BCMA-targeting engineered immune cell and use thereof
12570743 ยท 2026-03-10
Assignee
Inventors
- Hua ZHANG (Shanghai, CN)
- Lianjun SHEN (Shanghai, CN)
- Huan SHI (Shanghai, CN)
- Wei Cao (Shanghai, CN)
- Chunhui Yang (Shanghai, CN)
- Liping LIU (Shanghai, CN)
Cpc classification
A61K40/4215
HUMAN NECESSITIES
A61K40/11
HUMAN NECESSITIES
A61K2239/38
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
C07K16/2878
CHEMISTRY; METALLURGY
International classification
A61K35/17
HUMAN NECESSITIES
A61K40/11
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
Abstract
Provided are a BCMA-targeting engineered immune cell and the use thereof. In particular, a CAR specifically targeting BCMA is provided. In the CAR, an antigen binding domain contained therein is a J-derived scFv, having an antibody heavy-chain variable region shown in SEQ ID NO: 9, and an antibody light-chain variable region shown in SEQ ID NO: 10. Also provided are a CAR-T cell containing the CAR, and a duplex CAR and CAR T cells containing the J-derived scFv, and related uses thereof. Compared with CAR-T cells constructed by using other scFvs, the CAR-T cells constructed by the present invention have higher killing effects and tumor clearance ability.
Claims
1. A bispecific chimeric antigen receptor (CAR), comprising: a first CAR targeting CD19; and a second CAR targeting B-Cell maturation antigen (BCMA); wherein the first CAR and the second CAR are linked by a 2A peptide, wherein the structure of the first CAR is shown in Formula V:
L-scFv1-H-TM-C-CD3(V) wherein the structure of the second CAR is shown in Formula (I):
L-scFv-H-TM-C-CD3(I) wherein, each - is independently a linker peptide or a peptide bond; L is none or a signal peptide sequence; H is none or a hinge region; TM is a transmembrane domain; C is a co-stimulatory signal molecule; CD3 is a cytoplasmic signal transduction sequence derived from CD3; scFv1 is an antigen binding domain targeting CD19BCMA, comprising an antibody heavy chain variable region shown in SEQ ID NO: 11 and an antibody light chain variable region shown in SEQ ID NO: 12; the structure of the antigen binding domain targeting CD19 is shown in Formula (C):
V.sub.L1-V.sub.H1(C) wherein V.sub.H1 is the antibody heavy chain variable region V.sub.L1 is the antibody light chain variable; and - is a linker peptide or a peptide bond; scFv is an antigen binding domain targeting BCMA, comprising an antibody heavy chain variable region shown in SEQ ID NO: 9 and an antibody light chain variable region shown in SEQ ID NO: 10; the structure of the antigen binding domain targeting BCMA is shown in Formula (A):
V.sub.H-V.sub.L(A) wherein V.sub.H is the antibody heavy chain variable region; V.sub.L is the antibody light chain variable; and - is a linker peptide or a peptide bond.
2. A method for enhancing viability of immune cells in vivo or killing ability of immune cells to tumor cells with clonal proliferation ability, comprising expressing the bispecific CAR of claim 1 in the immune cells.
3. The bispecific CAR of claim 1, wherein the L is a signal peptide of a protein selected from the group consisting of: a CD8, CD28, GM-CSF, CD4, CD137, or a combination thereof.
4. The bispecific CAR of claim 3, wherein the L comprises a CD8 signal peptide.
5. The bispecific CAR of claim 1, wherein the H comprises a hinge region from CD8, CD28, CD137, or a combination thereof.
6. The bispecific CAR of claim 5, wherein at least one H comprises a hinge region from CD8.
7. The bispecific CAR of claim 1, wherein the TM comprises a transmembrane region of CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, 4-1BB (CD137), CD154, or a combination thereof.
8. The bispecific CAR of claim 7, wherein each TM independently comprises a CD8 or CD28 transmembrane region.
9. The bispecific CAR of claim 1, wherein the C comprises a co-stimulatory signal molecule of OX40, CD2, CD7, CD27, CD28, CD30, CD40, CD70, CD134, 4-1BB (CD137), PD1, Dap10, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278), NKG2D, GITR, TLR2, or a combination thereof.
10. The bispecific CAR of claim 9, wherein each C independently comprises a CD28 and/or 4-1BB co-stimulatory signal molecule.
11. The bispecific CAR of claim 1, wherein the CD32 comprises the amino acid of SEQ ID NO: 3.
12. A nucleic acid molecule encoding the bispecific CAR of claim 1.
13. A vector comprising the nucleic acid molecule of claim 12.
14. An engineered immune cell comprising an exogenous nucleic acid molecule of claim 12.
15. An engineered immune cell comprising the vector of claim 13.
16. A method for enhancing viability of immune cells in vivo or killing ability of immune cells to tumor cells with clonal proliferation ability, comprising expressing the bispecific CAR of claim 6 in the immune cells.
Description
DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
DETAILED DESCRIPTION
(14) After extensive and in-depth research, the inventor constructed a new engineered immune cell targeting BCMA for the first time, and the antigen binding domain in CAR contained in it is J-derived scFv. Experiments show that compared with CAR-T cells constructed by using BB scFv and BCMA binding domain derived from April, CAR-T cells constructed in the present invention have higher killing effect and tumor elimination ability. The present invention also constructs the dual CAR-T cells using J scFv and CD19 scFv, which are CAR-T cells can kill BCMA and CD19 positive cells at the same time.
(15) In particular, the present invention utilizes scFv of different BCMA antibodies to construct CAR-T cells and compares them, and unexpectedly finds that CAR-T cells constructed by scFv derived from J have higher ability to kill BCMA over-expressed cells and BCMA positive tumor target cells than that constructed by scFv of BB and BCMA binding domain derived from April. In the in vivo mouse models, it also shows higher tumor elimination ability than BB-derived CAR-T. CAR-T cells constructed with other scFv targeting BCMA that are common in the art do not show ideal in vitro and in vivo functions.
The Terms
(16) In order to make it easier to understand the present disclosure, certain terms are first defined. As used herein, each of the following terms shall have the meanings given below unless expressly provided herein. Other definitions are stated throughout the application.
(17) The term about may refer to a value or composition within an acceptable error range of a particular value or composition determined by those of ordinary skill in the art, which will depend in part on how the value or composition is measured or determined.
(18) The term administration refers to the physical introduction of the product of the present invention into a subject using any of various methods and delivery systems known to those skilled in the art, including intravenous, intramuscular, subcutaneous, intraperitoneal, spinal or other parenteral routes of administration, such as by injection or infusion.
(19) The term antibody (Ab) shall include, but is not limited to an immunoglobulin, that specifically binds to an antigen and comprises at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds, or an antigen-binding portion thereof. Each H chain contains a heavy chain variable region (abbreviated herein as V.sub.H) and a heavy chain constant region. The heavy chain constant region contains three constant domains, CH1, CH2 and CH3. Each light chain contains a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region contains a constant domain CL. The VH and VL regions can be further subdivided into hypervariable regions called complementary determination regions (CDR), which are interspersed within more conservative regions called frame regions (FR). Each VH and VL contains three CDRs and four FRs, which are arranged from amino terminal to carboxyl terminal in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of heavy and light chains contain binding domains that interact with an antigen.
(20) It should be understood that the amino acid names herein are identified by international single English letters, and the corresponding three English letter abbreviations of amino acid names are: Ala (A), Arg (R), Asn (N), Asp (D), Cys (C), Gln (Q), Glu (E), Gly (G), His (H), Ile (I), Leu (L), Lys (K), Met (M), Phe (F), Pro (P), Ser (S), Thr (T), Trp (W), Tyr (Y), Val (V).
(21) B Cell Maturation Antigen (BCMA)
(22) BCMA is a transmembrane protein expressed on the surface of mature B lymphocytes, i.e., plasmablasts and plasma cells. And multiple myeloma is caused by abnormal proliferation of plasma cells and invasion of bone marrow. Studies have shown that BCMA is expressed on multiple myeloma cells. Car-T cells targeting BCMA have been proved to be able to kill myeloma cells specifically. However, some patients still have recurrence after receiving CAR-T cell therapy targeting BCMA. For these patients with recurrence, it is necessary to find another target that is different from BCMA in order to continue treatment.
(23) CD19
(24) CD19 molecule is a transmembrane protein on the surface of B cells, which is closely related to B cell activation, signal transduction and growth regulation. As shown in
(25) Chimeric Antigen Receptor (CAR)
(26) The chimeric antigen receptor (CAR) of the present invention includes an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain includes a target-specific binding element (also known as an antigen binding domain). The intracellular domain includes a costimulatory signal transduction region and a chain. The costimulatory signal transduction region refers to a part of the intracellular domain including costimulatory molecules. The costimulatory molecules are cell surface molecules needed by lymphocytes to respond effectively to antigens, rather than antigen receptors or their ligands.
(27) Linkers may be incorporated between the extracellular domain and the transmembrane domain of the CAR, or between the cytoplasmic domain and the transmembrane domain of the CAR. As used herein, the term linker generally refers to any oligopeptide or polypeptide that functions to link the transmembrane domain to the extracellular domain or cytoplasmic domain of a polypeptide chain. The linker may comprise 0 to 300 amino acids, preferably 2 to 100 amino acids and most preferably 3 to 50 amino acids.
(28) In a preferred embodiment of the present invention, the extracellular domain of the CAR provided by the present invention comprises an antigen binding domain targeting BCMA (or BCMA and CD19). When the CAR of the present invention is expressed in T cells, it can perform antigen recognition based on the antigen binding specificity. When it binds to its associated antigen, it affects tumor cells, causing tumor cells not to grow, being prompted to die or being affected in other ways, and causing the patient's tumor burden to be reduced or eliminated. The antigen binding domain is preferably fused with an intracellular domain derived from one or more of the costimulatory molecule and chain. Preferably, the antigen binding domain is fused with the intracellular domain of the combination of the 4-1BB signaling domain and CD3 signaling domain.
(29) As used herein, antigen binding domain and single chain antibody fragment all refer to a Fab fragment, a Fabfragment, a F (ab).sub.2 fragment, or a single Fv fragment having antigen binding activity. The Fv antibody contains the variable region of the heavy chain and the variable region of the light chain, but does not have the constant region, and has the smallest antibody fragment with all the antigen binding sites. Generally, the Fv antibody also contains a polypeptide linker between VH and VL domains, and can form the structure required for antigen binding. The antigen binding domain is usually a scFv (single-chain variable fragment). The size of scFv is generally of that of a complete antibody. The single chain antibody is preferably an amino acid chain sequence encoded by a nucleotide chain. As a preferred embodiment of the present invention, the antigen-binding domain comprises an antibody specifically recognizing BCMA and optionally an antibody specifically recognizing CD19, preferably a single chain antibody.
(30) For the hinge region and transmembrane region (transmembrane domain), the CAR may be designed to include a transmembrane domain fused to the extracellular domain of the CAR. In one embodiment, a transmembrane domain naturally associated with one of the domains in the CAR is used. In some examples, the transmembrane domain may be selected or modified by amino acid substitution to avoid binding such a domain to transmembrane domains of the same or different surface membrane proteins, thereby minimizing interaction with other members of the receptor complex.
(31) The intracellular domains in the CAR of the present invention include a signal transduction domain of 4-1BB and a signal transduction domain of CD3.
(32) Preferably, the CAR of the present invention also including cell suicide elements.
(33) Preferably, the scFv targeting BCMA of the present invention is J scFv, and the BB scFv and April chain in the examples serve as a control. BB scFv and April chain are commonly used binding sequences targeting BCMA in the field. BB scFv is described in PCT application WO 2010104949 A3, and April chain is described in CN105658671A.
(34) Bispecific CAR Targeting CD19 and BCMA
(35) Multiple myeloma (MM) is a malignant plasma cell tumor. Its tumor cells originate from plasma cells in bone marrow, and plasma cells are cells that develop to the final functional stage of B lymphocytes. Multiple myeloma is basically an incurable disease with the characteristics of high morbidity and high mortality. In the 2017 statistics, there were 30,000 newly diagnosed patients with multiple myeloma in the United States, while 12,000 may face death. At present, the common therapies for multiple myeloma include cytotoxic drugs, protease inhibitors (Bortezomib, etc.), lenalidomide, monoclonal antibodies and corticosteroids, etc. However, they are all partially effective, and the remission cannot be sustained, and the probability of recurrence is very high. Therefore, the improvement of multiple myeloma therapy is particularly important.
(36) CD19, a glycoprotein with a molecular weight of 95 kDa, is expressed on the membrane surface of preB cells and mature B cells. It is closely related to the transmembrane conduction pathway of Ca++ in B cells and regulates the proliferation and differentiation of B cells. CD19 is mainly expressed in normal B cells and cancerous B cells, with high tissue expression specificity, so it is a good antibody or CAR-T immunotherapy target. However, in the process of immunotherapy, the CD19 epitope of B cells is often lost, resulting in no response to immunotherapy or recurrence of patients.
(37) Bispecific means that the same CAR can specifically bind and recognize two different antigens, and CAR can produce immune response when binding to any antigen.
(38) In another preferred embodiment, the bispecific CAR targeting CD19 and BCMA is as described in the second aspect of the present invention.
(39) In a preferred embodiment of the present invention, the extracellular domain of the CAR provided by the present invention comprises antigen binding domains targeting CD19 and BCMA, including anti-CD19 scFv and anti-BCMA scFv.
(40) In another preferred embodiment, the present invention provides a bispecific chimeric antigen receptor for CD19 and BCMA antigens. The structural components of the CAR targeting both CD19 and BCMA may comprises a signal peptide, an anti-CD19 scFv, an anti-BCMA scFv, a hinge region, a transmembrane region, and an intracellular T cell signal region, wherein CD19scFv and BCMAscFv are connected by a short peptide segment (G4S)xN. The structure of the CAR targeting both CD19 and BCMA is described in the second aspect of the present invention.
(41) In another preferred embodiment, the CD19 and BCMA bispecific CAR of the present invention is a single structure comprising scFv against CD19 and BCMA. Wherein CAR includes CD19 scFv and BCMA scFv, and the sequences of CD19 scFv and BCMA scFv and the hinge are the main factors affecting its function.
(42) In another preferred embodiment, the present invention optimizes the sequence of the BCMA scFv, and the BCMA scFv (J scFv) has high affinity and good specificity with BCMA, and can specifically target the full-length antigen and extracellular region of BCMA.
(43) In a preferred embodiment of the present invention, (G4S)x3 is used to connect CD19scFv and BCMAscFv, at this time, the activity and lethality of CAR are the best.
(44) Compared with the CAR targeting a single antigen, the CAR using bidirectional targeting CD19 and BCMA has significantly enhanced affinity, significantly increased activity of immune cells and synergistic effect. In addition, due to the uneven expression levels of CD19 and BCMA in tumor cells, the scope of dual-targeted CAR-T therapy is wider. CAR-immune cells targeting both CD19 and BCMA can reduce the possibility of antigen escape caused by down-regulation or deletion of single surface antigen.
(45) Chimeric Antigen Receptor T Cells (CAR-T Cells)
(46) As use herein, the terms CAR-T cell, CAR-T, CAR-T cell of the present invention include CAR-T cells of the third aspect of the present invention.
(47) CAR-T cells have the following advantages over other T cell-based therapies: (1) the action process of CAR-T cells is not limited by MHC; (2) since many tumor cells express the same tumor antigen, once the CAR gene for a certain tumor antigen is constructed, it can be widely used; (3) CAR can use both tumor protein antigen and glycolipid non-protein antigen, thereby expanding the target range of tumor antigens; (4) the use of autologous cells from patients reduces the risk of rejection reaction; (5) CAR-T cells have immune memory function and can survive in vivo for a long time.
(48) Chimeric Antigen Receptor NK Cells (CAR-NK Cells)
(49) As use herein, the terms CAR-NK cell, CAR-NK, CAR-NK cell of the present invention all refer to the CAR-NK cells of the third aspect of the present invention. The CAR-NK cells of the present invention can be used for treating tumors with high expression of BCMA, such as multiple myeloma and the like.
(50) Natural killer (NK) cells are a major class of immune effector cells, which protect the body from virus infection and invasion of tumor cells through non-antigen-specific pathways. Engineered (genetically modified) NK cells may obtain new functions, including the ability to specifically recognize tumor antigens and enhance anti-tumor cytotoxicity.
(51) Compared with autologous CAR-T cells, CAR-NK cells also have the following advantages, for example: (1) they kill tumor cells directly by releasing perforin and granzyme, but have on killing effect on normal cells of the body; (2) they release a small amount of cytokines, thus reducing the risk of cytokine storms; (3) they are easy to expand in vitro and can be developed into off-the-shelf products. In addition, it is similar to CAR-T cell therapy.
(52) Suicide Gene Switch
(53) In order to further control the defects such as non-tumor targeting of CAR-T cells and cytokine release syndrome, all CART cells of the present invention are provided with suicide gene switches, which can effectively eliminate CAR-T cells in the body and block unknown or uncontrollable long-term toxicity under the action of exogenous drugs, so as to ensure the patients safety.
(54) The suicide switch used in the present invention can be herpes simplex virus thymidine kinase (HSV-TK), inducible caspase 9 (iCasp9), CD20, mutated human thymidylate kinase (mTMPK), etc. In comparison, HSV-TK, iCasp9 and CD20 have the same clearance ability on CAR-cells, but the clearance of iCasp9 and CD20 is faster, and HSV-TK is slower.
(55) The iCasp9 suicide switch contains a FKBP12-F36V domain, which can be linked to cysteine aspartate proteinase 9 through a flexible linker, which does not contain recruitment domain. FKBP12-F36V contains a FKBP domain in which phenylalanine replaces valine at the 36th amino acid residue. It has high selectivity and sub-nanomolar affinity, and can be combined with dimerization to form a ligand, such as other inert small molecules AP1903. When small molecules are added, it can promote its dimerization, thus inducing apoptosis of cells, but it is ineffective for normal cells without a suicide switch.
(56) Induced safety switch caspase9 (iCasp9) uses human caspase9 to fuse FK506 binding protein (FKBP), so that it can be induced to form dimer by chemical inducer (AP1903/Rimiducid, Bellicum Pharmaceutical), which leads to apoptosis of cells expressing the fusion protein.
(57) Although CD19 and BCMA are highly expressed in tumor cells, they are also expressed in normal B cells. The engineered immune cells of the present invention will attack normal B cells in the body.
(58) How to control the safety of CAR-cells has always been an urgent problem to be solved. Adding a safety switch to the CAR-cell is the safest way to stop the activity of CAR-cells. The inducible iCasp9 safety switch controls CAR-cell clearance after CAR-cells produce severe toxicity (CRS/neurotoxicity) or after patients achieve long-term sustained remission.
(59) Vector
(60) The nucleic acid sequence encoding the desired molecule can be obtained using recombinant methods known in the art, such as, for example, by screening a library from a cell expressing the gene, by obtaining the gene from a vector known to comprise the gene, or by directly isolating from cells and tissues containing the gene using standard techniques. Alternatively, the gene of interest can be synthesized and produced.
(61) The present invention also provides a vector in which the expression cassette of the invention is inserted. Vectors derived from retroviruses such as lentivirus are suitable tools for long-term gene transfer because they allow long-term stable integration of transgenes and their proliferation in daughter cells. Lentiviral vectors have advantages over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the advantage of low immunogenicity.
(62) In brief summary, the expression cassette or nucleic acid sequence of the present invention is generally operably linked to a promoter and incorporated into an expression vector. The vector is suitable for replication and integration in eukaryotes. Typical cloning vectors contain transcriptional and translational terminators, initial sequences, and promoters that can be used to regulate the expression of desired nucleic acid sequences.
(63) The expression constructs of the present invention can also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, for example, U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, which are incorporated herein in its entirety by reference. In another embodiment, the present invention provides a gene therapy vector.
(64) The nucleic acid can be cloned into many types of vectors. For example, the nucleic acid may be cloned into vectors including, but not limited to, plasmids, phage particles, phage derivatives, animal viruses, and clay particles. Specific vectors of interest include expression vectors, replication vectors, probe production vectors, and sequencing vectors.
(65) Further, the expression vector may be provided to cells in the form of a viral vector. Viral vector techniques are well known in the art and are described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York) and other manuals of virology and molecular biology. Viruses that can be used as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpesviruses, and lentivirus. Typically, a suitable vector comprises a replication origin, a promoter sequence, a convenient restriction enzyme site, and one or more selectable markers that function in at least one organism (e.g. WO01/96584; WO01/29058; and U.S. Pat. No. 6,326,193).
(66) Many virus-based systems have been developed for transferring genes into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. The selected gene may be inserted into a vector and packaged into a retroviral particle using techniques known in the art. The recombinant virus can then be isolated and transmitted to target cells either in vivo or ex vivo. Many retroviral systems are known in the art. In some embodiments, adenovirus vectors are used. Many adenovirus vectors are known in the art. In one embodiment, lentiviral vectors are used.
(67) Additional promoter elements, e.g., enhancers, may regulate the frequency of transcription initiation. Typically, these are located in the 30-110 bp region upstream of the initiation site although it has recently been shown that many promoters also contain functional elements downstream of the initiation site. The spacing between promoter elements is often flexible to maintain promoter function when the element is inverted or moved relative to the other. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased by 50 bp apart before activity begins to decline. Depending on the promoter, it is shown that individual elements can function either cooperatively or independently to initiate transcription.
(68) One example of a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. The promoter sequence is a strongly constitutive promoter sequence capable of driving a high level of expression of any polynucleotide sequence operably linked thereto. Another example of a suitable promoter is elongated growth factor-1a (EF-1). However, other constitutive promoter sequences may also be used, including, but not limited to, the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, the avian leukemia virus promoter, Epstein-Barr virus immediate early promoter, Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the present invention should not be limited to the use of constitutive promoters. Inducible promoters are also considered as part of the present invention. The use of an inducible promoter provides a molecular switch that can turn on the expression of a polynucleotide sequence which is operably linked to the inducible promoter when such expression is desired or turn off the expression when the expression is not desired. Examples of inducible promoters include but are not limited to a metallothionein promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
(69) In order to evaluate the expression of the CAR polypeptide or part thereof, the expression vector to be introduced into a ceil can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors. In other aspects, the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both of the selectable marker and reporter genes may be flanked with appropriate regulatory sequences to enable expression in host cells. Useful selectable markers include, for example, antibiotic resistance genes such as neo and the like.
(70) Reporter genes are used to identify potentially transfected cells and to evaluate the functionality of regulatory sequences. Typically, the reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is clearly indicated by some readily detectable property such as enzyme activity. After DNA has been introduced into the recipient cells, the expression of the reporter gene is measured at an appropriate time. Suitable reporter genes may include genes encoding luciferase, -galactosidase, chloramphenicol acetyltransferase, secretory alkaline phosphatase, or green fluorescent protein (e.g. Ui-Tei et al., 2000FEBS Letters 479: 79-82). Suitable expression systems are well known and may be prepared using known techniques or obtained commercially. Typically, the construct with at least 5 flanking regions showing the highest level of reporter gene expression is identified as the promoter. Such promoter region may be linked to a reporter gene and used to evaluate the ability of reagents to regulate promoter-driven transcription.
(71) Methods of introducing and expressing genes into cells are known in the art. In the content of the expression vector, the vector may be readily introduced into a host cell, e.g., a mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical or biological means.
(72) The physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipid transfection, particle bombardment, microinjection, electroporation and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). A preferred method for introducing a polynucleotides into a host cell is calcium phosphate transfection.
(73) Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors may be derived from lentivirus, poxvirus, herpes simplex virus I, adenovirus and adeno-associated virus, etc. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
(74) Chemical means for introducing polynucleotides into host cells include colloidal dispersion systems, such as macromolecular complexes, nanocapsules, microspheres, beads, and lipid-based systems, including oil-in-water emulsions, micelles, mixed micelles and liposomes. An exemplary colloidal system used as a delivery vehicles in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
(75) In the case of using a non-viral delivery system, an exemplary delivery tool is a liposome. The use of lipid formulations is contemplated for the introduction of the nucleic acids into host cells (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of the liposome, attached to the liposome via a linker molecule associated with both the liposome and the oligonucleotide, entrapped in the liposome, complexed with the liposome, dispersed in solutions containing lipids, mixed with lipids, combined with lipids, contained in lipids as suspensions, contained or complexed with micelles, or otherwise associated with lipids. The lipid, lipid/DNA or lipid/expression vector associated with the composition is not limited to any specific structure in solution. For example, they may exist in bilayer structures, as micelles or have a collapsed structure. They may also be simply dispersed in solution, possibly forming aggregates of uneven size or shape. Lipids are fatty substances, which can be naturally occurring or synthesized lipids. For example, lipids include fatty droplets that occur naturally in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
(76) In a preferred embodiment of the invention, the vector is a lentiviral vector.
(77) Preparation
(78) The present invention provides a preparation containing the CAR-T cell according to the first aspect of the present invention, and a pharmaceutically acceptable carrier, diluent or excipient. In one embodiment, the preparation is a liquid preparation. Preferably, the preparation is an injection. Preferably, the concentration of the CAR-T cells in the preparation is 110.sup.3-110.sup.8 cells/ml, preferably 110.sup.4-110.sup.7 cells/ml.
(79) In one embodiment, the preparation may comprise buffers such as neutral buffered saline, sulfate buffered saline, and the like; carbohydrates such as glucose, mannose, sucrose or dextran, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. The preparation of the present invention is preferably formulated for intravenous administration.
(80) Therapeutic Application
(81) The present invention comprises therapeutic application using cells (e.g., T cells) transduced with lentiviral vectors (LV) encoding the expression cassette of the present invention. The transduced T cells can target tumor cell markers BCMA and/or CD19, and activate T cells synergistically to cause T cell immune response, thereby significantly improving its killing efficiency on tumor cells.
(82) Thus, the present invention also provides a method for stimulating a T cell-mediated immune response to a target cell population or tissue in a mammal, comprising the step of administering the CAR-T cell of the invention to the mammal.
(83) In one embodiment, the present invention comprises a type of cell therapy that autologous T cells from a patient (or heterologous donors) are isolated, activated and genetically modified to generate CAR-T cells, and then the CAR-T cells are injected into the same patient. In this way, the probability of graft-versus-host disease is extremely low, and antigens are recognized by T cells in a non-MHC-restricted manner. In addition, one kind of CAR-T can treat all cancers expressing this antigen. Unlike antibody therapy, CAR-T cells are able to replicate in vivo and result in long-term persistence that can lead to sustained tumor control.
(84) In one embodiment, the CAR-T cells of the present invention can undergo stable in vivo T cell expansion and can persist for an extended amount of time. In addition, the CAR-mediated immune response may be part of an adoptive immunotherapy step in which CAR-modified T cells induce an immune response specific to the antigen-binding domain in the CAR. For example, anti-BCMA and/or CD19 CAR-T cells elicit a specific immune response against cells that express BCMA and/or CD19.
(85) Although the data disclosed herein specifically discloses lentiviral vectors comprising anti-BCMA and/or CD19scFv, hinge and transmembrane domains, and 4-1BB/CD28 and CD3 signaling domains, the present invention should be construed to include any number of changes to each of the constituent parts of the construct.
(86) Cancers that may be treated include tumors that are unvascularized or substantially unvascularized, as well as vascularized tumors. Cancers may include non-solid tumors (such as hematological tumors, for example, leukemia and lymphoma) or solid tumors. Types of cancers to be treated with the CAR of the present invention include, but are not limited to, carcinomas, blastocytomas and sarcomas, and certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignant tumors, e.g., sarcomas, carcinomas and melanomas. Adult tumors/cancers and pediatric tumors/cancers are also included.
(87) Hematological cancers are cancers of blood or bone marrow. Examples of hematological (or hematogenic) cancers include leukemia, including acute leukemia (such as acute lymphoblastic leukemia, acute myeloid leukemia, acute myelogenous leukemia and myeloblastic, promyelocytic, myelomonocytic, monocytic and erythroleukemia), chronic leukemia (such as chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia and chronic lymphocytic leukemia), polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma (painless and high-grade form), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia.
(88) Solid tumors are abnormal masses of tissue that usually do not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named after the cell types that form them (such as sarcoma, cancer and lymphoma). Examples of solid tumors such as sarcomas and cancers include fibrosarcoma, myxosarcoma, liposarcoma, mesothelioma, malignant lymphoma, pancreatic cancer, and ovarian cancer.
(89) The CAR-modified T cells of the present invention may also be used as a type of vaccine for ex vivo immunization and/or in vivo therapy of mammals. Preferably, the mammal is a human.
(90) For ex vivo immunization, at least one of the following occurs in vitro before the cell is administered into a mammal: i) expanding the cells, ii) introducing the nucleic acids encoding CAR into the cells, and/or iii) cryopreservation of the cells.
(91) Ex vivo procedures are well known in the art and are discussed more fully below. Briefly, cells are isolated from a mammal (preferably a human) and genetically modified (i.e., transduced or transfected in vitro) with vectors expressing the CAR disclosed herein. CAR-modified cells can be administered to a mammalian recipient to provide a therapeutic benefit. The mammalian recipient may be a human, and the CAR-modified cells may be autologous relative to the recipient. Alternatively, the cells may be allogeneic, syngeneic or xenogeneic with respect to the recipient.
(92) In addition to using a cell-based vaccine for in vitro immunization, the present invention also provides compositions and methods for in vivo immunization to elicit an immune response against an antigen in a patient.
(93) The present invention provides a method for treating a tumor comprising administering a therapeutically effective amount of CAR-modified T cells of the present invention to a subject in need thereof.
(94) The CAR-modified T cells of the present invention may be administered alone or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2, IL-17 or other cytokines or cell populations. Briefly, the pharmaceutical compositions of the present invention may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents, or excipients. Such compositions may comprise buffers such as neutral buffered saline, sulfate buffered saline, and the like; carbohydrates such as glucose, mannose, sucrose or dextran, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. The compositions of the present invention are preferably formulated for intravenous administration.
(95) The pharmaceutical compositions of the present invention may be administered in a manner suitable for the disease to be treated (or prevented). The quantity and frequency of administration will be determined by factors such as the condition of the patient, and the type and severity of the patient's disease, although the appropriate dose may be determined by clinical trials.
(96) When an immunologically effective amount, an anti-tumor effective amount, a tumor-inhibitory effective amount or a therapeutic amount is indicated, the precise amount of the composition of the invention to be administered may be determined by the physician, with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It may generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 10.sup.4 to 10.sup.9 cells/kg body weight, preferably 10.sup.5 to 10.sup.6 cells/kg body weight (including all integer values within those ranges). T cell compositions may also be administered multiple times at these dosages. Cells may be administered using infusion techniques that are well known in immunotherapy (see, for example, Rosenberg et al., New Eng. J. of Med. 319: 1676, 1988). The optimal dosage and treatment regimen for a particular patient can be easily determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
(97) The administration of the subject composition may be performed in any convenient manner, including by spraying, injection, swallowing, infusion, implantation, or transplantation. The compositions described herein may be administered to a patient subcutaneously, intradermally, intratumorally, intramuscularly, intramuscularly, intravenously (i.v.) injection, or intraperitoneal. In one embodiment, the T cell composition of the present invention is administered to a patient by intradermal or subcutaneous injection. In another embodiment, the T cell composition of the present invention is preferably administered by i.v. injection. The composition of T cells may be directly injected into tumors, lymph nodes or infected sites.
(98) In certain embodiments of the present invention, cells that are activated and expanded using the methods described herein or other methods known in the art for extending T cells to therapeutic levels are administered to a patient in conjunction with (e.g., before, simultaneously or subsequently) any number of related treatment forms, including but not limited to treatment with agents such as antiviral therapy, cidofovir and interleukin-2, cytarabine (also known as ARA-C) or natalizumab treatment for MS patients or efalizumab treatment for psoriasis patients or other treatments for PML patients. In further embodiments, the T cells of the present invention may be used in combination with chemotherapy, radiation, immunosuppressants such as cyclosporine, azathioprine, methotrexate, mycophenolate and FK506, antibodies or other immunotherapeutic agents. In a further embodiment, the cell composition of the present invention is administered to a patient in combination with (e.g. before, simultaneously, or subsequently) bone marrow transplantation, or the use of chemotherapy agents such as fludarabine, external-beam radiotherapy (XRT), cyclophosphamide. For example, in one embodiment, the subject may undergo standard treatment of high-dose chemotherapy followed by peripheral blood stem cell transplantation. In some embodiments, after transplantation, the subject receives an injection of extended immune cells of the present invention. In an additional embodiment, the expanded cells are administered before or after surgery.
(99) The dosage of the above treatments to be administered to the patient will vary with the precise nature of the condition being treated and the recipient of the treatment. The scaling of dosage for human administration can be implemented according to accepted practices in the art. In general, for each treatment or course of treatment, 110.sup.6 to 110.sup.10 of the modified T cells of the present invention (e.g. CAR-T20 cells) can be administered to patients by means of, e.g. intravenous reinfusion.
(100) The Main Advantages of the Invention Include:
(101) (a) The constructed CAR-T cells containing J scFv of the present invention have higher tumor killing and functional activities in vivo and in vitro than BB and April CAR-T.
(102) (b) The constructed bispecific CAR-T of the present invention can simultaneously recognize two or more targets including BCMA.
(103) The present invention will be further illustrated below with reference to the specific examples. It is to be understood that these examples are for illustrative purposes only and are not intended to limit the scope of the invention. The experimental methods without detailed conditions in the following examples are generally in accordance with conventional conditions, or in accordance with the conditions recommended by the manufacturer. Unless otherwise stated, percentages and parts are calculated by weight.
Example 1 Isolation of PBMC and Amplification of T Cells from Donor Blood
(104) Mononuclear cells were isolated from donor blood, and centrifuged with density gradient using Histopaque-1077 (Sigma-Aldrich). The T cells were enriched (EasySep Human T Cell Enrichment Kit, Stemcell Technologies). The T cells were activated, cultured and amplified using magnetic beads coupled with anti-CD3/anti-CD28. X-vivo15 (300 IU/ml rhIL2) was used as culture medium. All cells were cultured in a constant temperature incubator at 37 C., 5% CO.sub.2.
Example 2 Cell Culture and Construction
(105) BCMA-expressing cell lines MM.1s and RPMI8226, MM.1s-ffluc cells, RPMI8226-ffluc cells, Hela cells expressing BCMA, CD19 and BCMA/CD19 at the same time, the above cells were cultured in RPMI 1640 medium; 293T (human renal epithelial cell line, ATCC CRL-3216) was cultured using DMEM medium. All medium were supplemented with 10% (v/v) fetal bovine serum, 100 U/ml penicillin and streptomycin, 2 mM L-glutamine and 1 mM sodium pyruvate.
(106) Among them, Hela cells expressing BCMA, CD19 and BCMA/CD19 at the same time were stable cell lines obtained by transferring BCMA and CD19 antigens through lentiviral vectors, which can specifically express BCMA or/and CD19 protein molecules. MM.1s-ffluc cells and RPMI8226-ffluc cells are stable cell lines screened after lentivirus infection with firefly luciferase.
Example 3 CAR Structural Design and Transduction
(107) A single CAR targeting BCMA and a dual CAR targeting BCMA and CD19 were designed and constructed. The structure is schematically shown in
(108) TABLE-US-00001 TABLE 1 Structure of CAR Structure CAR-T naming Structure composition Name J1 SingleJ scFv CAR-J1 J2 Parallel CD19 CAR + J1 CAR (Dual CAR) CAR-J2 J3 Parallel J1 CAR + CD19 CAR (Dual CAR) CAR-J3 J4 CAR of CD19 scFv + J scFv with loop CAR-J4 structure S5 Serial J scFv + CD19 scFv CAR CAR-S5 BB Single BB scFv CAR-BB April Single April chain CAR-April 19-BB Parallel CD19 CAR + BB CAR (Dual CAR) CAR-19-BB 19 SingleCD19 scFv CAR-19
(109) The specific sequences of elements involved in the CAR described in
(110) TABLE-US-00002 JscFvheavychain (SEQIDNO:9) QVQLQQSGGGLVQPGGSLKLSCAASGIDFSRYWMSWVRRAPGKGLEWIGE INPDSSTINYAPSLKDKFIISRDNAKNTLYLQMSKVRSEDTALYYCASLY YDYGDAMDYWGQGTSVTVSS JscFvlightchain (SEQIDNO:10) DIVMTQSQRFMTTSVGDRVSVTCKASQSVDSNVAWYQQKPRQSPKALIFS ASLRFSGVPARFTGSGSGTDFTLTISNLQSEDLAEYFCQQYNNYPLTFGA GTKLELK BBscFvheavychain (SEQIDNO:13) DIVLTQSPPSLAMSLGKRATISCRASESVTILGSHLIHWYQQKPGQPPTL LIQLASNVQTGVPARFSGSGSRTDFTLTIDPVEEDDVAVYYCLQSRTIPR TFGGGTKLEIK BBscFvlightchain (SEQIDNO:14) QIQLVQSGPELKKPGETVKISCKASGYTFTDYSINWVKRAPGKGLKWMGW INTETREPAYAYDFRGRFAFSLETSASTAYLQINNLKYEDTATYFCALDY SYAMDYWGQGTSVTVSSAAA Aprilchain (SEQIDNO:15) SVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLL YSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAG VFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLSGGGSDP CD8signalpeptide (SEQIDNO:16) MALPVTALLLPLALLLHAARP (G45)3linkerpeptide (SEQIDNO:17) GGGGSGGGSGGGGS (G45)5linkerpeptide (SEQIDNO:18) GGGGSGGGGSGGGGSGGGGSGGGGS 218linkerpeptide (SEQIDNO:19) GSTSGSGKPGSGEGSTKG CD8hingeregion (SEQIDNO:8) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQIDNO:21) OrKPTTTPAPRPPTPAPTIASQPLSLRPEASRPAAGGAVHTRGLDFASDK P or (SEQIDNO:22) SGTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD CD8transmembraneregion (SEQIDNO:7) IYIWAPLAGTCGVLLLSLVITLYC CD28transmembraneregion (SEQIDNO:6) FWVLVVVGGVLACYSLLVTVAFIIFWV 41BBsignalregion (SEQIDNO:5) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD28signalregion (SEQIDNO:4) RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS CD3zsignalregion (SEQIDNO:3) RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR (SEQIDNO:23) orRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGK PQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTAT KDTYDALHMQALPPR 2Apeptide (SEQIDNO:2) GSGATNFSLLKQAGDVEENP FMC63scFv(CD19scFv)heavychain (SEQIDNO:11) EVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGV IWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYY YGGSYAMDYWGQGTSVTVSS FMC63scFv(CD19scFv)lightchain (SEQIDNO:12) DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYH TSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGG GTKLEIT GM-CSFsignalpeptide (SEQIDNO:1) MLLLVTSLLLCELPHPAFLLIP EGFRtsequence (SEQIDNO:20) RKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTH TPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQH GQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGT SGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGR ECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCA HYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGL EGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFM
(111) The CAR genes in Table 1 were cloned into the skeleton of FUW lentivirus vector to construct a complete lentivirus expression vector which can be used to infect T cells. Specifically, taking the BCMA CAR gene as an example, the BCMA CAR gene was placed under the promoter of EF1 (EF-1) to form Fuw-EF1-BCMA CAR, and three plasmids including Fuw-EF1a-BCMA CAR, lentiviral envelope plasmid pMD2.G (Addgene, Plasmid #12259) and lentiviral packaging plasmid psPAX2 (Addgene, Plasmid #12260) were transferred into 293T using Lipofectamine3000 to prepare lentiviral complete expression vector. The virus supernatant was collected at 48 h and 72 h, and concentrated by ultracentrifugation. The concentrated virus could be used to infect T cells.
(112) The results of flow cytometry analysis show that the constructed CAR gene can be used to produce lentiviral vector expressing BCMA CAR.
Example 4 Preparation of CAR-T Cell
(113) The experimental methods were as follows:
(114) 4.1 Lentivirus Infection
(115) After activation for 2 days, the isolated and purified primary T cells were infected with lentiviral vectors constructed in Example 3, transferred to a cell culture flask, and cultured in a constant temperature incubator at 37 C., 5% CO.sub.2.
(116) 4.2 Detection of Cell Proliferation and CAR Positive Rate
(117) After the 3rd day of infection and before cryopreservation, BCMA antigen was used to detect the number of cells and the proportion of BCMA positive cells, that is, to detect the CAR positive rate of T cells, and half of the culture medium was changed every 2-3 days.
(118) The results show that CAR-T cells are successfully produced using the lentiviral vectors packaged in Example 3, and the names are shown in Table 1.
(119) Specifically, the construction results of BCMA CAR-T cells are shown in
Example 5 Cell Killing In Vitro
(120) CAR-J1 CAR-T cells, CAR-BB CAR-T cells and CAR-April CAR-T cells obtained in Example 4 were subjected to in vitro killing assay. The killing of CAR-T cells to Hela cell lines over-expressing BCMA was tested by RTCA assay.
(121) The results are as shown in
(122) Then, the killing ability of tumor target cells labeled with luciferase was detected. The luciferase gene was transferred into target cells, and MM.1s-Luc and RPMI8226-Luc stable cell lines were obtained after cloning and screening. In the experiment, when luciferin substrate was added, luciferase reacted with luciferin to produce fluorescence. By detecting the intensity of fluorescence, the activity of luciferase and the survival rate of cells could be measured, and the killing effect of CAR-T cells could be obtained.
(123)
(124) In addition, the applicant also constructed CAR-T cells using a variety of common targeting BCMA scFv in the art. After testing, these CAR-T cells do not show ideal killing function.
(125) In summary, after CAR-T cells were co-cultured with target cells (BCMA overexpressing cells, BCMA-positive tumor cells, MM.1s-Luc and RPMI8226 cells), the target cells could be lysed by CAR-T cells targeting BCMA, and CAR-J1 showed higher killing ability than CAR-BB. Other CAR-T cells constructed by scFv targeting BCMA that are common in the art, do not show ideal killing function.
Example 6 Cytokine Release Assay
(126) The CAR T cells targeting BCMA (CAR-J1 CAR T cells and CAR-BB CAR T cells) obtained in Example 4 were mixed with tumor cells (Hela, Hela-BCMA, Hela-CD19, Hela-BCMA-CD19) and placed in RPMI medium at a density of 110.sup.4/ml of each cell. 100 ul of CAR-T cells and 100 ul of tumor cells were cultured overnight in 96-well plates. The supernatant was collected and centrifuged to detect the release level of cytokines such as IFN-. Elisa kit was used for detection.
(127) The results are as shown in
Example 7 In Vivo Pharmacodynamic Study
(128) NOG mice aged 6-12 weeks were selected and injected subcutaneously with 110.sup.7 RPMI8226 cells. Two days later, the load of tumor grafts was measured. After 10 days, mice were divided into groups. CAR-J1 CAR-T cells and CAR-BB CAR-T cells were injected one day after grouping, respectively. After CAR-T treatment, the tumor volume load of mice was evaluated twice a week.
(129) The results are as shown in
Example 8 Preparation of Dual CAR-T Cells
(130) The experimental methods were as follows:
(131) In this example, CAR-T cells targeting both BCMA and CD19 are involved, and the structure of CAR is schematically shown in
(132) The BCMA-CD19 CAR gene was cloned into the vector skeleton and placed under the promoter of EF1 (EF-1 ). The lentiviral complete expression vector was prepared by transferring EF1 -BCMA-CD19 CAR plasmid and lentiviral envelope plasmid into 293T using Lipofectamine3000. The virus supernatant was collected at 48 h and 72 h, and then concentrated by ultracentrifugation. The concentrated virus could be used to infect T cells.
(133) Lentivirus infection: After activation for 2 days, the isolated and purified primary T cells were infected with lentiviral vectors constructed above at MOI (1-10), transferred to a cell culture flask, and cultured in a constant temperature incubator at 37 C., 5% CO.sub.2.
(134) Detection of cell proliferation and CAR positive rate: The number of cells and the proportion of BCMA/CD19 dual positive cells were detected on the 3rd day after infection and before cryopreservation, that is, to detect the CAR positive rate of T cells, and half of the culture medium was changed every 2-3 days.
(135) The results show that BCMA-CD19 CAR-T cells are successfully constructed by using the BCMA-CD19 CAR lentiviral vector, as shown in
(136) The results are as shown in
Example 9 Cell Killing In Vitro
(137) The CAR-T cells obtained in Example 8 were subjected to in vitro killing assay. The overexpressing Hela cell lines that overexpressed BCMA and CD19 were used for RTCA or luciferase-labeled tumor target cells were used for detection. The luciferase gene was transferred into target cells, and stable cell lines (RPMI8226, MM.1s and Nalm6) were obtained after cloning and screening. In the experiment, when luciferin substrate was added, luciferase reacted with luciferin to produce fluorescence. By detecting the intensity of fluorescence, the activity of luciferase and the survival rate of cells could be measured, and the killing effect of CART cells could be obtained.
(138) The results show that all the target cells (CD19/BCMA dual positive, CD19 single positive, BCMA single positive) were lysed after CAR-T cells and the target cells above were co-cultured, which indicates that BCMA-CD19 CAR-T has killing effect on CD19/BCMA dual positive, CD19 single positive and BCMA single positive cells.
(139) The results are as shown in
(140)
Example 10 Up-Regulation of CD107 after Stimulation
(141) The CAR-T cells obtained in Example 8 were subjected to flow cytometry analysis of CD107a expression changes after activation, and a co-incubation activation experiment was performed using tumor cell lines expressing CD19 or BCMA. The cells after co-incubation were labeled with antibodies for CD3, CD8, and CD107a, and then flow cytometric analysis was performed.
(142) The results are as shown in
Example 11 In Vivo Pharmacodynamic Study
(143) NOG mice aged 6-12 weeks were selected and injected intravenously with 110.sup.7 MM.1s cells. Two days later, the tumor graft load was measured. And 10 days later, the mice were divided into groups, and CAR-T cells were injected with high and low doses one day after grouping. After CAR-T treatment, the tumor burden of mice was evaluated twice a week. Each mouse was intraperitoneally injected with 3 mg d-luciferin (Perkin Elmer Life Sciences), and photographed with Xenogen IVIS Imaging System (Perkin Elmer Life Sciences) four minutes later, and exposed for 30s. The signal of bioluminescence is calculated according to the amount of photons emitted, and the amount of photons is normalized by exposure time and surface area, and finally the amount of photons/s/cm.sup.2/steradian (p/s/cm.sup.2/sr) is obtained.
(144) The results of
Example 12
(145) The killing ability was detected by using Raji lymphoma target cells labeled with luciferase. The luciferase gene was transferred into Raji target cells, and the stable cell line Raji-Luc was obtained after cloning and screening. In the experiment, when luciferin substrate was added, luciferase reacted with luciferin to produce fluorescence. By detecting the intensity of fluorescence, the activity of luciferase and the survival rate of cells could be measured, and the killing effect of CAR-T cells could be obtained.
(146) The results are as shown in
(147) All literatures mentioned in the present application are incorporated by reference herein, as though each one is individually incorporated by reference. In addition, it should be understood that after reading the above teaching content of the present invention, various changes or modifications may be made by those skilled in the art, and these equivalents also fall within the scope as defined by the appended claims of the present application.