor implantation. The length and breadth of the tumors were measured after the tumor transplantation over time, and the tumor volumes were calculated according to the formula: (longer diametershorter diametershorter diameter0.5). Statistical analysis was performed by non-parametric test using Microsoft Excel (Microsoft).

2. Results

(34) From the results in Example 1, tumors formed by subcutaneously implanted murine fibrosarcoma CMS5a cell line in BALB/c mice were expected to be resistant to immune checkpoint inhibitors. Therefore, combination therapy was attempted using anti-PD-1 antibody, anti-CTLA-4 antibody and anti-GITR antibody as immune checkpoint inhibitors to BALB/c mice with tumors formed by subcutaneously implanted mouse cancer cell lines. The results were shown in FIG. 2. The inhibition effects on tumor growth by the combination therapy using the immune checkpoint inhibitors were observed clearly in CT26 tumors, CMS7 tumors and CMS5a-NY tumors. In contrast, the combination therapy using the immune checkpoint inhibitors did not have any effect on CMS5a tumors; they showed similar growth as the untreated group. Therefore, the CMS5a tumors were proved to exhibit strong resistance to immune checkpoint inhibitors. Together with the results of Example 1, CMS5a tumors were considered to be a good model of immune checkpoint inhibitor-resistant human tumors. It became clear that effective treatments for immune checkpoint inhibitor-resistant human tumors were to be examined by using CMS5a tumors as the evaluation system.

Example 3

1. Materials and Methods

(35) Cholesteryl pullulan (abbreviation CHP, trade name CHP-80T) was obtained from NOF Corporation. Incomplete Freund's adjuvant (abbreviation IFA, product number F5506) was purchased from Sigma-Aldrich. Long chain peptide antigen-loaded CHP nanogel was prepared as follows. Long peptides antigens (MEN peptide: SNPARYEFLYYYYYYQYIHSANVLYYYYYYRGPESRLL (SEQ ID NO: 1) and p121 peptide: NDHIAYFLYQILRGLQYIHSANVLHRDLKPSNLLLNT (SEQ ID NO: 2)) were chemically synthesized by Bio-Synthesis and were dissolved in dimethyl sulfoxide (abbreviation DMSO, Nacalai Tesque) at a concentration of 10 mg/mL. CHP was dissolved in phosphate-buffered saline (PBS) containing 6 M urea (Nacalai Tesque) at a concentration of 10 mg/mL. One mL (10 mg) of the long chain peptide antigen solution and 20 mL (200 mg) of the CHP solution were mixed and left overnight with gentle stirring at 4 C. in the dark. The mixture was transferred to a dialysis membrane (molecular weight: 3,500, Thermo Scientific), and dialyzed against PBS containing 0.6 M urea as the external dialysis solution in a volume ratio of 100 times or more for 2 hours to overnight at 4 C. Furthermore, dialysis was performed using PBS containing 0.06 M urea as the external dialysis solution in a volume ratio of 100 times for 2 hours to overnight at 4 C. Again, dialysis was performed using PBS as the external dialysis solution in a volume ratio of 100 times or more for 2 hours to overnight at 4 C. The dialysis internal solution was recovered and filtered using a sterilized filter with a 0.22 m pore size (PVDF membrane, Millipore). After filtration, the UV absorbance at 280 nm was measured using Nanodrop 2000 (Thermo Scientific). The final concentration of the long chain peptide antigen was determined with a molecular extinction coefficient (1 mg/mL=4.181).

(36) The long chain peptide antigen:IFA mixture was prepared as follows. The long chain peptide antigen was dissolved at a concentration of 60 g/125 L in PBS containing 25% DMSO and collected into a syringe. Separately, 125 L of IFA was drawn into another syringe. After both syringes were connected by a three-way stopcock, suctioning and discharging by the syringes were repeated. After mixing well, the solution was used for administration. Fetal bovine serum (FBS) was purchased from Bio-West. RPMI1640 medium (containing 2-mercaptoethanol) was purchased from the Cell Science Institute. Mouse fibrosarcoma CMS5a cell line was obtained from Memorial Sloan-Kettering Cancer Institute, and was used as subcultured at Mie University. Mouse fibrosarcoma CMS5a cell line expresses mutated ERK2 protein. A peptide containing the mutation site of the mutated ERK2 protein (QYIHSANVL: SEQ ID NO: 3, the underline indicates the mutation) is recognized by CD8+ cytotoxic T cells of BALB/c mice. A T cell receptor (TCR) that recognizes the mutant peptide was isolated, and TCR gene-introduced mice (DUC18 mice) have been produced. The long chain peptide antigens used in the example (MEN peptide and p121 peptide) contain a CD8+ cytotoxic T-cell recognition epitope sequence of the mutated ERK2 (QYIHSANVL: SEQ ID NO. 3).

(37) Female BALB/c mice from 6-weeks-old to 12-weeks-old were purchased from Japan SLC. DUC18 mice were obtained from the University of Washington, and were used as bred at Mie University. The mice were bred at the Mie University School of Medicine Animal Center. Protocols for animal experiments were approved by the ethics committee of the Mie University School of Medicine.

(38) Mouse fibrosarcoma CMS5a cell line was cultured in 10% FBS-containing RPMI1640 medium using a T75 culture flask (Corning). The cell line was detached from the flask using 0.5% trypsin-containing PBS and suspended in 10% FBS-containing RPMI1640 medium. The suspension was centrifuged (400g, 5 min, 4 C.) to remove the supernatant. The cells were washed twice with RPMI1640 medium and suspended in RPMI1640 medium at a concentration of 110.sup.6/100 L. The suspension was subcutaneously implanted in both sides of the backs of BALB/c mouse at a dose of 100 L/individual (4 mice per group). In case the antigen loaded nanogel and an immune enhancer were to be administered as the pretreatment drug, at 7 days and 11 days after tumor implantation, the long chain peptide antigen-loaded CHP nanogel or the long chain peptide antigen:IFA mixture was administered subcutaneously into the backs or tail veins of the mice together with 50 g of CpG oligo DNA1668 (Gene Design) or 50 g of Poly-ICLC RNA (Oncovir) in PBS as the immune-enhancing agent. In the experiment shown in FIG. 4(A), the p121 peptide was used as the long chain peptide antigen. In the other experiments, the MEN peptide was used. CD8+ T cells in the spleen of mutated ERK2-specific TCR transgenic mice (DUC18 mice) were isolated using a CD8a+ T Cell Isolation Kit (Miltenyi). Isolated CD8+ T cells were suspended in RPMI1640 medium at a concentration of 210.sup.6 cells/200 L. After 8 days and 12 days from tumor implantation, isolated CD8+ T cells were infused from within the tail vein as antigen-specific T cells for the treatment. Statistical analysis was performed by non-parametric test using Microsoft Excel (Microsoft).

2. Results

(39) An effective treatment for immune checkpoint inhibitor-resistant human tumors was investigated using CMS5a tumors, which formed by being implanted subcutaneously in BALB/c mice, as the evaluation system. As a result, as shown in FIG. 3(A), the proliferation of CMS5a tumors was significantly inhibited by antigen-specific T cell infusion after subcutaneous administration of the long chain peptide antigen-loaded CHP nanogel and the immune-enhancing agent (CpG oligo DNA) as the pretreatment drug. A therapeutic effect was not observed in the case of using IFA as the delivery system. As shown in FIG. 3(B), intravenous administration of the pretreatment drug, instead of subcutaneous administration, also was found to be effective. As shown in FIG. 3(C), poly-IC RNA as the immune-enhancing agent in the pretreatment drug, instead of CpG oligo DNA, also was found to be effective.

(40) As shown in FIG. 4(A), a pretreatment drug that omitted the long chain peptide antigen loaded CHP nanogel was found to be not effective. As shown in FIG. 4(B), a pretreatment drug that omitted the immune-enhancing agent (CpG oligo DNA) was found to be not effective. These results showed that the pretreatment drug of the antigen-specific T cell infusion must contain a long chain peptide antigen-loaded CHP nanogel and an immune-enhancing agent. As shown in FIG. 4(C), when the antigen-specific T cell infusion was omitted, administration of only the pretreatment drug was found to be not effective.

(41) Thus, the pretreatment drug of the invention, when combined with the antigen-specific T cell infusion, was found to treat immune checkpoint inhibitor-resistant tumors.

Example 4

1. Materials and Methods

(42) Rhodamine-labeled CHP nanogel was obtained from Dr. Kazunari Akiyoshi at Kyoto University. APC-Cy7-labeled anti-mouse CD45 antibody (clone 30-F11), FITC-labeled anti-mouse CD8 antibody (clone 53-6.7), PE-labeled anti-mouse CD11b antibody (clone M1/70), Pacific blue-labeled anti-mouse F4/80 antibody (clone BM8) and PE-Cy7-labeled anti-mouse CD11c antibody (clone N418) were purchased from BioLegend. PerCP-Cy5.5-labeled anti-mouse CD4 antibody (clone RM4-5) was purchased from BD Biosciences. APC-labeled anti-mouse B220 antibody (clone RA3-6B2) was purchased from eBioscience. Fetal bovine serum (FBS) was purchased from Bio-West. RPMI1640 medium (containing 2-mercaptoethanol) was purchased from the Cell Science Institute. Erythrocyte hemolysis solution (0.15 M NH.sub.4Cl/10 mM KHCO.sub.3/0.1 mM EDTA.Math.Na.sub.2 pH 7.2) was prepared at Mie University. Mouse fibrosarcoma CMS5a cell line was obtained from Memorial Sloan-Kettering Cancer Institute and was used as subcultured at Mie University. Female BALB/c mice from 6-weeks-old to 12-weeks-old were purchased from Japan SLC and housed at the Mie University School of Medicine Animal Center. Protocols for animal experiments were approved by the ethics committee of the Mie University School of Medicine.

(43) The mouse fibrosarcoma CMS5a cell line was cultured in 10% FBS-containing RPMI1640 medium using a T75 culture flask (Corning). The cell line was detached from the flask using 0.5% trypsin-containing phosphate buffer saline (PBS), and suspended in 10% FBS-containing RPMI1640 medium. The suspension was centrifuged (400g, 5 min, 4 C.) to remove the supernatant. The cells were washed twice with RPMI1640 medium. The cells were suspended in RPMI1640 medium at a concentration of 110.sup.6/100 L; the cells were implanted subcutaneously into the backs of BALB/c mice at a dose of 100 L/individual (4 per group). After 7 days from tumor implantation, 1 mg of Rhodamine-labeled CHP nanogel (10 mg/mL PBS) was subcutaneously administered to the backs or to the tail vein. On the next day after the Rhodamine-labeled CHP nanogel administration, tumor-infiltrating immune cells were separated by the following method. Tumors were isolated from the mice, crushed using gentleMACS (Miltenyi) and suspended in RPMI1640 medium. Separated cells from 4 mice in a group were pooled. Collagenase D (final concentration 2 mg/ml, Roche) was added to suspended cells, reacted for 30 min at 37 C., and the cells were crushed again using gentleMACS. The cells were filtered with a filter (22-m pore size, BD Biosciences) and centrifuged (400g, 5 min, 4 C.); the supernatant was removed and 2 mL of erythrocyte hemolysis solution was added to the cells. After one minute, 18 mL of RPMI1640 medium was added, and the cells were centrifuged (400g, 5 min, 4 C.). After the supernatant was removed, the cells were suspended in RPMI1640 medium. After counting the number of cells, they were suspended in staining buffer (0.5% bovine serum albumin-containing PBS) to yield a cell concentration of 310.sup.7 cells/mL. Fifty micro liters of the cell suspension per well were transferred into a 96-well V-bottom microplate (Nunc). The microplate was centrifuged (2000 rpm, 1 min, 4 C.); after removing the supernatant, the cells were suspended in 50 L of staining buffer per well. After 18 hours from the Rhodamine-labeled CHP nanogel administration, regional lymph nodes were collected. In the case of subcutaneous administration, lymph nodes of the administration site (the inguinal lymph nodes) were collected; in the case of intravenous administration, tumor draining lymph nodes (inguinal lymph nodes) were collected.

(44) After grinding the lymph nodes using a glass slide, released cells were suspended in RPMI1640 medium. At this time, cells from 4 mice in a group were pooled. The suspension was centrifuged (400g, 5 min, 4 C.) to remove the supernatant, and the cells were treated for 1 min by adding 2 mL of erythrocyte hemolysis solution. 18 mL of RPMI1640 medium was added, and the cells were centrifuged (400g, 5 min, 4 C.).

(45) After removing the supernatant, the cells were suspended in RPMI1640 medium. The cell suspension was centrifuged (400g, 5 min, 4 C.) and the supernatant was removed. The cells were washed twice with 2% FBS-containing PBS, and suspended. APC-Cy7-labeled anti-mouse CD45 antibody, FITC-labeled anti-mouse CD8 antibody, PerCP-Cy5.5-labeled anti-mouse CD4 antibody, APC-labeled anti-mouse B220 antibody, PE-labeled anti-mouse CD11b antibody, Pacific blue-labeled anti-mouse F4/80 antibody, and PE-Cy7-labeled anti-mouse CD11c antibody were added at the recommended usage concentrations of the manufacturer of each antibody to cell suspensions prepared from the tumors or lymph nodes. After mixing, they were allowed to stand in the dark for 15 minutes at 4 C. The cells were washed twice with 200 L of staining buffer, re-suspended in 200 L of staining buffer, and transferred to round-bottomed polystyrene tubes (BD Biosciences). The cells were analyzed using a flow cytometer FACS Canto II (BD Biosciences) and data analysis software FlowJo (Tree Star).

(46) T cells were detected as CD45+ and CD4+, or CD45+ and CD8+; B cells were detected as CD45+ and B220+, macrophages were detected as CD45+ and CD11b+ and CD11c+ and F4/80+. The Rhodamine+ cells in each of the immune cells were detected as CHP nanogel uptake cells.

2. Results

(47) As shown in FIG. 3(B), the pretreatment drug of the invention showed similar therapeutic effects against the immune checkpoint inhibitor-resistant CMS5a tumors in both subcutaneous and intravenous administration. To elucidate the mechanism of action of the pretreatment drug, after subcutaneous or intravenous administration of the Rhodamine-labeled CHP nanogel into BALB/c mice, into which the CMS5a tumors had been implanted subcutaneously, the uptake of CHP nanogel into immune cells was measured in lymph nodes and tumor sites. As shown in FIG. 5, subcutaneously administered CHP nanogel was taken up well into macrophages of administered regional lymph nodes. On the other hand, intravenously administered CHP nanogel was taken up well into tumor-associated macrophages. Uptake into other immune cells was not observed. It was thought that the activity of antigen-specific T cells is enhanced by lymph nodes or tumor-associated macrophages taking up the long chain peptide antigens delivered by CHP nanogel and presenting to infused antigen-specific T cells. When the CHP nanogel is administered intravenously, it may be selectively delivered to tumor-associated macrophages.

Example 5

1. Materials and Methods

(48) Fetal bovine serum (FBS) was purchased from Bio-West. RPMI1640 medium (containing 2-mercaptoethanol) was purchased from the Cell Science Institute. Erythrocyte hemolysis solution (0.15 M NH.sub.4Cl/10 mM KHCO.sub.3/0.1 mM EDTA.Math.Na.sub.2 pH 7.2) was prepared at Mie University. Mouse fibrosarcoma CMS5a cell line was obtained from Memorial Sloan-Kettering Cancer Institute, and was used as subcultured at Mie University. Female BALB/c mice from 6-weeks-old to 12-weeks-old were purchased from Japan SLC. Mutated ERK2-specific TCR transgenic mice (DUC18 mice) were obtained from the University of Washington, and were used as bred at Mie University. The mice were bred at the Mie University School of Medicine Animal Center. Protocols for animal experiments were approved by the ethics committee of the Mie University School of Medicine.

(49) The mouse fibrosarcoma CMS5a cell line was cultured in 10% FBS-containing RPMI1640 medium using a T75 culture flask (Corning). The cell line was detached from the flask using 0.5% trypsin-containing PBS, and suspended in 10% FBS-containing RPMI1640 medium. The suspension was centrifuged (400g, 5 min, 4 C.) to remove the supernatant. The cells were washed twice with RPMI1640 medium and suspended in RPMI1640 medium at a concentration of 110.sup.6/100 L. The suspension was subcutaneously implanted in both sides of the backs of BALB/c mouse at a dose of 100 L/individual (5 mice per group). At 7 days after tumor implantation, a long chain peptide antigen-loaded CHP nanogel (60 g as MEN peptide, dissolved in PBS), which was prepared in the same manner as in Example 3, and CpG oligo DNA1668 (50 g, dissolved into PBS, Gene Design) were admixed and administered into the tail vein. 18 hours later, antigen presenting cells from tumor, lung, liver, spleen and lymph nodes of treated mice were separated by the method shown below.

(50) The isolation kit made by Miltenyi (Tumor Dissociation Kit (Part No. 130-096-730)) for tumors, the isolation kit made by Miltenyi (Lung Dissociation Kit (Part No. 130-095-927)) for lung, and the isolation kit made by Miltenyi (Liver Dissociation kit (Part No. 130-105-807))) for liver, were respectively used. After treatment according to the manufacturer's recommended protocol, isolated cells were suspended in RPMI1640 medium.

(51) At this time, cells from 5 mice in a group were pooled. The suspensions were centrifuged (400g, 5 min, 4 C.) to remove supernatant, and the cells were treated for 1 min by adding 2 mL of erythrocyte hemolysis solution. 18 mL of RPMI1640 medium was added, and the cells were centrifuged (400g, 5 min, 4 C.). After removing the supernatant, the cells were suspended in RPMI1640 medium. After the spleen and inguinal lymph nodes were triturated with a glass slide, released cells were collected in RPMI1640 medium. At this time, cells from 5 mice in a group were pooled. The suspensions were centrifuged (400g, 5 min, 4 C.) to remove the supernatant, and the cells were treated for 1 minute by adding 2 mL of erythrocyte hemolysis solution. 18 mL of RPMI1640 medium was added, and the cells were centrifuged (400g, 5 min, 4 C.). After removing the supernatant, the cells were suspended in RPMI1640 medium (it was called the primary cell suspension). The primary cell suspension prepared from each tissue was centrifuged (400g, 5 min, 4 C.) and the supernatant was removed. After the cells were washed twice with 2% FBS-containing PBS, they were suspended in 2% FBS-containing PBS. The suspension was called the secondary cell suspension. CD11b+ cells were isolated from the secondary cell suspension using CD11b microbeads (Miltenyi). These cells were used as antigen presenting cells from each tissue. On the other hand, CD8+ T cells were isolated from the spleen of DUC18 mice in the same manner as in Example 3. Then, responder T cells were prepared by labeling with the fluorescent dye CFSE (Thermo Fisher Science). 2.510.sup.5 cells of antigen presenting cells and 210.sup.5 cells of responder T cells per well were added to a 96-well V-bottom microplate (Nunc), and co-cultured for 72 hours in 10% FBS-containing RPMI1640 medium. When the responder T cells proliferate in response to antigen presentation, the fluorescence of CFSE is attenuated with the cell division. The change of the fluorescence was measured using a flow cytometer FACS Canto II (BD Biosciences) and data analysis software FlowJo (Tree Star). The percentage of responder T cells that divided more than once was calculated, and the antigen presenting ability of antigen-presenting cells from each tissue was evaluated.

2. Results

(52) In Example 4, it was revealed that intravenously administered CHP nanogel was taken up selectively by tumor-associated macrophages. It was considered that the long chain peptide antigen-loaded CHP nanogels administered intravenously were taken up into tumor-associated macrophages, and the antigen was presented to the infused antigen-specific T cells to enhance the activity of the antigen-specific T cells. The following experiments were performed to confirm the antigen-presenting activity of tumor-associated macrophages. CD11b+ macrophages in tumors or various tissues were isolated from BALB/c mice in which CMS5a tumors had been implanted subcutaneously; CHP nanogel, which was loaded with a long chain peptide antigen containing the CD8+ T cell recognition epitope of mutated ERK2, and CpG oligoDNA were intravenously administered. The CD11b+macrophages as antigen-presenting cells were co-cultured in vitro with the CD8+ T cells from mutated ERK2-specific TCR transgenic mice. If the CD11b+ macrophages present the CD8+ T cell recognition epitope of the mutated ERK2 derived from the administered long chain peptide antigen, the CD8+ T cells from mutated ERK2-specific TCR transgenic mice are activated and proliferate. The fluorescence was measured by CFSE dilution test using flow cytometry to estimate the T cell proliferation and was used as an indicator of antigen presentation.

(53) As shown in FIG. 6, when a long chain peptide antigen-loaded CHP nanogel and CpG oligoDNA were administered intravenously, the long chain peptide antigen was presented by tumor-associated macrophages. Macrophages from lymph nodes were observed to present the long chain peptide antigen weakly. Macrophages from other tissues were not observed to present the long peptides antigen. It was thought that these macrophages did not take up the long chain peptide antigen-loaded CHP nanogel and CpG oligoDNA, or may lack the ability to present the antigen. These results showed that, when the CHP nanogel is administered intravenously, the CHP nanogel has the ability to selectively transport molecules, in particular antigen, to tumor-associated macrophages and to cause the antigen to be presented.

(54) The mechanism has been thought to be the same in non-human mammals, including monkey, mouse, rat, pig, cattle, and dog. The composition of the invention is believed to have the same effect on humans, monkeys, mice, rats, pigs, cattle, dogs, etc.

(55) According to these embodiments, it was possible to provide a therapeutic technique for treating immune checkpoint inhibitor-resistant tumors that do not express molecular targets of immune checkpoint inhibitors. The enhancement of the anti-cancer activity of antigen-specific T cell infusion was derived by a synthetic long chain peptide antigen or recombinant protein antigen loaded-nanogel using a hydrophobized polysaccharide-based nanogel as the delivery system and an immunological enhancer, serving as a pretreatment drug.