Vaccines and uses thereof to induce an immune response to SARS-CoV2

12577589 ยท 2026-03-17

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided herein are recombinant modified vaccinia Ankara (rMVA) viral vectors comprising heterologous nucleic acid inserts encoding one or more SARS-CoV2 proteins, peptides, or fragments thereof, operably linked to a promoter compatible with poxvirus expression systems that, upon expression, are capable of inducing protective immunity. The compositions can be used in a priming vaccination strategy or in a prime/boost vaccination strategy to provide immunity to SARS-CoV2 and variants thereof.

Claims

1. A recombinant modified vaccinia Ankara (rMVA) viral vector comprising a heterologous nucleic acid sequence encoding a Spike(S) protein, a Membrane (M) protein, and an Envelope (E) protein derived from severe acute respiratory syndrome-coronavirus 2 (SARS-CoV2) operably linked to one or more promoters compatible with poxvirus expression systems.

2. The rMVA of claim 1, wherein the S protein comprises the amino acid sequence of SEQ ID NO: 1, or an amino acid sequence at least 95% homologous thereto.

3. The rMVA of claim 1, wherein the S protein comprises the amino acid sequence of SEQ ID NO: 6, or an amino acid sequence at least 95% homologous thereto.

4. The rMVA of claim 1, wherein the M protein comprises an amino acid sequence of SEQ ID NO: 43, or an amino acid sequence at least 95% homologous thereto.

5. The rMVA of claim 1, wherein the E protein comprises an amino acid sequence of SEQ ID NO: 40, or an amino acid sequence at least 95% homologous thereto.

6. The rMVA of claim 1, wherein the rMVA heterologous nucleic acid sequence comprises a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 46, 47, and 156, or a nucleic acid sequence at least 95% homologous thereto.

7. The rMVA of claim 1, wherein the promoters are selected from the group consisting of a p11 promoter, pmH5 promoter, pH5 promoter, p7.5 promoter, pSyn promoter, pHyb promoter, and a combination thereof.

8. A method of inducing an immune response in a human comprising administering an effective amount of an rMVA viral vector of claim 1 to the human.

9. A recombinant modified vaccinia Ankara (rMVA) viral vector comprising a heterologous nucleic acid sequence encoding a stabilized Spike(S) protein comprising proline substitutions corresponding to amino acid positions K986 and V987 of SEQ ID NO: 8, a Membrane (M) protein, and an Envelope (E) protein derived from severe acute respiratory syndrome-coronavirus 2 (SARS-CoV2) operably linked to a promoter compatible with poxvirus expression systems.

10. The rMVA of claim 9, wherein the stabilized S protein comprises the amino acid sequence of SEQ ID NO:8, or an amino acid sequence at least 95% homologous thereto.

11. The rMVA of claim 9, wherein the stabilized S protein comprises the amino acid sequence of SEQ ID NO:11, or an amino acid sequence at least 95% homologous thereto.

12. The rMVA of claim 9, wherein the M protein comprises an amino acid sequence of SEQ ID NO: 43, or an amino acid sequence at least 95% homologous thereto.

13. The rMVA of claim 9, wherein the E protein comprises an amino acid sequence of SEQ ID NO: 40, or an amino acid sequence at least 95% homologous thereto.

14. The rMVA of claim 9, wherein the rMVA heterologous nucleic acid sequence comprises a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 48, 49, 50, 157, 159, or 160, and a nucleic acid sequence at least 95% homologous thereto.

15. The rMVA of claim 9, wherein the promoters are selected from the group consisting of a p11 promoter, pmH5 promoter, pH5 promoter, p7.5 promoter, pSyn promoter, pHyb promoter, and a combination thereof.

16. A method of inducing an immune response in a human comprising administering an effective amount of an rMVA viral vector of claim 9 to the human.

17. The rMVA of claim 1, wherein, upon expression in a host cell, the S protein, M protein, and E protein are capable of together forming a virus-like particle (VLP).

18. The rMVA of claim 10, wherein, upon expression in a host cell, the stabilized S protein, M protein, and E protein are capable of together forming a Virus-like particle (VLP).

19. The rMVA of claim 2, wherein the S protein comprises one or more amino acid substitutions selected from the group consisting of K417T, K417N, E484K, N501Y, and a combination thereof, wherein K417T, K417N, E484K, N501Y correspond to amino acid positions 417, 484, and 501 of SEQ ID NO: 1.

20. The rMVA of claim 10, wherein the stabilized S protein comprises one or more amino acid substitutions selected from the group consisting of K417T, K417N, E484K, N501Y, and a combination thereof, wherein K417T, K417N, E484K, N501Y correspond to amino acid positions 417, 484, and 501 of SEQ ID NO: 8.

21. The rMVA of claim 2, wherein the S protein comprises the amino acid sequence of SEQ ID NO:1.

22. The rMVA of claim 3, wherein the S protein comprises the amino acid sequence of SEQ ID NO:6.

23. The rMVA of claim 4, wherein the M protein comprises an amino acid sequence of SEQ ID NO:43.

24. The rMVA of claim 5, wherein the E protein comprises an amino acid sequence of SEQ ID NO:40.

25. The rMVA of claim 10, wherein the stabilized S protein comprises the amino acid sequence of SEQ ID NO:8.

26. The rMVA of claim 11, wherein the stabilized S protein comprises the amino acid sequence of SEQ ID NO:11.

27. The rMVA of claim 12, wherein the M protein comprises an amino acid sequence of SEQ ID NO:43.

28. The rMVA of claim 13, wherein the E protein comprises an amino acid sequence of SEQ ID NO:40.

Description

BRIEF DESCRIPTION OF FIGURES

(1) FIG. 1A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising an insert comprising a nucleic acid encoding a full-length S, E, and M protein between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding the full-length SARS-CoV2 S protein in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the S protein sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the S protein, prior to the stop codon. As exemplified, adjacent to the S protein is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. Similar to the S protein, the E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(2) FIG. 1B-1C-1D is an exemplary rMVA nucleic acid insert of SEQ ID NO: 46 encoding the full-length SARS-CoV2 S, M, and E proteins. Also exemplified and identified within the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(3) FIG. 1E-1F-1G is an exemplary rMVA nucleic acid insert of SEQ ID NO: 47 encoding the full-length SARS-CoV2 S, M, and E proteins. Also exemplified and identified within the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, SmaI restriction site, and c-tag sequences.

(4) FIG. 1H-1I-1J is an exemplary rMVA nucleic acid insert of SEQ ID NO: 156 encoding the full-length SARS-CoV2 S, M, and E proteins. Also exemplified and identified within the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, SmaI restriction site, and c-tag sequences.

(5) FIG. 2A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid insert encoding a stabilized S protein, an E protein, and an M protein between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding the full-length SARS-CoV2 S stabilized protein in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the S stabilized protein sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the S stabilized protein, prior to the stop codon. As exemplified, adjacent to the S stabilized protein is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. Similar to the S stabilized protein, the E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a pmH5 promoter. The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(6) FIG. 2B-2C-2D is an exemplary rMVA nucleic acid insert of SEQ ID NO: 48 encoding the full-length stabilized SARS-CoV2 S, M, and E proteins comprising the amino acid substitutions K986P and V987P. Also exemplified and identified within the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(7) FIG. 2E-2F-2G is an exemplary rMVA nucleic acid insert of SEQ ID NO: 49 encoding the full-length stabilized SARS-CoV2 S, M, and E proteins comprising the amino acid substitutions K986P and V987P. Also exemplified and identified within the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(8) FIG. 2H-2I-2J is an exemplary rMVA nucleic acid insert of SEQ ID NO: 50 encoding the full-length stabilized SARS-CoV2 S, M, and E proteins comprising the amino acid substitutions K986P, V987P, K417T, E484K, and N501Y. Also exemplified and identified within the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(9) FIG. 2K-2L-2M is an exemplary rMVA nucleic acid insert of SEQ ID NO: 157 encoding the full-length stabilized SARS-CoV2 S, M, and E proteins comprising the amino acid substitutions K986P and V987P. Also exemplified and identified within the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(10) FIG. 2N-2O-2P is an exemplary rMVA nucleic acid insert of SEQ ID NO: 159 encoding the full-length stabilized SARS-CoV2 S, M, and E proteins comprising the amino acid substitutions K986P, V987P, K417T, E484K, and N501Y. Also exemplified and identified within the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(11) FIG. 2Q-2R-2S is an exemplary rMVA nucleic acid insert of SEQ ID NO: 160 encoding the full-length stabilized SARS-CoV2 S, M, and E proteins comprising the amino acid substitutions K986P, V987P, K417T, E484K, and N501Y. Also exemplified and identified within the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, and Kozak regulatory sequences.

(12) FIG. 3A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding an RBD (aa 331-524) region of the S protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding amino acids 331 to 524 of the S protein in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to a start codon inserted 5 of the S RBD (aa 331-524) protein sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the S RBD (aa 331-524) protein, prior to the stop codon. As exemplified, adjacent to the S RBD (aa 331-524) protein is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. Similar to the S RBD (aa 331-524) protein, the E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(13) FIG. 3B is an exemplary rMVA nucleic acid insert of SEQ ID NO: 53 encoding an RBD (aa 331-524) region of the S protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(14) FIG. 3C is an exemplary rMVA nucleic acid insert of SEQ ID NO: 54 encoding an RBD (aa 331-524) region of the S protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(15) FIG. 3D provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding an RBD (aa 327-524) region of the S protein, an E protein, and an M protein inserted between, for example, MVA A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding amino acids 327 to 524 of the S protein in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to a start codon inserted 5 of the S RBD (aa 327-524) protein sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the S RBD (aa 327-524) protein, prior to the stop codon. As exemplified, adjacent to the S RBD (aa 327-524) protein is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. Similar to the S RBD (aa 327-524) protein, the E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(16) FIG. 3E is an exemplary rMVA nucleic acid insert of SEQ ID NO: 51 encoding an RBD (aa 327-524) region of the S protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(17) FIG. 3F is an exemplary rMVA nucleic acid insert of SEQ ID NO: 52 encoding an RBD (aa 327-524) region of the S protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(18) FIG. 3G provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a S protein signal peptide (SP)-S protein RBD (aa 331-524)-S protein transmembrane domain (STM) fusion protein, an E protein, and an M protein inserted between, for example, MVA A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a S protein signal peptide derived from amino acids 1-13 of the S protein (SP), an S protein RBD (aa 331-524) peptide, and a transmembrane domain derived from amino acids 1214-1273 of the S protein (STM), in a left-to-right orientation. A start codon is provided 5 to the SP-S RBD (aa 331-524)-STM fusion encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the signal peptide encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the SP-S RBD (aa 331-524)-STM fusion, prior to the stop codon. As exemplified, adjacent to the SP-S RBD (aa 331-524)-STM fusion encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. The E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(19) FIG. 3H provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a S protein signal peptide (SP)-S protein RBD (aa 327-524)-S protein transmembrane domain (STM) fusion protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a S protein signal peptide derived from amino acids 1-13 of the S protein (SP), an S protein RBD (aa 327-524) peptide, and a transmembrane domain derived from amino acids 1214-1273 of the S protein (STM), in a left-to-right orientation. A start codon is provided 5 to the SP-S RBD (aa 327-524)-STM fusion encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the signal peptide encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the SP-S RBD (aa 327-524)-STM fusion, prior to the stop codon. As exemplified, adjacent to the SP-S RBD (aa 327-524)-STM fusion encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. The E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(20) FIG. 3I-3J is an exemplary rMVA nucleic acid insert of SEQ ID NO: 69 encoding a S protein signal peptide (SP)-S protein RBD (aa 327-524)-S protein transmembrane domain (STM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(21) FIG. 3K-3L is an exemplary rMVA nucleic acid insert of SEQ ID NO: 70 encoding a S protein signal peptide (SP)-S protein RBD (aa 327-524)-S protein transmembrane domain (STM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(22) FIG. 3M-3N is an exemplary rMVA nucleic acid insert of SEQ ID NO: 71 encoding a S protein signal peptide (SP)-S protein RBD (aa 331-524)-S protein transmembrane domain (STM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(23) FIG. 3O-3P is an exemplary rMVA nucleic acid insert of SEQ ID NO: 72 encoding a S protein signal peptide (SP)-S protein RBD (aa 331-524)-S protein transmembrane domain (STM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(24) FIG. 3Q provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a S protein signal peptide (SP)-S protein RBD (aa 327-524) fusion protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a S protein signal peptide derived from amino acids 1-13 of the S protein (SP) and an S protein RBD (aa 327-524) peptide in a left-to-right orientation. A start codon is provided 5 to the SP-S RBD (aa 327-524) fusion encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the signal peptide encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the SP-S RBD (aa 327-524), prior to the stop codon. As exemplified, adjacent to the SP-S RBD (aa 327-524) fusion encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. The E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(25) FIG. 3R provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a S protein signal peptide (SP)-S protein RBD (aa 331-524) fusion protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a S protein signal peptide derived from amino acids 1-13 of the S protein (SP) and an S protein RBD (aa 331-524) peptide in a left-to-right orientation. A start codon is provided 5 to the SP-S RBD (aa 331-524) fusion encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the signal peptide encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the SP-S RBD (aa 331-524), prior to the stop codon. As exemplified, adjacent to the SP-S RBD (aa 331-524) fusion encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. The E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(26) FIG. 3S provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a S protein signal peptide (SP)-S protein RBD (aa 327-598) fusion protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a S protein signal peptide derived from amino acids 1-13 of the S protein (SP) and an S protein RBD (aa 327-598) peptide in a left-to-right orientation. A start codon is provided 5 to the SP-S RBD (aa 327-598) fusion encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the signal peptide encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the SP-S RBD (aa 327-598), prior to the stop codon. As exemplified, adjacent to the SP-S RBD (aa 327-598) fusion encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. The E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(27) FIG. 3T provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a S protein signal peptide (SP)-S protein RBD (aa 331-598) fusion protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a S protein signal peptide derived from amino acids 1-13 of the S protein (SP) and an S protein RBD (aa 331-598) peptide in a left-to-right orientation. A start codon is provided 5 to the SP-S RBD (aa 331-598) fusion encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the signal peptide encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the SP-S RBD (aa 331-598), prior to the stop codon. As exemplified, adjacent to the SP-S RBD (aa 331-598) fusion encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. The E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(28) FIG. 3U-3V is an exemplary rMVA nucleic acid insert of SEQ ID NO: 158 encoding a S protein signal peptide (SP)-S protein RBD (aa 331-524)-S protein transmembrane domain (STM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(29) FIG. 4A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a tandem repeat of S protein RBD derived amino acids, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding the S RBD tandem repeat ((aa504-524)-GPGPG-(aa473-490)-GPGPG) 5, in a left-to-right orientation. A start codon is provided 5 to the S RBD tandem repeat. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the S RBD tandem repeat sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the S RBD tandem repeat protein, prior to the stop codon. As exemplified, adjacent to the S RBD tandem repeat protein is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. Similar to the S RBD tandem repeat, the E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a pmH5 promoter. The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(30) FIG. 4B-4C is an exemplary rMVA nucleic acid insert of SEQ ID NO: 73 encoding a tandem repeat of S protein RBD derived amino acids, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, linker sequences, and c-tag sequences.

(31) FIG. 4D-4E is an exemplary rMVA nucleic acid insert of SEQ ID NO: 74 encoding a tandem repeat of S protein RBD derived amino acids, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, linker sequences, and c-tag sequences.

(32) FIG. 4F provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a signal peptide of the S protein amino acids 1-13 (SP)-S protein RBD tandem repeat-S protein transmembrane domain (STM) fusion protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide derived from amino acids 1-13 of the S protein (SP), an S protein RBD tandem repeat peptide, and a transmembrane domain derived from amino acids 1214-1273 of the S protein (STM), in a left-to-right orientation. A start codon is provided 5 to the SP-S RBD tandem repeat-STM fusion encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the signal peptide encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the SP-S RBD tandem repeat-STM fusion, prior to the stop codon. As exemplified, adjacent to the SP-S RBD tandem repeat-STM fusion encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. The E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(33) FIG. 4G-4H is an exemplary rMVA nucleic acid insert of SEQ ID NO: 81 encoding a signal peptide of the S protein amino acids 1-13 (SP)-S protein RBD tandem repeat-S protein transmembrane domain (STM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(34) FIG. 4I-4J is an exemplary rMVA nucleic acid insert of SEQ ID NO: 82 encoding a signal peptide of the S protein amino acids 1-13 (SP)-S protein RBD tandem repeat-S protein transmembrane domain (STM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, Smal restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(35) FIG. 5A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding an S protein RBD consensus sequence, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding the S RBD consensus protein in a left-to-right orientation. A start codon is provided 5 to the S RBD consensus encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the S RBD consensus protein encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the S RBD consensus protein, prior to the stop codon. As exemplified, adjacent to the S RBD consensus protein encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. Similar to the S RBD consensus protein, the E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(36) FIG. 5B provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a signal peptide of the S protein amino acids 1-13 (SP)-S protein RBD consensus-S protein transmembrane domain (STM) fusion protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide derived from amino acids 1-13 of the S protein (SP), an S protein RBD consensus peptide, and a transmembrane domain derived from amino acids 1214-1273 of the S protein (STM), in a left-to-right orientation. A start codon is provided 5 to the SP-S RBD consensus-STM fusion encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the signal peptide encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the SP-S RBD consensus-STM fusion, prior to the stop codon. As exemplified, adjacent to the SP-S RBD consensus-STM fusion encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left to right orientation, which is operably linked to, for example, a p11 promoter. The E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(37) FIG. 6A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid encoding truncated amino acids 1-1213 derived from the S protein (S1+S2 truncated), an E protein, and M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding truncated amino acids 1-1213 derived from the S protein (S1+S2 truncated), in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the S (S1+S2 truncated) protein sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the S protein (S1+S2 truncated), prior to the stop codon. As exemplified, adjacent to the S protein (S1+S2 truncated) is a nucleic acid sequence encoding the full-length E protein, left-to-right orientation, which is operably linked to, for example, a p11 promoter. Similar to the S protein (S1+S2 truncated), the E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(38) FIG. 6B-6C-6D is an exemplary rMVA nucleic acid insert of SEQ ID NO: 83 encoding truncated amino acids 1-1213 derived from the S protein (S1+S2 truncated), an E protein, and M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(39) FIG. 6E-6F-6G is an exemplary rMVA nucleic acid insert of SEQ ID NO: 84 encoding truncated amino acids 1-1213 derived from the S protein (S1+S2 truncated), an E protein, and M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(40) FIG. 6H provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid encoding truncated amino acids 1-1213 derived from the S protein (S1+S2 truncated) with two proline substitutions at amino acids 981 and 982, an E protein, and M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding truncated amino acids 1-1213 derived from the S protein (S1+S2 truncated+K986P and V987P), in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the S (S1+S2 truncated+K986P and V987P) protein sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the S protein (S1+S2 truncated+K986P and V987P), prior to the stop codon. As exemplified, adjacent to the S protein (S1+S2 truncated+K986P and V987P) is a nucleic acid sequence encoding the full-length E protein, left-to-right orientation, which is operably linked to, for example, a p11 promoter. Similar to the S protein (S1+S2 truncated+K986P and V987P), the E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(41) FIG. 6I-6J-6K is an exemplary rMVA nucleic acid insert of SEQ ID NO: 85 encoding truncated amino acids 1-1213 derived from the S protein (S1+S2 truncated) with two proline substitutions at amino acids 981 and 982, an E protein, and M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(42) FIG. 6L-6M-6N is an exemplary rMVA nucleic acid insert of SEQ ID NO: 86 encoding truncated amino acids 1-1213 derived from the S protein (S1+S2 truncated) with two proline substitutions at amino acids 981 and 982, an E protein, and M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(43) FIG. 7A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a signal glycoprotein (Signal GP)-S protein RBD consensus-glycoprotein transmembrane domain sequence (GP TM) fusion protein, an E protein, and an M protein inserted between MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus signal glycoprotein (Signal GP), an S protein RBD consensus peptide, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the Signal GP-S RBD consensus-GP TM fusion encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the signal peptide encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the Signal GP-S RBD consensus-GP TM fusion, prior to the stop codon. As exemplified, adjacent to the Signal GP-S RBD consensus-GP TM fusion encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left-to-right orientation, which is operably linked to, for example, a p11 promoter. The E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between, for example, MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a mH5 promoter (pmH5). Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(44) FIG. 7B provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a signal glycoprotein (Signal GP)-S protein RBD (aa 331-524) consensus-glycoprotein transmembrane domain sequence (GP TM) fusion protein, an E protein, and an M protein inserted between MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus signal glycoprotein (Signal GP), an S protein RBD (aa 331-524) consensus peptide, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the Signal GP-S RBD (aa 331-524) consensus-GP TM fusion encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the signal peptide encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the Signal GP-S RBD (aa 331-524) consensus-GP TM fusion, prior to the stop codon. As exemplified, adjacent to the Signal GP-S RBD (aa 331-524) consensus-GP TM fusion encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left-to-right orientation, which is operably linked to, for example, a p11 promoter. The E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between, for example, MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a mH5 promoter (pmH5). Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(45) FIG. 7C-7D is an exemplary rMVA nucleic acid insert of SEQ ID NO: 103 encoding a signal glycoprotein (Signal GP)-S protein RBD (aa 331-524) consensus-glycoprotein transmembrane domain sequence (GP TM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(46) FIG. 7E-7F is an exemplary rMVA nucleic acid insert of SEQ ID NO: 104 encoding a signal glycoprotein (Signal GP)-S protein RBD (aa 331-524) consensus-glycoprotein transmembrane domain sequence (GP TM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(47) FIG. 7G provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a signal glycoprotein (Signal GP)-S protein RBD (aa 327-524) consensus-glycoprotein transmembrane domain sequence (GP TM) fusion protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus signal glycoprotein (Signal GP), an S protein RBD (aa 327-524) consensus peptide, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the Signal GP-S RBD (aa 327-524) consensus-GP TM fusion encoding nucleic acid. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the signal peptide encoding sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the Signal GP-S RBD (aa 327-524) consensus-GP TM fusion, prior to the stop codon. As exemplified, adjacent to the Signal GP-S RBD (aa 327-524) consensus-GP TM fusion encoding sequence is a nucleic acid sequence encoding the full-length E protein, in a left-to-right orientation, which is operably linked to, for example, a p11 promoter. The E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between, for example, MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a mH5 promoter (pmH5). Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(48) FIG. 7H-7I is an exemplary rMVA nucleic acid insert of SEQ ID NO: 101 encoding a signal glycoprotein (Signal GP)-S protein RBD (aa 327-524) consensus-glycoprotein transmembrane domain sequence (GP TM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(49) FIG. 7J-7K is an exemplary rMVA nucleic acid insert of SEQ ID NO: 102 encoding a signal glycoprotein (Signal GP)-S protein RBD (aa 327-524) consensus-glycoprotein transmembrane domain sequence (GP TM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(50) FIG. 8A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-tandem repeat of S protein RBD derived amino acid-transmembrane domain of the glycoprotein (GP TM) fusion protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), S RBD tandem repeat ((aa504-524)-GPGPG-(aa473-490)-GPGPG) 5, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the Signal GP MARV-S RBD tandem repeat-GP TM fusion encoding sequence. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S RBD tandem repeat-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. As exemplified, adjacent to the fusion protein is a nucleic acid sequence encoding the full-length E protein, in the left to right orientation, which is operably linked to, for example, a p11 promoter. Similar to the fusion protein, the E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between, for example, MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a mH5 promoter (pmH5). Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(51) FIG. 8B-8C is an exemplary rMVA nucleic acid insert of SEQ ID NO: 111 encoding a glycoprotein (Signal GP MARV)-tandem repeat of S protein RBD derived amino acid-transmembrane domain of the glycoprotein (GP TM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, linker sequences, and c-tag sequences.

(52) FIG. 8D-8E is an exemplary rMVA nucleic acid insert of SEQ ID NO: 112 encoding a glycoprotein (Signal GP MARV)-tandem repeat of S protein RBD derived amino acid-transmembrane domain of the glycoprotein (GP TM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, linker sequences, and c-tag sequences.

(53) FIG. 9A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-truncated amino acids 2-1213 derived from the S protein (S1+S2 truncated)-transmembrane domain of the glycoprotein (GP TM) fusion protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), the S protein (S1+S2 truncated), and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the Signal GP MARV-S protein truncated (S1+S2 truncated)-GP TM fusion encoding sequence. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S protein (S1+S2 truncated)-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. As exemplified, adjacent to the fusion protein is a nucleic acid sequence encoding the full-length E protein, in the left to right orientation, which is operably linked to, for example, a p11 promoter. Similar to the fusion protein, the E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between, for example, MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a mH5 promoter (pmH5). Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(54) FIG. 9B-9C-9D is an exemplary rMVA nucleic acid insert of SEQ ID NO: 119 encoding a glycoprotein (Signal GP MARV)-truncated amino acids 2-1213 derived from the S protein (S1+S2 truncated)-transmembrane domain of the glycoprotein (GP TM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(55) FIG. 9E-9F-9G is an exemplary rMVA nucleic acid insert of SEQ ID NO: 120 encoding a glycoprotein (Signal GP MARV)-truncated amino acids 2-1213 derived from the S protein (S1+S2 truncated)-transmembrane domain of the glycoprotein (GP TM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(56) FIG. 9H provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-truncated amino acids 2-1213 derived from the S protein (S1+S2 truncated+K986P and V987P)-transmembrane domain of the glycoprotein (GP TM) fusion protein, an E protein, and an M protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), the S protein (S1+S2 truncated+K986P and V987P), and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the Signal GP MARV-S protein truncated (S1+S2 truncated+K986P and V987P)-GP TM fusion encoding sequence. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S protein (S1+S2 truncated+K986P and V987P)-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. As exemplified, adjacent to the fusion protein is a nucleic acid sequence encoding the full-length E protein, in the left to right orientation, which is operably linked to, for example, a p11 promoter. Similar to the fusion protein, the E protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, the insert further includes a nucleic acid sequence encoding a full-length M protein. As exemplified, the M protein coding sequence is oriented in a right-to-left orientation, wherein the 3 end of the E protein coding sequence is adjacent to the 3 end of the M protein coding sequence. As exemplified, the M protein coding sequence is operably linked to a mH5 promoter (pmH5). The M protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between, for example, MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a mH5 promoter (pmH5). Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(57) FIG. 9I-9J-9K is an exemplary rMVA nucleic acid insert of SEQ ID NO: 121 encoding a glycoprotein (Signal GP MARV)-truncated amino acids 2-1213 derived from the S protein (S1+S2 truncated+K986P and V987P)-transmembrane domain of the glycoprotein (GP TM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(58) FIG. 9L-9M-9N is an exemplary rMVA nucleic acid insert of SEQ ID NO: 122 encoding a glycoprotein (Signal GP MARV)-truncated amino acids 2-1213 derived from the S protein (S1+S2 truncated+K986P and V987P)-transmembrane domain of the glycoprotein (GP TM) fusion protein, an E protein, and an M protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(59) FIG. 10A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-S protein truncated S1+S2-transmembrane domain of the glycoprotein (GP TM) fusion protein inserted between MVA genes A5R and A6L, and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted between MVA genes A50R and B1R. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), truncated amino acids 2-1213 derived from the S protein (S1+S2 truncated), and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the Signal GP MARV-S protein (S1+S2 truncated)-GP TM fusion encoding nucleic acid in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S protein (S1+S2 truncated)-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a pmH5 promoter. Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(60) FIG. 10B-10C is an exemplary rMVA nucleic acid insert of SEQ ID NO: 123 encoding a glycoprotein (Signal GP MARV)-S protein truncated S1+S2-transmembrane domain of the glycoprotein (GP TM) fusion protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(61) FIG. 10D-10E is an exemplary rMVA nucleic acid insert of SEQ ID NO: 124 encoding a glycoprotein (Signal GP MARV)-S protein truncated S1+S2-transmembrane domain of the glycoprotein (GP TM) fusion protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(62) FIG. 10F provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-S protein S1+S2 truncated+K986P and V987P-transmembrane domain of the glycoprotein (GP TM) fusion protein inserted between MVA genes A5R and A6L, and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted between MVA genes A50R and B1R. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), truncated amino acids 2-1213 derived from the S protein (S1+S2 truncated) plus two proline substitutions at amino acids 981 and 982, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the Signal GP MARV-S protein (S1+S2 truncated)-GP TM fusion encoding nucleic acid in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S protein (S1+S2 truncated+K986P and V987P)-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between, for example, MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a pmH5 promoter. Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(63) FIG. 10G-10H is an exemplary rMVA nucleic acid insert of SEQ ID NO: 125 encoding a glycoprotein (Signal GP MARV)-S protein S1+S2 truncated+K986P and V987P-transmembrane domain of the glycoprotein (GP TM) fusion protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(64) FIG. 10I-10J is an exemplary rMVA nucleic acid insert of SEQ ID NO: 126 encoding a glycoprotein (Signal GP MARV)-S protein S1+S2 truncated+K986P and V987P-transmembrane domain of the glycoprotein (GP TM) fusion protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(65) FIG. 10K provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-S protein truncated S1+S2-transmembrane domain of the glycoprotein (GP TM) fusion protein and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), truncated amino acids 2-1213 derived from the S protein (S1+S2 truncated), and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the Signal GP MARV-S protein (S1+S2 truncated)-GP TM fusion encoding nucleic acid in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S protein (S1+S2 truncated)-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is also inserted as, for example, a bicistronic sequence. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a pmH15 promoter and is oriented in a 3 to 5 orientation. Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(66) FIG. 10L-10M-10N is an exemplary rMVA nucleic acid insert of SEQ ID NO: 127 encoding a glycoprotein (Signal GP MARV)-S protein truncated S1+S2-transmembrane domain of the glycoprotein (GP TM) fusion protein and the MARC VP40 protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(67) FIG. 10O-10P-10Q is an exemplary rMVA nucleic acid insert of SEQ ID NO: 128 encoding a glycoprotein (Signal GP MARV)-S protein truncated S1+S2-transmembrane domain of the glycoprotein (GP TM) fusion protein and the MARC VP40 protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(68) FIG. 10R provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-S protein truncated S1+S2 plus two proline substitutions at amino acids 981 and 982-transmembrane domain of the glycoprotein (GP TM) fusion protein and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), truncated amino acids 2-1213 derived from the S protein (S1+S2 truncated+K986P and V987P), and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the Signal GP MARV-S protein (S1+S2 truncated+K986P and V987P)-GP TM fusion encoding nucleic acid in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S protein (S1+S2 truncated+K986P and V987P)-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is also inserted as, for example, a bicistronic sequence. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a pmH5 promoter and is oriented in a 3 to 5 orientation. Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(69) FIG. 10S-10T-10U is an exemplary rMVA nucleic acid insert of SEQ ID NO: 129 encoding a glycoprotein (Signal GP MARV)-S protein truncated S1+S2 plus two proline substitutions at amino acids 981 and 982-transmembrane domain of the glycoprotein (GP TM) fusion protein and the MARC VP40 protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(70) FIG. 10V-10W-10X is an exemplary rMVA nucleic acid insert of SEQ ID NO: 130 encoding a glycoprotein (Signal GP MARV)-S protein truncated S1+S2 plus two proline substitutions at amino acids 981 and 982-transmembrane domain of the glycoprotein (GP TM) fusion protein and the MARC VP40 protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, SmaI restriction site, start codons, Kozak regulatory sequences, and c-tag sequences.

(71) FIG. 11A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-S protein RDB-transmembrane domain of the glycoprotein (GPTM) fusion protein inserted between MVA genes A5R and A6L, and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted between MVA genes A50R and B1R. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), S protein RBD region, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the glycoprotein-S RBD fusion encoding nucleic acid in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S RBD-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a pmH5 promoter. Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(72) FIG. 11B provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-S protein RDB (331-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein inserted between MVA genes A5R and A6L, and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted between MVA genes A50R and B1R. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), S protein RBD (331-524) region, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the glycoprotein-S RBD (331-524) fusion encoding nucleic acid in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S RBD (331-524)-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a pmH5 promoter. Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(73) FIG. 11C is an exemplary rMVA nucleic acid insert of SEQ ID NO: 133 encoding a glycoprotein (Signal GP MARV)-S protein RDB (331-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(74) FIG. 11D is an exemplary rMVA nucleic acid insert of SEQ ID NO: 134 encoding a glycoprotein (Signal GP MARV)-S protein RDB (331-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, Smal restriction site, and c-tag sequences.

(75) FIG. 11E provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-S protein RDB (327-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein inserted between MVA genes A5R and A6L, and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted between MVA genes A50R and B1R. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), S protein RBD (327-524) region, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the glycoprotein-S RBD (327-524) fusion encoding nucleic acid in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S RBD (327-524)-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a pmH5 promoter. Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(76) FIG. 11F is an exemplary rMVA nucleic acid insert of SEQ ID NO: 131 encoding a glycoprotein (Signal GP MARV)-S protein RDB (327-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(77) FIG. 11G is an exemplary rMVA nucleic acid insert of SEQ ID NO: 132 encoding a glycoprotein (Signal GP MARV)-S protein RDB (327-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, SmaI restriction site, and c-tag sequences.

(78) FIG. 11H provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a bicistronic nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-S protein RDB-transmembrane domain of the glycoprotein (GP TM) fusion protein and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted, for example, between MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), S protein RBD region, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the glycoprotein-S RBD fusion encoding nucleic acid in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S RBD-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. In addition, the bicistronic nucleic acid sequence also encodes a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a pmH5 promoter. Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(79) FIG. 11I provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a bicistronic nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-S protein RDB (aa 331-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted, for example, between MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), S protein RBD (aa 331-524) region, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the glycoprotein-S RBD fusion encoding nucleic acid in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S RBD (aa 331-524)-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. In addition, the bicistronic nucleic acid sequence also encodes a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a pmH5 promoter. Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(80) FIG. 11J-11K is an exemplary rMVA nucleic acid insert of SEQ ID NO: 137 encoding a glycoprotein (Signal GP MARV)-S protein RDB (aa 331-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein and the MARV VP40 protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(81) FIG. 11L-11M is an exemplary rMVA nucleic acid insert of SEQ ID NO: 138 encoding a glycoprotein (Signal GP MARV)-S protein RDB (aa 331-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein and the MARV VP40 protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, SmaI restriction site, and c-tag sequences

(82) FIG. 11N provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a bicistronic nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-S protein RDB (aa 327-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted, for example, between MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), S protein RBD (aa 327-524) region, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the glycoprotein-S RBD fusion encoding nucleic acid in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S RBD (aa 327-524)-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. In addition, the bicistronic nucleic acid sequence also encodes a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a pmH5 promoter. Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(83) FIG. 11O-11P is an exemplary rMVA nucleic acid insert of SEQ ID NO: 135 encoding a glycoprotein (Signal GP MARV)-S protein RDB (aa 327-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein and the MARV VP40 protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(84) FIG. 11Q-11R is an exemplary rMVA nucleic acid insert of SEQ ID NO: 136 encoding a glycoprotein (Signal GP MARV)-S protein RDB (aa 327-524)-transmembrane domain of the glycoprotein (GP TM) fusion protein and the MARV VP40 protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, SmaI restriction site, and c-tag sequences.

(85) FIG. 12A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-tandem repeat of S protein RBD derived amino acid-transmembrane domain of the glycoprotein (GP TM) fusion protein inserted between MVA genes A5R and A6L, and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted between MVA genes A50R and B1R. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), S RBD tandem repeat ((aa504-524)-GPGPG-(aa473-490)-GPGPG) 5, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the Signal GP MARV-S RBD tandem repeat-GP TM fusion encoding sequence. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S RBD tandem repeat-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. As exemplified, a nucleic acid sequence encoding a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40, is inserted between MVA genes A50R and B1R. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a mH5 promoter (pmH5). Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(86) FIG. 12B is an exemplary rMVA nucleic acid insert of SEQ ID NO: 139 encoding a glycoprotein (Signal GP MARV)-tandem repeat of S protein RBD derived amino acid-transmembrane domain of the glycoprotein (GP TM) fusion protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences

(87) FIG. 12C is an exemplary rMVA nucleic acid insert of SEQ ID NO: 140 encoding a glycoprotein (Signal GP MARV)-tandem repeat of S protein RBD derived amino acid-transmembrane domain of the glycoprotein (GP TM) fusion protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, SmaI restriction site, and c-tag sequences

(88) FIG. 12D provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a bicistronic nucleic acid sequence encoding a glycoprotein (Signal GP MARV)-S protein RBD tandem repeat ((aa504-524)-GPGPG-(aa473-490)-GPGPG) 5)-transmembrane domain of the glycoprotein (GP TM) fusion protein and a nucleic acid sequence encoding a non-coronavirus matrix protein inserted, for example, between MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding a fusion protein, wherein the fusion protein includes a signal peptide from a non-coronavirus glycoprotein (Signal GP MARV), S protein RBD tandem repeat ((aa504-524)-GPGPG-(aa473-490)-GPGPG) 5) region, and a transmembrane domain of the glycoprotein (GP TM), in a left-to-right orientation. A start codon is provided 5 to the glycoprotein-S RBD fusion encoding nucleic acid in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the Signal GP MARV-S protein RBD tandem repeat ((aa504-524)-GPGPG-(aa473-490)-GPGPG) 5)-GP TM fusion sequence. In addition, a nucleic acid sequence encoding a tag, for example a C-affinity tag, may be included at the 3 terminus of the fusion protein, prior to the stop codon. In addition, the bicistronic nucleic acid sequence also encodes a non-coronavirus matrix protein, for example Marburgvirus matrix protein VP40. The nucleic acid sequence encoding the matrix protein is operably linked to, for example, a pmH5 promoter. Similar to the fusion protein, the matrix protein nucleic acid sequence can also include appropriate translation initiation sequences such as a Kozak sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(89) FIG. 12E-12F is an exemplary rMVA nucleic acid insert of SEQ ID NO: 141 encoding a glycoprotein (Signal GP MARV)-S protein RBD tandem repeat ((aa504-524)-GPGPG-(aa473-490)-GPGPG) 5)-transmembrane domain of the glycoprotein (GP TM) fusion protein and the MARV VP40 protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(90) FIG. 12G-12H is an exemplary rMVA nucleic acid insert of SEQ ID NO: 142 encoding a glycoprotein (Signal GP MARV)-S protein RBD tandem repeat ((aa504-524)-GPGPG-(aa473-490)-GPGPG) 5)-transmembrane domain of the glycoprotein (GP TM) fusion protein and the MARV VP40 protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, SmaI restriction site, and c-tag sequences.

(91) FIG. 13A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid encoding a full-length S protein inserted between MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding the full-length SARS-CoV2 S protein in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the S protein sequence as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(92) FIG. 13B-13C is an exemplary rMVA nucleic acid insert of SEQ ID NO: 143 encoding a full-length S protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(93) FIG. 13D-13E is an exemplary rMVA nucleic acid insert of SEQ ID NO: 144 encoding a full-length S protein. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, SmaI restriction site, and c-tag sequences.

(94) FIG. 14A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding a stabilized S protein inserted between MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding the full-length SARS-CoV2 S stabilized protein in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the S stabilized protein sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(95) FIG. 14B-14C is an exemplary rMVA nucleic acid insert of SEQ ID NO: 145 encoding a full-length a stabilized S protein plus two proline substitutions at amino acids 981 and 982. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(96) FIG. 14D-14E is an exemplary rMVA nucleic acid insert of SEQ ID NO: 146 encoding a full-length a stabilized S protein plus two proline substitutions at amino acids 981 and 982. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, SmaI restriction site, and c-tag sequences.

(97) FIG. 15A provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding amino acid 1-1213 truncated S protein (S1+S2 truncated) inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding the full-length SARS-CoV2 S (S1+S2 truncated) protein in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the S (S1+S2 truncated) protein sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(98) FIG. 15B-15C is an exemplary rMVA nucleic acid insert of SEQ ID NO: 147 encoding amino acid 1-1213 truncated S protein (S1+S2 truncated). Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(99) FIG. 15D-15E is an exemplary rMVA nucleic acid insert of SEQ ID NO: 148 encoding amino acid 1-1213 truncated S protein (S1+S2 truncated). Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, SmaI restriction site, and c-tag sequences.

(100) FIG. 15F provides an exemplary linear schematic of an exemplary recombinant MVA viral vector comprising a nucleic acid sequence encoding amino acid 1-1213 truncated S protein (S1+S2 truncated+K986P and V987P) inserted between, for example, MVA genes A5R and A6L. As exemplified, a mH5 promoter (pmH5) is operably linked to a nucleic acid encoding the full-length SARS-CoV2 S (S1+S2 truncated+K986P and V987P) protein in a left-to-right orientation. The insert may include a translation initiation sequence, for example a Kozak sequence, prior to the start codon of the S (S1+S2 truncated+K986P and V987P) protein sequence, as well as a nucleic acid sequence encoding a tag at the 3 terminus of the coding sequence prior to the stop codon.

(101) FIG. 15G-15H is an exemplary rMVA nucleic acid insert of SEQ ID NO: 149 encoding amino acid 1-1213 truncated S protein (S1+S2 truncated) plus two substitutions at K986P and V987P. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, and c-tag sequences.

(102) FIG. 15I-15J is an exemplary rMVA nucleic acid insert of SEQ ID NO: 150 encoding amino acid 1-1213 truncated S protein (S1+S2 truncated) plus two substitutions at K986P and V987P. Also exemplified and identified in the sequence are the vaccinia mH5 promoters, vaccinia P11 promoter, start codons, Kozak regulatory sequences, SmaI restriction site, and c-tag sequences.

(103) FIG. 16 is a picture of an immunocytochemistry assay of CEF cells infected with recombinant MVA construct GEO-CM01 expressing S, M, and E VLPs exposed to a primary mouse-anti-SARS-CoV-2 spike antibody and secondary anti-mouse HRP antibody and developed with AEC peroxidase substrate. Arrows indicate plaques staining positive for S protein expression.

(104) FIG. 17 is a PCR gel showing the amplification of the S protein antigen insert. GEO-CM01 represents recombinant MVA construct GEO-CM01 expressing S, M, and E VLPs; positive control was generated using 50 ng of DNA from the shuttle plasmid used to generate GEO-CM01 (positive control); and the negative control represents the MVA parental strain.

(105) FIG. 18 is a PCR gel showing the amplification of the S protein antigen insert. CM01 viral DNA represents recombinant MVA construct GEO-CM01 expressing S, M, and E VLPs; CM01 plasmid represents a positive control generated using 50 ng of DNA from the shuttle plasmid used to generate GEO-CM01; CM02 viral DNA represents recombinant MVA construct GEO-CM02 expressing stabilized S, M, and E VLPs; CM02 plasmid represents a positive control generated using 50 ng of DNA from the shuttle plasmid used to generate GEO-CM02; CM03 viral DNA represents recombinant MVA construct GEO-CM03 expressing the RBD of the S protein, M, and E VLPs; CM03 plasmid represents a positive control generated using 50 ng of DNA from the shuttle plasmid used to generate GEO-CM03; and the empty MVA DNA represents the MVA parental strain as a negative control.

(106) FIG. 19 is a Western blot of S protein antigen expression in cell lysate and supernatant of DF1 cells infected with recombinant MVA construct GEO-CM01 (Covid M01), GEO-CM02 (Covid M02), and GEO-CM03 (Covid M03), indicating the formation of virus-like particles.

(107) FIG. 20 is an electron microscopic image of the formation of a virus-like particle in GEO-CM01 infected DF1 cells.

(108) FIG. 21 is a schematic of a SARS-CoV2 neutralization assay. Serum from immunized animals was tested for its capacity to neutralize live SARS-CoV-2. Serial dilutions of serum were incubated with SARS-CoV-2 and then level of neutralization was determined by plaque assay.

(109) FIG. 22 is a schematic of an ELISA specific for antibody detection to recombinant Spike-Membrane fusion, Spike, and the receptor binding domain (RBD) of the S protein following immunization of golden hamsters,

(110) FIG. 23 is a schematic of body weight and health scores over time in a SARS-CoV2 post challenge in a prime/boost (GEO-CM01) vs. control test in golden hamsters. P=0.0003 Friendman's test followed by Dunn's multiple comparison test.

(111) FIG. 24 is a shuttle vector map of pAD-1/S-ME.

(112) FIG. 25 is a shuttle vector map of pAD-1/sS-ME.

(113) FIG. 26 is a shuttle vector map of pAD-1/pUC57.

(114) FIG. 27 is a PCR gel showing the amplification of the S protein antigen insert. GEO-CM02 represents recombinant MVA construct GEO-CM02 expressing stabilized S, M, and E VLPs; positive control was generated using 50 ng of DNA from the shuttle plasmid used to generate GEO-CM02 (positive control); and the negative control represents the MVA parental strain.

(115) FIG. 28 is a PCR gel showing the amplification of the RBD antigen insert. GEO-CM03 represents recombinant MVA construct GEO-CM03 expressing stabilized RBD, M, and E VLPs; positive control was generated using 50 ng of DNA from the shuttle plasmid used to generate GEO-CM03 (positive control); and the negative control represents the MVA parental strain. The amplification product from GEO-CM01 is used as a comparative.

(116) FIG. 29 is a PCR gel showing the amplification of the RBD antigen insert of GEO-CM03b represents recombinant MVA construct GEO-CM03b expressing RBD; positive control was generated using 50 ng of DNA from the shuttle plasmid used to generate GEO-CM03b (P=positive control); and the negative control represents the MVA parental strain (M). M=MVA parent; P=pGeo-MTRBD plasmid DNA; Cl.1=MVA-RBDVP40 clone #4/01; Cl.2=MVA-RBDVP40 clone #4/02. The expected PCR fragments are as follows: p53/p54: MVA parent (M)=647 bp; MVA-RBDVP40/GFP-2544 bp (upper arrow); MVA-RBDVP40-1558 bp (upper middle arrow); pGEO-MTRBD-2544 bp. P55/p54=MVA parent (M)=377 bp (lower arrow); MVA-RBDVP40/GFP-1288 bp (lower middle arrow); MVA-RBDVP40-1288 bp (lower middle arrow); pGEO-MTRBD-1288 bp (lower middle arrow).

DETAILED DESCRIPTION

(117) Provided herein are vaccine compositions comprising a recombinant MVA viral vector capable of expressing one or more SARS-CoV2 (2019-novel coronavirus) antigens, fragments thereof, variants thereof, or a combination thereof. The vaccine can be used to protect against SARS-CoV2, thereby treating, preventing, and/or protecting against SARS-CoV2 based pathologies. The vaccine can significantly induce an immune response of a subject administered the vaccine, thereby protecting against and treating SARS-CoV2 infection.

(118) The compositions and methods of the present invention can be used in a therapeutically effective amount to prevent infection in an unexposed person or to treat disease in a subject exposed to SARS-CoV2 in order to lessen the severity of the disease.

(119) In some embodiments, the compositions and methods can be used as a booster vaccine, to increase or modify or alter immune responses induced by a prior SARS-CoV2 vaccine; such as an RNA vaccine or a DNA vaccine or a virus vectored vaccine, such as adenovirus vaccine vectors, or a protein-based vaccine or a vaccine comprised on a killed or inactivated preparation of SARS-CoV2, with or without an adjuvant, or an attenuated SARS-CoV2. In some embodiments, the compositions and methods can be used as a booster vaccine following infection and recovery from SARS-CoV2.

(120) Ideal immunogenic compositions or vaccines have the characteristics of safety, efficacy, scope of protection and longevity. Compositions having fewer than all of these characteristics may still be useful in preventing SARS-CoV2 infection or limiting symptoms or disease progression in an exposed subject treated prior to the development of symptoms. In one embodiment the present invention provides a vaccine that permits at least partial, if not complete, protection after a single immunization.

(121) The vaccine can induce a humoral immune response in the subject administered the vaccine. The induced humoral immune response can be specific for one or more of the rMVA expressed SARS-CoV2 antigenic epitopes or regions that are specific to SARS-CoV2 or conserved epitopes or segments that are also present in other coronaviruses. The induced humoral immune response can be reactive with the one or more expressed SARS-CoV2 antigens.

(122) The humoral immune response induced by the vaccine can include an increased level of neutralizing antibodies associated with the subject administered the vaccine as compared to a subject not administered the vaccine. In addition, the humoral response induced by the vaccine can include an increased level of neutralizing antibodies for those who have been previously infected with SARS-CoV2, wherein the rMVA of the present invention acts as a booster. The humoral response induced by the vaccine can include an increased level of neutralizing antibodies for those who have been previously administered a different SARS-CoV2 vaccine, wherein the rMVA of the present invention acts as a booster. The neutralizing antibodies can be specific for the SARS-CoV2 antigens or fragments thereof expressed by the rMVA viral vector. The neutralizing antibodies can be reactive with the SARS-CoV2 antigens. The neutralizing antibodies can provide protection against and/or treatment of SARS-CoV2 infection and its associated pathologies in the subject administered the vaccine.

(123) The humoral immune response induced by the vaccine can include an increased level of IgG antibodies associated with the subject administered the vaccine as compared to a subject not administered the vaccine. These IgG antibodies can be specific for at least one SARS-CoV2 antigens.

(124) The vaccine can induce a cellular immune response in the subject administered the vaccine. The induced cellular immune response can be specific for the SARS-CoV2 antigens. The induced cellular immune response can be reactive to the SARS-CoV2 antigens. The induced cellular immune response can include eliciting a CD8+ T cell response. The elicited CD8+ T cell response can be reactive with the SARS-CoV2 antigenic epitopes or regions that are specific to SARS-CoV2 or conserved epitopes or segments that are also present in other coronaviruses.

(125) The elicited CD8+ T cell response can be polyfunctional. The induced cellular immune response can include eliciting a CD8+ T cell response, in which the CD8+ T cells produce interferon-gamma (IFN-), tumor necrosis factor alpha (TNF-), interleukin-2 (IL-2), or a combination of IFN- and TNF-.

(126) The induced cellular immune response can include an increased CD8+ T cell response associated with the subject administered the vaccine as compared to the subject not administered the vaccine. The induced cellular immune response can include an increased frequency of CD3+CD8+ T cells that produce IFN-. The induced cellular immune response can include an increased frequency of CD3+CD8+ T cells that produce TNF-. The induced cellular immune response can include an increased frequency of CD3+CD8+ T cells that produce IL-2. The induced cellular immune response can include an increased frequency of CD3+CD8+ T cells that produce both IFN- and TNF-.

(127) The cellular immune response induced by the vaccine can include eliciting a CD4+ T cell response. The elicited CD4+ T cell response can be reactive with the SARS-CoV2 antigens. The elicited CD4+ T cell response can be polyfunctional. The induced cellular immune response can include eliciting a CD4+ T cell response, in which the CD4+ T cells produce IFN-, TNF-, IL-2, or a combination of IFN- and TNF-.

(128) The induced cellular immune response can include an increased frequency of CD3+CD4+ T cells that produce IFN-. The induced cellular immune response can include an increased frequency of CD3+CD4+ T cells that produce TNF-. The induced cellular immune response can include an increased frequency of CD3+CD4+ T cells that produce IL-2. The induced cellular immune response can include an increased frequency of CD3+CD4+ T cells that produce both IFN- and TNF-.

(129) In some embodiments, these increased cellular immune responses described above induced by the vaccine are in subjects who have been previously infected with SARS-CoV2, wherein the rMVA of the present invention acts as a booster. In some embodiments, these increased cellular immune responses described above induced by the vaccine are in subjects who have been previously administered a different SARS-CoV2 vaccine, wherein the rMVA of the present invention acts as a booster.

Definitions

(130) Where a term is provided in the singular, the inventors also contemplate aspects of the invention described by the plural of that term. As used in this specification and in the appended claims, the singular forms a, an, and the include plural references unless the context clearly dictates otherwise, e.g., a peptide includes a plurality of peptides. Thus, for example, a reference to a method includes one or more methods, and/or steps of the type described herein, and/or which will become apparent to those persons skilled in the art upon reading this disclosure.

(131) The term adjuvant as used herein means any molecule added to the vaccine described herein to enhance the immunogenicity of the composition.

(132) The term antigen refers to a substance or molecule, such as a protein, or fragment thereof, that is capable of inducing an immune response.

(133) Coding sequence or encoding nucleic acid or nucleic acid sequence encoding or the like, as used herein means the nucleic acids (RNA or DNA molecule) that comprise a nucleotide sequence which encodes a protein or fragment thereof. The coding sequence can further include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to which the nucleic acid is administered.

(134) The term conservative amino acid substitution refers to substitution of a native amino acid residue with a non-native residue such that there is little or no effect on the size, polarity, charge, hydrophobicity, or hydrophilicity of the amino acid residue at that position, and without resulting in substantially altered immunogenicity. For example, these may be substitutions within the following groups: valine, glycine; glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. Conservative amino acid modifications to the sequence of a polypeptide (and the corresponding modifications to the encoding nucleotides) may produce polypeptides having functional and chemical characteristics similar to those of a parental polypeptide.

(135) The term deletion in the context of a polypeptide or protein refers to removal of codons for one or more amino acid residues from the polypeptide or protein sequence, wherein the regions on either side are joined together. The term deletion in the context of a nucleic acid refers to removal of one or more bases from a nucleic acid sequence, wherein the regions on either side are joined together.

(136) The term fragment in the context of a proteinaceous agent refers to a peptide or polypeptide comprising an amino acid sequence of at least 2 contiguous amino acid residues, at least 5 contiguous amino acid residues, at least 10 contiguous amino acid residues, at least 15 contiguous amino acid residues, at least 20 contiguous amino acid residues, at least 25 contiguous amino acid residues, at least 40 contiguous amino acid residues, at least 50 contiguous amino acid residues, at least 60 contiguous amino residues, at least 70 contiguous amino acid residues, at least 80 contiguous amino acid residues, at least 90 contiguous amino acid residues, at least 100 contiguous amino acid residues, at least 125 contiguous amino acid residues, at least 150 contiguous amino acid residues, at least 175 contiguous amino acid residues, at least 200 contiguous amino acid residues, or at least 250 contiguous amino acid residues of the amino acid sequence of a peptide, polypeptide or protein. In one embodiment the fragment constitutes at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference polypeptide. In one embodiment, a fragment of a full-length protein retains activity of the full-length protein. In another embodiment, the fragment of the full-length protein does not retain the activity of the full-length protein.

(137) The term fragment in the context of a nucleic acid refers to a nucleic acid comprising an nucleic acid sequence of at least 2 contiguous nucleotides, at least 5 contiguous nucleotides, at least 10 contiguous nucleotides, at least 15 contiguous nucleotides, at least 20 contiguous nucleotides, at least 25 contiguous nucleotides, at least 30 contiguous nucleotides, at least 35 contiguous nucleotides, at least 40 contiguous nucleotides, at least 50 contiguous nucleotides, at least 60 contiguous nucleotides, at least 70 contiguous nucleotides, at least contiguous 80 nucleotides, at least 90 contiguous nucleotides, at least 100 contiguous nucleotides, at least 125 contiguous nucleotides, at least 150 contiguous nucleotides, at least 175 contiguous nucleotides, at least 200 contiguous nucleotides, at least 250 contiguous nucleotides, at least 300 contiguous nucleotides, at least 350 contiguous nucleotides, or at least 380 contiguous nucleotides of the nucleic acid sequence encoding a peptide, polypeptide or protein. In one embodiment the fragment constitutes at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid sequence. In a preferred embodiment, a fragment of a nucleic acid encodes a peptide or polypeptide that retains activity of the full-length protein. In another embodiment, the fragment encodes a peptide or polypeptide that of the full-length protein does not retain the activity of the full-length protein.

(138) As used herein, the phrase heterologous sequence refers to any nucleic acid, protein, polypeptide or peptide sequence which is not normally associated in nature with another nucleic acid or protein, polypeptide or peptide sequence of interest.

(139) As used herein, the phrase heterologous nucleic acid insert refers to any nucleic acid sequence that has been or is to be inserted into the recombinant vectors described herein. The heterologous nucleic acid insert may refer to only the gene product encoding sequence or may refer to a sequence comprising a promoter, a gene product encoding sequence (for example membrane (M) protein, envelope (E) protein, spike(S) protein), and any regulatory sequences associated or operably linked therewith.

(140) The term homopolymer stretch refers to a sequence comprising at least four of the same nucleotides uninterrupted by any other nucleotide, e.g., GGGG or TTTTTTT.

(141) The term inducing an immune response means eliciting a humoral response (e.g., the production of antibodies) or a cellular response (e.g., the activation of T cells) directed against one or more SARS-CoV2 proteins or fragments thereof expressed by the rMVA in a subject to which the rMVA has been administered.

(142) The term modified vaccinia Ankara, modified vaccinia Ankara, Modified Vaccinia Ankara, or MVA refers to a highly attenuated strain of vaccinia virus developed by Dr. Anton Mayr by serial passage on chick embryo fibroblast cells; or variants or derivatives thereof. MVA is reviewed in Mayr, A. et al. 1975 Infection 3:6-14.

(143) Nucleic acid or oligonucleotide or polynucleotide as used herein means at least two nucleotides covalently linked together. The depiction of a single strand also defines the sequence of the complementary strand. Thus, a nucleic acid also encompasses the complementary strand of a depicted single strand. Many variants of a nucleic acid can be used for the same purpose as a given nucleic acid. Thus, a nucleic acid also encompasses substantially identical nucleic acids and complements thereof. A single strand provides a probe that can hybridize to a target sequence under stringent hybridization conditions. Thus, a nucleic acid also encompasses a probe that hybridizes under stringent hybridization conditions.

(144) Nucleic acids can be single stranded or double stranded, or can contain portions of both double stranded and single stranded sequence. The nucleic acid can be DNA, both genomic and cDNA, RNA, or a hybrid, where the nucleic acid can contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine. Nucleic acids can be obtained by chemical synthesis methods or by recombinant methods.

(145) Operably linked as used herein means that expression of a gene is under the control of a promoter with which it is spatially connected. A promoter can be positioned 5 (upstream) or 3 (downstream) of a gene under its control. The distance between the promoter and a gene can be approximately the same as the distance between that promoter and the gene it controls in the gene from which the promoter is derived. As is known in the art, variation in this distance can be accommodated without loss of promoter function.

(146) A peptide, protein, or polypeptide as used herein can mean a linked sequence of amino acids and can be natural, synthetic, or a modification or combination of natural and synthetic.

(147) Promoter as used herein means a synthetic or naturally-derived molecule which is capable of conferring, activating or enhancing expression of a nucleic acid in a cell. A promoter can comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of same. A promoter can also comprise distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription.

(148) The term prevent, preventing, and prevention refers to the inhibition of the development or onset of a condition (e.g., a SARS-CoV2 infection), or the prevention of the recurrence, onset, or development of one or more symptoms of a condition in a subject resulting from the administration of a therapy or the administration of a combination of therapies.

(149) The term prophylactically effective amount refers to the amount of a composition (e.g., the recombinant MVA vector or pharmaceutical composition) which is sufficient to result in the prevention of the development, recurrence, or onset of a condition or a symptom thereof (e.g., a SARS-CoV2 infection) or symptom associated therewith or to enhance or improve the prophylactic effect(s) of another therapy.

(150) The term recombinant, with respect to a viral vector, means a vector (e.g., a viral genome) that has been manipulated in vitro, e.g., using recombinant nucleic acid techniques to express heterologous viral nucleic acid sequences.

(151) The term regulatory sequence and regulatory sequences refers collectively to promoter sequences, polyadenylation signals, transcription termination sequences, upstream regulatory domains, origins of replication, internal ribosome entry sites (IRES), enhancers, and the like, which collectively provide for the transcription and translation of a coding sequence. Not all of these control sequences need always be present so long as the selected gene is capable of being transcribed and translated.

(152) The term shuttle vector refers to a genetic vector (e.g., a DNA plasmid) that is useful for transferring genetic material from one host system into another. A shuttle vector can replicate alone (without the presence of any other vector) in at least one host (e.g., E. coli). In the context of MVA vector construction, shuttle vectors are usually DNA plasmids that can be manipulated in E. coli and then introduced into cultured cells infected with MVA vectors, resulting in the generation of new recombinant MVA vectors.

(153) The term silent mutation means a change in a nucleotide sequence that does not cause a change in the primary structure of the protein encoded by the nucleotide sequence, e.g., a change from AAA (encoding lysine) to AAG (also encoding lysine).

(154) The term subject means any mammal, including but not limited to, humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, rats, mice, guinea pigs and the like. Determination of those subjects at risk can be made by any objective or subjective determination by a diagnostic test or opinion of a subject or health care provider (e.g., genetic test, enzyme or protein marker, marker history, and the like).

(155) The term synonymous codon refers to the use of a codon with a different nucleic acid sequence to encode the same amino acid, e.g., AAA and AAG (both of which encode lysine). Codon optimization changes the codons for a protein to the synonymous codons that are most frequently used by a vector or a host cell.

(156) The term therapeutically effective amount means the amount of the composition (e.g., the recombinant MVA vector or pharmaceutical composition) that, when administered to a mammal for preventing or treating a virus, is sufficient to affect such prevention or treatment of the virus.

(157) The term treating or treat refer to the eradication or control of a SARS-CoV2 infection, the reduction or amelioration of the progression, severity, and/or duration of a condition or one or more symptoms caused by the virus resulting from the administration of one or more therapies.

(158) The term vaccine means material used to provoke an immune response and confer immunity after administration of the material to a subject. Such immunity may include a cellular or humoral immune response that occurs when the subject is exposed to the immunogen after vaccine administration.

(159) The term vaccine insert refers to a nucleic acid sequence encoding a heterologous sequence that is operably linked to a promoter for expression when inserted into a recombinant vector. The heterologous sequence may encode a glycoprotein or matrix protein described herein.

(160) The term virus-like particles or VLP refers to a structure which resembles a virus but is not infectious because it does not contain viral genetic material.

(161) For the recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.

(162) SARS-CoV2 Antigens

(163) Provided herein are recombinant modified vaccinia Ankara (rMVA) viral vectors comprising heterologous nucleic acid inserts encoding one or more SARS-CoV2 proteins, peptides, or fragments thereof, operably linked to a promoter compatible with poxvirus expression systems that, upon expression, are capable of inducing protective immunity without inducing the immuno-pathologies associated with previous MVA-related coronavirus vaccination strategies.

(164) Coronaviruses belong to the family Coronaviridae in the order Nidovirales and are a large family of single-stranded enveloped RNA viruses. They can be classified into four genera: Alphacoronavirus, Betacoronavirus, Gammacoronavirus, and Deltacoronavirus (Perlman & Netland, Coronaviruses post-SARS: update on replication and pathogenesis. Nature Reviews Microbiology 2009; 7:439-450). The SARS-CoV2 belongs to the Betacoronavirus-genus, which also includes SARS-CoV, MERS-CoV, bat coronavirus HKU4, mouse hepatitis coronavirus (MHV), bovine coronavirus (BCoV), and human coronavirus OC43.

(165) Coronaviruses have the largest genome among all RNA viruses, typically ranging from 27 to 32 kb. The genome is packed inside a helical capsid formed by the nucleocapsid protein (N) and further surrounded by an envelope. Associated with the viral envelope are at least three structural proteins: The membrane protein (M) and the envelope protein (E) are involved in virus assembly, whereas the spike protein(S) mediates virus entry into host cells. Among these structural proteins, the spike forms large protrusions from the virus surface, giving coronaviruses the appearance of having crowns (hence their name; corona in Latin means crown). In addition to mediating virus entry, the spike is a critical determinant of viral host range and tissue tropism and a major inducer of host immune responses.

(166) The complete genome of the SARS-CoV2 has been sequenced, and has been assigned GenBank accession number MN908947.3. It consists of a single-stranded RNA sequence that is 29,903 base pairs. To date, 10 open reading frames (ORFs) have been identified, including genes encoding a structural membrane (M) protein, envelope (E) protein, and a spike(S) protein.

(167) Spike(S) Protein

(168) An envelope-anchored spike protein mediates coronavirus entry into host cells by first binding to a host receptor and then fusing viral and host membranes (Li F. 2016. Structure, Function, and Evolution of Coronavirus Spike Proteins. Annu Rev Virol 3:237-261). A defined receptor-binding domain (RBD) of SARS-CoV spike specifically recognizes its host receptor angiotensin-converting enzyme 2 (ACE2) (Li et al., 2003. Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus. Nature 426:450-454). The overall sequence similarities between SARS-CoV2 spike and SARS-CoV spike are around 76%-78% for the whole protein, around 73%-76% for the RBD, and 50%-53% for the receptor binding motif (RBM), with the similarities between the two S proteins indicating the likelihood that ACE2 is the receptor for SARS-CoV2. See Wan et al., Receptor recognition by novel coronavirus from Wuhan: An analysis based on decade-long structural studies of SARS, J. Virol. doi: 10.1128/JVI.00127-20.

(169) The coronavirus spike contains three segments: a large ectodomain, a single-pass transmembrane anchor, and a short intracellular tail. The ectodomain consists of a receptor-binding subunit S1 and a membrane-fusion subunit S2. Electron microscopy studies revealed that the spike is a clove-shaped trimer with three S1 heads and a trimeric S2 stalk. See, e.g., Kirchdoerfer et al., Pre-fusion structure of a human coronavirus spike protein. Nature. 2016 Mar. 3; 531 (7592): 118-21. During virus entry, S1 binds to a receptor on the host cell surface for viral attachment, and S2 fuses the host and viral membranes, allowing viral genomes to enter host cells. Receptor binding and membrane fusion are the initial and critical steps in the coronavirus infection cycle.

(170) The amino acid sequence of the SARS-CoV2 spike(S) protein is 1273 amino acids in length. The S protein has been reported at GenBank Accession No. QHD43416, and is reproduced in Table 1 as SEQ ID NO: 1, along with its corresponding nucleic acid sequence (SEQ ID NO: 2), which has been reported at GenBank Accession No. MN908947.3, and is located at nucleic acids 21563-25384 of the SARS-CoV2 genome. In some embodiments, the rMVA comprises a nucleic acid sequence encoding SEQ ID NO: 1, or an amino acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the nucleic acid for the full-length S protein inserted into the MVA viral vector has been optimized, as described below and for example, as provided in SEQ ID NO: 3, or a nucleic acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In certain embodiments, an additional nucleic acid sequence encoding a tag may be included in the nucleic acid sequence to be inserted into the rMVA, so that the tag is expressed at the C-terminus of the protein. In some embodiments, the nucleic acid sequence (GAGCCAGAGGCT) (SEQ ID NO: 4) encodes for the high affinity C-tag having the amino acid sequence EPEA (SEQ ID NO: 5).

(171) TABLE-US-00001 TABLE1 SARS-CoV2SpikeProtein SEQIDNO:1- MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFL SARS-CoV2full- PFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDS lengthSprotein KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNC TFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSA LEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLK YNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNL CPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDL CFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKV GGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTN GVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTES NKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVL YQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPI GAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVT TEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNT QEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIK QYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGA GAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASAL GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGR LQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQ SAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRN FYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDV DLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGF IAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT SEQIDNO:2- ATGTTTGTTTTTCTTGTTTTATTGCCACTAGTCTCTAGTCAGTGTGTTAATCTTA SARS-CoV2nucleic CAACCAGAACTCAATTACCCCCTGCATACACTAATTCTTTCACACGTGGTGTT acidsequencefor TATTACCCTGACAAAGTTTTCAGATCCTCAGTTTTACATTCAACTCAGGACTTG fulllengthSprotein TTCTTACCTTTCTTTTCCAATGTTACTTGGTTCCATGCTATACATGTCTCTGGGA CCAATGGTACTAAGAGGTTTGATAACCCTGTCCTACCATTTAATGATGGTGTT TATTTTGCTTCCACTGAGAAGTCTAACATAATAAGAGGCTGGATTTTTGGTAC TACTTTAGATTCGAAGACCCAGTCCCTACTTATTGTTAATAACGCTACTAATGT TGTTATTAAAGTCTGTGAATTTCAATTTTGTAATGATCCATTTTTGGGTGTTTA TTACCACAAAAACAACAAAAGTTGGATGGAAAGTGAGTTCAGAGTTTATTCT AGTGCGAATAATTGCACTTTTGAATATGTCTCTCAGCCTTTTCTTATGGACCTT GAAGGAAAACAGGGTAATTTCAAAAATCTTAGGGAATTTGTGTTTAAGAATA TTGATGGTTATTTTAAAATATATTCTAAGCACACGCCTATTAATTTAGTGCGTG ATCTCCCTCAGGGTTTTTCGGCTTTAGAACCATTGGTAGATTTGCCAATAGGT ATTAACATCACTAGGTTTCAAACTTTACTTGCTTTACATAGAAGTTATTTGACT CCTGGTGATTCTTCTTCAGGTTGGACAGCTGGTGCTGCAGCTTATTATGTGGGT TATCTTCAACCTAGGACTTTTCTATTAAAATATAATGAAAATGGAACCATTAC AGATGCTGTAGACTGTGCACTTGACCCTCTCTCAGAAACAAAGTGTACGTTGA AATCCTTCACTGTAGAAAAAGGAATCTATCAAACTTCTAACTTTAGAGTCCAA CCAACAGAATCTATTGTTAGATTTCCTAATATTACAAACTTGTGCCCTTTTGGT GAAGTTTTTAACGCCACCAGATTTGCATCTGTTTATGCTTGGAACAGGAAGAG AATCAGCAACTGTGTTGCTGATTATTCTGTCCTATATAATTCCGCATCATTTTC CACTTTTAAGTGTTATGGAGTGTCTCCTACTAAATTAAATGATCTCTGCTTTAC TAATGTCTATGCAGATTCATTTGTAATTAGAGGTGATGAAGTCAGACAAATCG CTCCAGGGCAAACTGGAAAGATTGCTGATTATAATTATAAATTACCAGATGAT TTTACAGGCTGCGTTATAGCTTGGAATTCTAACAATCTTGATTCTAAGGTTGGT GGTAATTATAATTACCTGTATAGATTGTTTAGGAAGTCTAATCTCAAACCTTTT GAGAGAGATATTTCAACTGAAATCTATCAGGCCGGTAGCACACCTTGTAATG GTGTTGAAGGTTTTAATTGTTACTTTCCTTTACAATCATATGGTTTCCAACCCA CTAATGGTGTTGGTTACCAACCATACAGAGTAGTAGTACTTTCTTTTGAACTTC TACATGCACCAGCAACTGTTTGTGGACCTAAAAAGTCTACTAATTTGGTTAAA AACAAATGTGTCAATTTCAACTTCAATGGTTTAACAGGCACAGGTGTTCTTAC TGAGTCTAACAAAAAGTTTCTGCCTTTCCAACAATTTGGCAGAGACATTGCTG ACACTACTGATGCTGTCCGTGATCCACAGACACTTGAGATTCTTGACATTACA CCATGTTCTTTTGGTGGTGTCAGTGTTATAACACCAGGAACAAATACTTCTAA CCAGGTTGCTGTTCTTTATCAGGATGTTAACTGCACAGAAGTCCCTGTTGC TATTCATGCAGATCAACTTACTCCTACTTGGCGTGTTTATTCTACAGGTTCTAA TGTTTTTCAAACACGTGCAGGCTGTTTAATAGGGGCTGAACATGTCAACAACT CATATGAGTGTGACATACCCATTGGTGCAGGTATATGCGCTAGTTATCAGACT CAGACTAATTCTCCTCGGCGGGCACGTAGTGTAGCTAGTCAATCCATCATTGC CTACACTATGTCACTTGGTGCAGAAAATTCAGTTGCTTACTCTAATAACTCTAT TGCCATACCCACAAATTTTACTATTAGTGTTACCACAGAAATTCTACCAGTGT CTATGACCAAGACATCAGTAGATTGTACAATGTACATTTGTGGTGATTCAACT GAATGCAGCAATCTTTTGTTGCAATATGGCAGTTTTTGTACACAATTAAACCG TGCTTTAACTGGAATAGCTGTTGAACAAGACAAAAACACCCAAGAAGTTTTTG CACAAGTCAAACAAATTTACAAAACACCACCAATTAAAGATTTTGGTGGTTTT AATTTTTCACAAATATTACCAGATCCATCAAAACCAAGCAAGAGGTCATTTAT TGAAGATCTACTTTTCAACAAAGTGACACTTGCAGATGCTGGCTTCATCAAAC AATATGGTGATTGCCTTGGTGATATTGCTGCTAGAGACCTCATTTGTGCACAA AAGTTTAACGGCCTTACTGTTTTGCCACCTTTGCTCACAGATGAAATGATTGCT CAATACACTTCTGCACTGTTAGCGGGTACAATCACTTCTGGTTGGACCTTTGG TGCAGGTGCTGCATTACAAATACCATTTGCTATGCAAATGGCTTATAGGTTTA ATGGTATTGGAGTTACACAGAATGTTCTCTATGAGAACCAAAAATTGATTGCC AACCAATTTAATAGTGCTATTGGCAAAATTCAAGACTCACTTTCTTCCACAGC AAGTGCACTTGGAAAACTTCAAGATGTGGTCAACCAAAATGCACAAGCTTTA AACACGCTTGTTAAACAACTTAGCTCCAATTTTGGTGCAATTTCAAGTGTTTTA AATGATATCCTTTCACGTCTTGACAAAGTTGAGGCTGAAGTGCAAATTGATAG GTTGATCACAGGCAGACTTCAAAGTTTGCAGACATATGTGACTCAACAATTAA TTAGAGCTGCAGAAATCAGAGCTTCTGCTAATCTTGCTGCTACTAAAATGTCA GAGTGTGTACTTGGACAATCAAAAAGAGTTGATTTTTGTGGAAAGGGCTATCA TCTTATGTCCTTCCCTCAGTCAGCACCTCATGGTGTAGTCTTCTTGCATGTGAC TTATGTCCCTGCACAAGAAAAGAACTTCACAACTGCTCCTGCCATTTGTCATG ATGGAAAAGCACACTTTCCTCGTGAAGGTGTCTTTGTTTCAAATGGCACACAC TGGTTTGTAACACAAAGGAATTTTTATGAACCACAAATCATTACTACAGACAA CACATTTGTGTCTGGTAACTGTGATGTTGTAATAGGAATTGTCAACAACACAG TTTATGATCCTTTGCAACCTGAATTAGACTCATTCAAGGAGGAGTTAGATAAA TATTTTAAGAATCATACATCACCAGATGTTGATTTAGGTGACATCTCTGGCAT TAATGCTTCAGTTGTAAACATTCAAAAAGAAATTGACCGCCTCAATGAGGTTG CCAAGAATTTAAATGAATCTCTCATCGATCTCCAAGAACTTGGAAAGTATGAG CAGTATATAAAATGGCCATGGTACATTTGGCTAGGTTTTATAGCTGGCTTGAT TGCCATAGTAATGGTGACAATTATGCTTTGCTGTATGACCAGTTGCTGTAGTT GTCTCAAGGGCTGTTGTTCTTGTGGATCCTGCTGCAAATTTGATGAAGACGAC TCTGAGCCAGTGCTCAAAGGAGTCAAATTACATTACACA SEQIDNO:3- ATGTTCGTGTTCCTAGTCCTACTACCGCTAGTCTCTTCTCAGTGTGTAAACCTA SARS-CoV2 ACAACGAGAACACAACTACCACCGGCGTACACCAATTCTTTCACAAGAGGAG optimizednucleic TATATTACCCGGACAAGGTGTTCAGATCCTCCGTACTACATTCTACACAGGAC acidsequencefor CTATTCCTACCGTTCTTCTCTAACGTAACATGGTTCCACGCGATCCATGTCTCT fulllengthSprotein GGAACAAACGGAACGAAGAGATTCGATAACCCGGTCTTGCCGTTCAACGATG GTGTATACTTTGCGTCCACCGAGAAGTCCAACATCATCAGAGGATGGATCTTC GGAACCACCTTGGATTCTAAGACCCAGTCCTTGCTAATCGTCAACAACGCGAC CAACGTCGTCATCAAAGTCTGCGAATTCCAGTTCTGTAACGACCCGTTCTTGG GAGTCTACTACCACAAGAACAACAAGTCCTGGATGGAATCCGAGTTCAGAGT CTACTCTTCCGCGAACAACTGCACCTTCGAATATGTATCTCAGCCGTTCCTAAT GGACCTAGAGGGAAAGCAGGGAAACTTCAAGAACCTAAGAGAGTTCGTATTC AAGAACATCGACGGATACTTCAAGATCTACTCCAAGCACACTCCGATCAACCT AGTTAGAGATCTACCGCAAGGATTCTCTGCGCTAGAACCGTTAGTAGATTTGC CGATCGGAATCAACATCACCAGATTCCAGACACTACTAGCGCTACACAGATCT TACCTAACGCCGGGAGATTCTTCTTCTGGATGGACTGCTGGTGCTGCGGCTTA TTATGTAGGATACCTACAGCCGAGAACCTTCCTATTGAAGTACAACGAAAAC GGAACCATCACCGATGCCGTAGATTGTGCTCTAGATCCGCTATCCGAAACGAA GTGCACCCTAAAGTCTTTCACCGTCGAGAAGGGAATCTACCAGACCTCCAACT TTAGAGTACAGCCGACCGAATCCATCGTCAGATTTCCGAACATCACGAACCTA TGTCCGTTCGGAGAAGTGTTCAACGCGACAAGATTTGCGTCTGTCTATGCGTG GAACAGAAAAAGAATCAGTAACTGCGTCGCGGACTACTCCGTCCTATACAAC TCTGCCTCTTTCTCCACGTTCAAATGCTACGGTGTATCTCCGACAAAGCTAAA CGATCTATGCTTCACCAACGTCTACGCGGACTCCTTCGTAATCAGAGGAGATG AAGTTAGACAGATTGCGCCGGGACAAACTGGAAAGATCGCGGATTATAACTA CAAGCTACCGGACGACTTCACCGGATGTGTAATTGCGTGGAATTCGAACAAC CTAGACTCCAAAGTCGGAGGAAACTACAACTACTTGTACAGACTATTCAGAA AGTCCAACCTAAAGCCGTTCGAGAGAGACATCTCCACCGAAATCTATCAGGC TGGATCTACACCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCCCGCTAC AGTCTTACGGATTTCAACCGACAAACGGTGTAGGATATCAGCCGTACAGAGT CGTCGTACTATCCTTCGAACTACTACATGCTCCGGCGACAGTATGTGGACCGA AAAAGTCTACCAACCTAGTCAAGAACAAATGCGTCAACTTTAACTTCAACGG ACTAACCGGAACCGGTGTCCTAACCGAATCTAACAAGAAGTTTCTACCGTTCC AGCAGTTCGGAAGAGATATCGCGGATACAACAGACGCTGTCAGAGATCCGCA AACCTTGGAGATCCTAGATATCACACCGTGTTCTTTCGGTGGTGTCTCTGTAAT TACTCCGGGAACGAACACCTCCAATCAAGTAGCGGTACTATACCAGGACGTG AACTGTACAGAAGTACCGGTAGCTATTCACGCGGATCAACTAACACCAACTT GGAGAGTGTACTCCACCGGATCTAACGTATTCCAAACAAGAGCGGGATGTCT AATCGGAGCGGAACACGTAAACAACTCCTACGAATGTGATATCCCGATTGGA GCGGGAATCTGTGCGTCTTACCAAACACAAACAAACTCTCCGAGAAGAGCGA GATCTGTAGCCTCTCAATCTATTATCGCCTACACCATGTCCTTGGGAGCCGAA AATTCTGTCGCGTACTCCAACAATTCTATCGCGATCCCGACAAACTTCACCAT CTCTGTAACAACCGAGATCCTACCGGTGTCTATGACCAAGACATCTGTCGATT GCACCATGTACATCTGCGGAGATTCCACCGAGTGCTCCAACCTACTACTACAG TACGGATCTTTCTGTACCCAGCTAAACAGAGCGTTGACTGGAATCGCTGTAGA GCAGGATAAGAACACTCAAGAGGTATTCGCGCAAGTCAAGCAGATCTATAAG ACTCCGCCGATCAAGGACTTCGGAGGTTTCAACTTCTCTCAGATCTTGCCGGA TCCGTCCAAACCGTCTAAGAGATCTTTCATCGAGGACCTACTATTCAACAAAG TCACCCTAGCTGACGCGGGATTCATCAAACAATACGGAGATTGCTTGGGAGA CATTGCGGCGAGAGATCTAATTTGCGCGCAGAAGTTTAACGGATTGACAGTA CTACCGCCGCTACTAACCGATGAGATGATTGCGCAGTACACGTCTGCTCTATT GGCGGGAACAATTACAAGTGGATGGACATTTGGAGCCGGTGCCGCTCTACAA ATTCCGTTTGCTATGCAAATGGCGTACAGATTCAACGGAATCGGAGTAACCCA GAACGTCTTGTACGAGAACCAGAAGCTAATCGCGAACCAGTTCAATTCCGCG ATCGGAAAGATCCAGGACAGTCTATCTTCTACTGCTTCGGCGTTGGGAAAGCT ACAGGATGTAGTAAATCAAAACGCGCAGGCGCTAAACACCTTGGTCAAGCAA CTATCCTCTAACTTCGGAGCGATCTCGTCCGTCCTAAACGACATCTTATCCAG ACTAGATAAGGTCGAAGCGGAGGTCCAGATCGATAGACTAATCACTGGAAGA TTGCAGTCCCTACAGACCTACGTAACACAGCAACTAATTAGAGCGGCGGAGA TTAGAGCCTCTGCTAATCTAGCTGCGACCAAGATGTCCGAATGTGTCTTGGGA CAATCCAAGAGAGTGGACTTCTGCGGAAAGGGATACCACCTAATGTCTTTCCC ACAATCTGCGCCGCATGGTGTCGTATTCCTACATGTAACATATGTGCCGGCGC AAGAAAAGAACTTCACAACAGCTCCAGCGATCTGCCATGATGGAAAAGCTCA TTTCCCGAGAGAGGGAGTCTTTGTCTCTAACGGAACTCATTGGTTCGTCACCC AGAGAAACTTCTACGAGCCGCAGATCATCACCACCGACAACACATTCGTCTC GGGAAACTGCGACGTGGTCATCGGAATCGTAAACAATACCGTCTACGATCCG TTGCAGCCGGAACTAGACTCCTTCAAAGAAGAGTTGGACAAGTACTTCAAGA ACCACACCTCTCCGGATGTGGACTTGGGAGATATCTCTGGAATCAACGCGTCC GTCGTCAACATCCAGAAAGAAATCGATAGATTGAACGAGGTCGCGAAGAACT TGAACGAGTCCCTAATCGACCTACAAGAGCTAGGAAAATACGAGCAGTACAT CAAGTGGCCGTGGTACATCTGGCTAGGATTCATTGCTGGACTAATTGCGATCG TCATGGTCACCATCATGCTATGCTGTATGACCTCCTGTTGCTCCTGTCTAAAGG GATGTTGTTCCTGCGGATCCTGTTGCAAGTTCGATGAAGATGATAGTGAACCG GTCCTAAAGGGTGTCAAGCTACACTACACA

(172) In certain embodiments, the S protein is expressed as a full-length protein and contains one or more amino acid substitutions. In some embodiments, the S protein is expressed as a full-length protein and contains one or more substitutions selected from K417T, E484K or N501Y of SEQ ID NO: 1. In some embodiments, the S protein is expressed as a full-length protein and contains the following substitutions: K417T, E484K, and N501Y of SEQ ID NO:1. In some embodiments, the substitution is K417N. In some embodiments, the S protein is expressed as a full-length protein of SEQ ID NO: 6, or an amino acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the S protein is expressed as a full-length protein and has a deletion of one or more spike protein amino acids H69, V70, or Y144, or combinations thereof, of SEQ ID NO: 1. In some embodiments, the S protein is expressed as a full-length protein and contains one or more substitutions selected from D614G, A570D, P681H, T716I, S982A, D1118H, K417N or K417T, D215G, A701V, L18F, R246I, Y453F, I692V, M1229I, N439K, A222V, S477N, or A376T, or combinations thereof, of SEQ ID NO:1. In some embodiments, the variant strain is a SARS-CoV2 virus which has a spike protein deletion at amino acids 242-244 of SEQ ID NO: 1. In some embodiments, the S protein is expressed as a full-length protein and contains the following deletions and substitutions: deletion of amino acids 69-70, deletion of amino acid Y144, amino acid substitution N501Y, amino acid substitution A570D, amino acid substitution D614G, amino acid substitution P681H, amino acid substitution T716I, amino acid substitution S982A, and amino acid substitution D1118H, or SEQ ID NO: 1. In some embodiments, the S protein is expressed as a full-length protein and contains the following deletions and substitutions: N501Y, K417N or K417T, E484K, D80A, A701V, L18F, and amino acid deletion at amino acids 242-244, of SEQ ID NO: 1. In some embodiments, the S protein is expressed as a full-length protein and contains one or more of the following substitutions: D614G; D936Y; P1263L; L5F; N439K; R211; D839Y; L54F; A879S; L18F; F1121L; R847K; T478I; A829T; Q675H; S477N; H49Y; T29I; G769V; G1124V; V1176F; K1073N; P479S; S1252P; Y145 deletion; E583D; R214L; A1020V; Q1208H; D215G; H146Y; S98F; T95I; G1219C; A846V; I197V; R102I; V367F; T572I; A1078S; A831V; P1162L; T73I; A845S; G1219V; H245Y; L8V; Q675R; S254F; V483A; Q677H; D138H; D80Y; M1237T; D1146H; E654D; H655Y; S50L; S939F; S943P; G485R; Q613H; T76I; V341I; M153I; S221L; T859I; W258L; L242F; P681L; V289I; A520S; V1104L; V1228L; L176F; M1237I; T307I; T716I; L141; M1229I; A1087S; P26S; P330S; P384L; R765L; S940F; T323I; V826L; E1202Q; L1203F; L611F; V615I; A262S; A522V; A688V; A706V; A892S; E554D; Q836H; T1027I; T221; A222V; A27S; A626V; C1247F; K1191N; M731I; P26L; S1147L; S1252F; S255F; V1264L; V308L; D80A; I670L; P251L; P631S; *1274Q; A344S; A771S; A879T; D1084Y; D253G; H1101Y; L1200F; Q14H; Q239K; A623V; D215Y; E1150D; G476S; K77M; M177I; P812S; S704L; T51I; T547I; T791I; V1122L; Y145H; D574Y; G142D; G181V; 1834T; N370S; P812L; S12F; T791P; V90F; W152L; A292S; A570V; A647S; A845V; D1163Y; G181R; L84I; L938F; P1143L; P809S; R78M; T1160I; V1133F; V213L; V615F; A831V; D839Y; D839N; D839E; S943P; P1263L; or V622F; and combinations thereof, of SEQ ID NO: 1.

(173) TABLE-US-00002 TABLE2 SARS-CoV2SpikeProteinMutants SEQIDNO:6- MFVFLVLLPLVSSQCVNLTTRTQLPPAYTN SARS-CoV2full- SFTRGVYYPDKVFRSSVLHSTQDLFLPFFS lengthS NVTWFHAIHVSGTNGTKRFDNPVLPFNDGV protein- YFASTEKSNIIRGWIFGTTLDSKTQSLLIV K417T,E484K, NNATNVVIKVCEFQFCNDPFLGVYYHKNNK andN501Y SWMESEFRVYSSANNCTFEYVSQPFLMDLE GKQGNFKNLREFVFKNIDGYFKIYSKHTPI NLVRDLPQGFSALEPLVDLPIGINITRFQT LLALHRSYLTPGDSSSGWTAGAAAYYVGYL QPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFP NITNLCPFGEVFNATRFASVYAWNRKRISN CVADYSVLYNSASFSTFKCYGVSPTKLNDL CFTNVYADSFVIRGDEVRQIAPGQTGcustom character IAD YNYKLPDDFTGCVIAWNSNNLDSKVGGNYN YLYRLFRKSNLKPFERDISTEIYQAGSTPC NGVcustom character GFNCYFPLQSYGFQPTcustom character GVGYQPYRV VVLSFELLHAPATVCGPKKSTNLVKNKCVN FNFNGLTGTGVLTESNKKFLPFQQFGRDIA DTTDAVRDPQTLEILDITPCSFGGVSVITP GTNTSNQVAVLYQDVNCTEVPVAIHADQLT PTWRVYSTGSNVFQTRAGCLIGAEHVNNSY ECDIPIGAGICASYQTQTNSPRRARSVASQ SIIAYTMSLGAENSVAYSNNSIAIPTNFTI SVTTEILPVSMTKTSVDCTMYICGDSTECS NLLLQYGSFCTQLNRALTGIAVEQDKNTQE VFAQVKQIYKTPPIKDFGGFNFSQILPDPS KPSKRSFIEDLLFNKVTLADAGFIKQYGDC LGDIAARDLICAQKFNGLTVLPPLLTDEMI AQYTSALLAGTITSGWTFGAGAALQIPFAM QMAYRFNGIGVTQNVLYENQKLIANQFNSA IGKIQDSLSSTASALGKLQDVVNQNAQALN TLVKQLSSNFGAISSVLNDILSRLDKVEAE VQIDRLITGRLQSLQTYVTQQLIRAAEIRA SANLAATKMSECVLGQSKRVDFCGKGYHLM SFPQSAPHGVVFLHVTYVPAQEKNFTTAPA ICHDGKAHFPREGVFVSNGTHWFVTQRNFY EPQIITTDNTFVSGNCDVVIGIVNNTVYDP LQPELDSFKEELDKYFKNHTSPDVDLGDIS GINASVVNIQKEIDRLNEVAKNLNESLIDL QELGKYEQYIKWPWYIWLGFIAGLIAIVMV TIMLCCMTSCCSCLKGCCSCGSCCKFDEDD SEPVLKGVKLHYT

(174) In certain aspects, the S protein is expressed as a full-length protein and contains one or more amino acid proline substitutions that stabilize the S protein trimer in the prefusion conformation. In some embodiments, the S protein is expressed as a full-length protein and contains one or more proline substitutions at or near the boundary between a Heptad Repeat 1 (HR1) and a central helix of the promoters of the S ectodomain trimer. In some embodiments, the proline substitutions occur between amino acid residues 970 to 990 (GAISSVLNDILSRLDKVEAE) (SEQ ID NO: 7) of the promoters in the trimer. In some embodiments, the S protein is expressed as a full-length protein and contains two proline substitutions at amino acids K986 and V987 of SEQ ID NO: 1, as provided for in SEQ ID NO: 8 in Table 3 below, wherein the K986P and V987P substitutions are bolded and underlined, or an amino acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 9, which provides a nucleic acid sequence encoding the full-length S protein of SARS-CoV2 derived from the native SARS-CoV2 sequence with nucleic acid substitutions encoding for P986 and P987, or a nucleic acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 10, which provides an optimized nucleic acid sequence encoding the double proline substituted and stabilized SARS-CoV2 S protein, wherein the nucleic acid has been optimized as described below, or a nucleic acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In certain embodiments, an additional nucleic acid sequence encoding a tag may be included in the nucleic acid sequence to be inserted into the rMVA, so that the tag is expressed at the C-terminus of the protein. In some embodiments, the nucleic acid sequence (GAGCCAGAGGCT) (SEQ ID NO: 4) encodes for the high affinity C-tag having the amino acid sequence EPEA (SEQ ID NO: 5).

(175) TABLE-US-00003 TABLE3 ExemplarySARS-CoV2Full-LengthSProtein-Stabilized SEQIDNO:8- MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFL SARS-CoV2full- PFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDS lengthSprotein- KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNC stabilizedwith2 TFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSA proline LEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLK substitutions YNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNL CPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDL CFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKV GGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTN GVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTES NKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVL YQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPI GAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVT TEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNT QEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIK QYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGA GAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASAL GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDcustom character EAEVQIDRLITGRL QSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQS APHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNF YEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVD LGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFI AGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT SEQIDNO:9- ATGTTTGTTTTTCTTGTTTTATTGCCACTAGTCTCTAGTCAGTGTGTTAATCTTA SARS-CoV2nucleic CAACCAGAACTCAATTACCCCCTGCATACACTAATTCTTTCACACGTGGTGTT acidsequencefor TATTACCCTGACAAAGTTTTCAGATCCTCAGTTTTACATTCAACTCAGGACTTG fulllength TTCTTACCTTTCTTTTCCAATGTTACTTGGTTCCATGCTATACATGTCTCTGGGA Sprotein CCAATGGTACTAAGAGGTTTGATAACCCTGTCCTACCATTTAATGATGGTGTT with2proline TATTTTGCTTCCACTGAGAAGTCTAACATAATAAGAGGCTGGATTTTTGGTAC substitutions. TACTTTAGATTCGAAGACCCAGTCCCTACTTATTGTTAATAACGCTACTAATGT TGTTATTAAAGTCTGTGAATTTCAATTTTGTAATGATCCATTTTTGGGTGTTTA TTACCACAAAAACAACAAAAGTTGGATGGAAAGTGAGTTCAGAGTTTATTCT AGTGCGAATAATTGCACTTTTGAATATGTCTCTCAGCCTTTTCTTATGGACCTT GAAGGAAAACAGGGTAATTTCAAAAATCTTAGGGAATTTGTGTTTAAGAATA TTGATGGTTATTTTAAAATATATTCTAAGCACACGCCTATTAATTTAGTGCGTG ATCTCCCTCAGGGTTTTTCGGCTTTAGAACCATTGGTAGATTTGCCAATAGGT ATTAACATCACTAGGTTTCAAACTTTACTTGCTTTACATAGAAGTTATTTGACT CCTGGTGATTCTTCTTCAGGTTGGACAGCTGGTGCTGCAGCTTATTATGTGGGT TATCTTCAACCTAGGACTTTTCTATTAAAATATAATGAAAATGGAACCATTAC AGATGCTGTAGACTGTGCACTTGACCCTCTCTCAGAAACAAAGTGTACGTTGA AATCCTTCACTGTAGAAAAAGGAATCTATCAAACTTCTAACTTTAGAGTCCAA CCAACAGAATCTATTGTTAGATTTCCTAATATTACAAACTTGTGCCCTTTTGGT GAAGTTTTTAACGCCACCAGATTTGCATCTGTTTATGCTTGGAACAGGAAGAG AATCAGCAACTGTGTTGCTGATTATTCTGTCCTATATAATTCCGCATCATTTTC CACTTTTAAGTGTTATGGAGTGTCTCCTACTAAATTAAATGATCTCTGCTTTAC TAATGTCTATGCAGATTCATTTGTAATTAGAGGTGATGAAGTCAGACAAATCG CTCCAGGGCAAACTGGAAAGATTGCTGATTATAATTATAAATTACCAGATGAT TTTACAGGCTGCGTTATAGCTTGGAATTCTAACAATCTTGATTCTAAGGTTGGT GGTAATTATAATTACCTGTATAGATTGTTTAGGAAGTCTAATCTCAAACCTTTT GAGAGAGATATTTCAACTGAAATCTATCAGGCCGGTAGCACACCTTGTAATG GTGTTGAAGGTTTTAATTGTTACTTTCCTTTACAATCATATGGTTTCCAACCCA CTAATGGTGTTGGTTACCAACCATACAGAGTAGTAGTACTTTCTTTTGAACTTC TACATGCACCAGCAACTGTTTGTGGACCTAAAAAGTCTACTAATTTGGTTAAA AACAAATGTGTCAATTTCAACTTCAATGGTTTAACAGGCACAGGTGTTCTTAC TGAGTCTAACAAAAAGTTTCTGCCTTTCCAACAATTTGGCAGAGACATTGCTG ACACTACTGATGCTGTCCGTGATCCACAGACACTTGAGATTCTTGACATTACA CCATGTTCTTTTGGTGGTGTCAGTGTTATAACACCAGGAACAAATACTTCTAA CCAGGTTGCTGTTCTTTATCAGGATGTTAACTGCACAGAAGTCCCTGTTGC TATTCATGCAGATCAACTTACTCCTACTTGGCGTGTTTATTCTACAGGTTCTAA TGTTTTTCAAACACGTGCAGGCTGTTTAATAGGGGCTGAACATGTCAACAACT CATATGAGTGTGACATACCCATTGGTGCAGGTATATGCGCTAGTTATCAGACT CAGACTAATTCTCCTCGGCGGGCACGTAGTGTAGCTAGTCAATCCATCATTGC CTACACTATGTCACTTGGTGCAGAAAATTCAGTTGCTTACTCTAATAACTCTAT TGCCATACCCACAAATTTTACTATTAGTGTTACCACAGAAATTCTACCAGTGT CTATGACCAAGACATCAGTAGATTGTACAATGTACATTTGTGGTGATTCAACT GAATGCAGCAATCTTTTGTTGCAATATGGCAGTTTTTGTACACAATTAAACCG TGCTTTAACTGGAATAGCTGTTGAACAAGACAAAAACACCCAAGAAGTTTTTG CACAAGTCAAACAAATTTACAAAACACCACCAATTAAAGATTTTGGTGGTTTT AATTTTTCACAAATATTACCAGATCCATCAAAACCAAGCAAGAGGTCATTTAT TGAAGATCTACTTTTCAACAAAGTGACACTTGCAGATGCTGGCTTCATCAAAC AATATGGTGATTGCCTTGGTGATATTGCTGCTAGAGACCTCATTTGTGCACAA AAGTTTAACGGCCTTACTGTTTTGCCACCTTTGCTCACAGATGAAATGATTGCT CAATACACTTCTGCACTGTTAGCGGGTACAATCACTTCTGGTTGGACCTTTGG TGCAGGTGCTGCATTACAAATACCATTTGCTATGCAAATGGCTTATAGGTTTA ATGGTATTGGAGTTACACAGAATGTTCTCTATGAGAACCAAAAATTGATTGCC AACCAATTTAATAGTGCTATTGGCAAAATTCAAGACTCACTTTCTTCCACAGC AAGTGCACTTGGAAAACTTCAAGATGTGGTCAACCAAAATGCACAAGCTTTA AACACGCTTGTTAAACAACTTAGCTCCAATTTTGGTGCAATTTCAAGTGTTTTA AATGATATCCTTTCACGTCTTGACCCACCGGAGGCTGAAGTGCAAATTGATAG GTTGATCACAGGCAGACTTCAAAGTTTGCAGACATATGTGACTCAACAATTAA TTAGAGCTGCAGAAATCAGAGCTTCTGCTAATCTTGCTGCTACTAAAATGTCA GAGTGTGTACTTGGACAATCAAAAAGAGTTGATTTTTGTGGAAAGGGCTATCA TCTTATGTCCTTCCCTCAGTCAGCACCTCATGGTGTAGTCTTCTTGCATGTGAC TTATGTCCCTGCACAAGAAAAGAACTTCACAACTGCTCCTGCCATTTGTCATG ATGGAAAAGCACACTTTCCTCGTGAAGGTGTCTTTGTTTCAAATGGCACACAC TGGTTTGTAACACAAAGGAATTTTTATGAACCACAAATCATTACTACAGACAA CACATTTGTGTCTGGTAACTGTGATGTTGTAATAGGAATTGTCAACAACACAG TTTATGATCCTTTGCAACCTGAATTAGACTCATTCAAGGAGGAGTTAGATAAA TATTTTAAGAATCATACATCACCAGATGTTGATTTAGGTGACATCTCTGGCAT TAATGCTTCAGTTGTAAACATTCAAAAAGAAATTGACCGCCTCAATGAGGTTG CCAAGAATTTAAATGAATCTCTCATCGATCTCCAAGAACTTGGAAAGTATGAG CAGTATATAAAATGGCCATGGTACATTTGGCTAGGTTTTATAGCTGGCTTGAT TGCCATAGTAATGGTGACAATTATGCTTTGCTGTATGACCAGTTGCTGTAGTT GTCTCAAGGGCTGTTGTTCTTGTGGATCCTGCTGCAAATTTGATGAAGACGAC TCTGAGCCAGTGCTCAAAGGAGTCAAATTACATTACACA SEQIDNO:10- ATGTTCGTGTTCCTAGTCCTACTACCGCTAGTCTCTTCTCAGTGTGTAAACCTA SARS-CoV2nucleic ACAACGAGAACACAACTACCACCGGCGTACACCAATTCTTTCACAAGAGGAG acidsequencefor TATATTACCCGGACAAGGTGTTCAGATCCTCCGTACTACATTCTACACAGGAC fulllength CTATTCCTACCGTTCTTCTCTAACGTAACATGGTTCCACGCGATCCATGTCTCT Sprotein GGAACAAACGGAACGAAGAGATTCGATAACCCGGTCTTGCCGTTCAACGATG with2proline GTGTATACTTTGCGTCCACCGAGAAGTCCAACATCATCAGAGGATGGATCTTC substitutions- GGAACCACCTTGGATTCTAAGACCCAGTCCTTGCTAATCGTCAACAACGCGAC optimized. CAACGTCGTCATCAAAGTCTGCGAATTCCAGTTCTGTAACGACCCGTTCTTGG GAGTCTACTACCACAAGAACAACAAGTCCTGGATGGAATCCGAGTTCAGAGT CTACTCTTCCGCGAACAACTGCACCTTCGAATATGTATCTCAGCCGTTCCTAAT GGACCTAGAGGGAAAGCAGGGAAACTTCAAGAACCTAAGAGAGTTCGTATTC AAGAACATCGACGGATACTTCAAGATCTACTCCAAGCACACTCCGATCAACCT AGTTAGAGATCTACCGCAAGGATTCTCTGCGCTAGAACCGTTAGTAGATTTGC CGATCGGAATCAACATCACCAGATTCCAGACACTACTAGCGCTACACAGATCT TACCTAACGCCGGGAGATTCTTCTTCTGGATGGACTGCTGGTGCTGCGGCTTA TTATGTAGGATACCTACAGCCGAGAACCTTCCTATTGAAGTACAACGAAAAC GGAACCATCACCGATGCCGTAGATTGTGCTCTAGATCCGCTATCCGAAACGAA GTGCACCCTAAAGTCTTTCACCGTCGAGAAGGGAATCTACCAGACCTCCAACT TTAGAGTACAGCCGACCGAATCCATCGTCAGATTTCCGAACATCACGAACCTA TGTCCGTTCGGAGAAGTGTTCAACGCGACAAGATTTGCGTCTGTCTATGCGTG GAACAGAAAAAGAATCAGTAACTGCGTCGCGGACTACTCCGTCCTATACAAC TCTGCCTCTTTCTCCACGTTCAAATGCTACGGTGTATCTCCGACAAAGCTAAA CGATCTATGCTTCACCAACGTCTACGCGGACTCCTTCGTAATCAGAGGAGATG AAGTTAGACAGATTGCGCCGGGACAAACTGGAAAGATCGCGGATTATAACTA CAAGCTACCGGACGACTTCACCGGATGTGTAATTGCGTGGAATTCGAACAAC CTAGACTCCAAAGTCGGAGGAAACTACAACTACTTGTACAGACTATTCAGAA AGTCCAACCTAAAGCCGTTCGAGAGAGACATCTCCACCGAAATCTATCAGGC TGGATCTACACCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCCCGCTAC AGTCTTACGGATTTCAACCGACAAACGGTGTAGGATATCAGCCGTACAGAGT CGTCGTACTATCCTTCGAACTACTACATGCTCCGGCGACAGTATGTGGACCGA AAAAGTCTACCAACCTAGTCAAGAACAAATGCGTCAACTTTAACTTCAACGG ACTAACCGGAACCGGTGTCCTAACCGAATCTAACAAGAAGTTTCTACCGTTCC AGCAGTTCGGAAGAGATATCGCGGATACAACAGACGCTGTCAGAGATCCGCA AACCTTGGAGATCCTAGATATCACACCGTGTTCTTTCGGTGGTGTCTCTGTAAT TACTCCGGGAACGAACACCTCCAATCAAGTAGCGGTACTATACCAGGACGTG AACTGTACAGAAGTACCGGTAGCTATTCACGCGGATCAACTAACACCAACTT GGAGAGTGTACTCCACCGGATCTAACGTATTCCAAACAAGAGCGGGATGTCT AATCGGAGCGGAACACGTAAACAACTCCTACGAATGTGATATCCCGATTGGA GCGGGAATCTGTGCGTCTTACCAAACACAAACAAACTCTCCGAGAAGAGCGA GATCTGTAGCCTCTCAATCTATTATCGCCTACACCATGTCCTTGGGAGCCGAA AATTCTGTCGCGTACTCCAACAATTCTATCGCGATCCCGACAAACTTCACCAT CTCTGTAACAACCGAGATCCTACCGGTGTCTATGACCAAGACATCTGTCGATT GCACCATGTACATCTGCGGAGATTCCACCGAGTGCTCCAACCTACTACTACAG TACGGATCTTTCTGTACCCAGCTAAACAGAGCGTTGACTGGAATCGCTGTAGA GCAGGATAAGAACACTCAAGAGGTATTCGCGCAAGTCAAGCAGATCTATAAG ACTCCGCCGATCAAGGACTTCGGAGGTTTCAACTTCTCTCAGATCTTGCCGGA TCCGTCCAAACCGTCTAAGAGATCTTTCATCGAGGACCTACTATTCAACAAAG TCACCCTAGCTGACGCGGGATTCATCAAACAATACGGAGATTGCTTGGGAGA CATTGCGGCGAGAGATCTAATTTGCGCGCAGAAGTTTAACGGATTGACAGTA CTACCGCCGCTACTAACCGATGAGATGATTGCGCAGTACACGTCTGCTCTATT GGCGGGAACAATTACAAGTGGATGGACATTTGGAGCCGGTGCCGCTCTACAA ATTCCGTTTGCTATGCAAATGGCGTACAGATTCAACGGAATCGGAGTAACCCA GAACGTCTTGTACGAGAACCAGAAGCTAATCGCGAACCAGTTCAATTCCGCG ATCGGAAAGATCCAGGACAGTCTATCTTCTACTGCTTCGGCGTTGGGAAAGCT ACAGGATGTAGTAAATCAAAACGCGCAGGCGCTAAACACCTTGGTCAAGCAA CTATCCTCTAACTTCGGAGCGATCTCGTCCGTCCTAAACGACATCTTATCCAG ACTAGATCCACCGGAAGCGGAGGTCCAGATCGATAGACTAATCACTGGAAGA TTGCAGTCCCTACAGACCTACGTAACACAGCAACTAATTAGAGCGGCGGAGA TTAGAGCCTCTGCTAATCTAGCTGCGACCAAGATGTCCGAATGTGTCTTGGGA CAATCCAAGAGAGTGGACTTCTGCGGAAAGGGATACCACCTAATGTCTTTCCC ACAATCTGCGCCGCATGGTGTCGTATTCCTACATGTAACATATGTGCCGGCGC AAGAAAAGAACTTCACAACAGCTCCAGCGATCTGCCATGATGGAAAAGCTCA TTTCCCGAGAGAGGGAGTCTTTGTCTCTAACGGAACTCATTGGTTCGTCACCC AGAGAAACTTCTACGAGCCGCAGATCATCACCACCGACAACACATTCGTCTC GGGAAACTGCGACGTGGTCATCGGAATCGTAAACAATACCGTCTACGATCCG TTGCAGCCGGAACTAGACTCCTTCAAAGAAGAGTTGGACAAGTACTTCAAGA ACCACACCTCTCCGGATGTGGACTTGGGAGATATCTCTGGAATCAACGCGTCC GTCGTCAACATCCAGAAAGAAATCGATAGATTGAACGAGGTCGCGAAGAACT TGAACGAGTCCCTAATCGACCTACAAGAGCTAGGAAAATACGAGCAGTACAT CAAGTGGCCGTGGTACATCTGGCTAGGATTCATTGCTGGACTAATTGCGATCG TCATGGTCACCATCATGCTATGCTGTATGACCTCCTGTTGCTCCTGTCTAAAGG GATGTTGTTCCTGCGGATCCTGTTGCAAGTTCGATGAAGATGATAGTGAACCG GTCCTAAAGGGTGTCAAGCTACACTACACA

(176) In certain embodiments, the S protein is expressed as a full-length protein and contains one or more amino acid substitutions. In some embodiments, the S protein is expressed as a full-length protein and contains one or more substitutions selected from K417T, E484K or N501Y of SEQ ID NO: 8. In some embodiments, the S protein is expressed as a full-length protein and contains the following substitutions: K417T, E484K, and N501Y of SEQ ID NO:8 . . . . In some embodiments, the S protein is expressed as a full-length protein of SEQ ID NO: 11, or an amino acid sequence 89%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 12, which provides an optimized nucleic acid sequence encoding the double proline substituted and stabilized SARS-CoV2 S protein with a K417T, E484K, and N501Y substitutions, wherein the nucleic acid has been optimized as described below, or a nucleic acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the mutation is K417N.

(177) In some embodiments, the S protein is expressed as a full-length protein and has a deletion of one or more spike protein amino acids H69, V70, or Y144, or combinations thereof, of SEQ ID NO: 8. In some embodiments, the S protein is expressed as a full-length protein and contains one or more substitutions selected from D614G, A570D, P681H, T716I, S982A, D1118H, K417N, K417T, D215G, A701V, L18F, R246I, Y453F, I692V, M1229I, N439K, A222V, S477N, or A376T, or combinations thereof, of SEQ ID NO: 8. In some embodiments, the spike protein includes a deletion at amino acids 242-244 of SEQ ID NO: 8. In some embodiments, the S protein is expressed as a full-length protein and contains the following deletions and substitutions: deletion of amino acids 69-70, deletion of amino acid Y144, amino acid substitution N501Y, amino acid substitution A570D, amino acid substitution D614G, amino acid substitution P681H, amino acid substitution T716I, amino acid substitution S982A, and amino acid substitution D1118H, or SEQ ID NO: 8. In some embodiments, the S protein is expressed as a full-length protein and contains the following deletions and substitutions: N501Y, K417N or K417T, E484K, D80A, A701V, L18F, and amino acid deletion at amino acids 242-244, of SEQ ID NO: 8. In some embodiments, the S protein is expressed as a full-length protein and contains one or more of the following substitutions: D614G; D936Y; P1263L; L5F; N439K; R21I; D839Y; L54F; A879S; L18F; F1121L; R847K; T478I; A829T; Q675H; S477N; H49Y; T29I; G769V; G1124V; V1176F; K1073N; P479S; S1252P; Y145 deletion; E583D; R214L; A1020V; Q1208H; D215G; H146Y; S98F; T95I; G1219C; A846V; I197V; R1021; V367F; T572I; A1078S; A831V; P1162L; T73I; A845S; G1219V; H245Y; L8V; Q675R; S254F; V483A; Q677H; D138H; D80Y; M1237T; D1146H; E654D; H655Y; S50L; S939F; S943P; G485R; Q613H; T76I; V341I; M153I; S221L; T859I; W258L; L242F; P681L; V289I; A520S; V1104L; V1228L; L176F; M1237I; T307I; T716I; L141; M1229I; A1087S; P26S; P330S; P384L; R765L; S940F; T323I; V826L; E1202Q; L1203F; L611F; V615I; A262S; A522V; A688V; A706V; A892S; E554D; Q836H; T1027I; T22I; A222V; A27S; A626V; C1247F; K1191N; M731I; P26L; S1147L; S1252F; S255F; V1264L; V308L; D80A; I670L; P251L; P631S; *1274Q; A344S; A771S; A879T; D1084Y; D253G; H1101Y; L1200F; Q14H; Q239K; A623V; D215Y; E1150D; G476S; K77M; M177I; P812S; S704L; T51I; T547I; T791I; V1122L; Y145H; D574Y; G142D; G181V; 1834T; N370S; P812L; S12F; T791P; V90F; W152L; A292S; A570V; A647S; A845V; D1163Y; G181R; L84I; L938F; P1143L; P809S; R78M; T1160I; V1133F; V213L; V615F; A831V; D839Y; D839N; D839E; S943P; P1263L; or V622F; and combinations thereof, of SEQ ID NO: 8.

(178) In some embodiment, the nucleic acid sequence encoding the stabilized S protein is SEQ ID NO: 12, or a nucleic acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. SEQ ID NO: 12 provides an optimized nucleic acid sequence encoding the double proline substituted and stabilized SARS-CoV2 S protein, further comprising K417T, E484K, and N501T amino acid substitutions, wherein the nucleic acid has been optimized as described below. In certain embodiments, an additional nucleic acid sequence encoding a tag may be included in the nucleic acid sequence to be inserted into the rMVA, so that the tag is expressed at the C-terminus of the protein. In some embodiments, the nucleic acid sequence (GAGCCAGAGGCT) (SEQ ID NO: 4) encodes for the high affinity C-tag having the amino acid sequence EPEA (SEQ ID NO: 5).

(179) TABLE-US-00004 TABLE4 ExemplarySARS-CoV2Full-LengthSProtein-StabilizedMutant SEQIDNO:11- MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFL SARS-CoV2full- PFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDS lengthstabilizedS KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNC protein-K417T, TFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSA E484K,andN501Y LEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLK YNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNL CPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDL CFTNVYADSFVIRGDEVRQIAPGQTGcustom character IADYNYKLPDDFTGCVIAWNSNNLDSKV GGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVcustom character GFNCYFPLQSYGFQPT custom character GVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTE SNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVL YQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPI GAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVT TEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNT QEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIK QYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGA GAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASAL GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDcustom character EAEVQIDRLITGRL QSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQS APHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNF YEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVD LGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFI AGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT SEQIDNO:12- ATGTTCGTGTTCCTAGTCCTACTACCGCTAGTCTCTTCTCAGTGTGTAAACCTA SARS-CoV2nucleic ACAACGAGAACACAACTACCACCGGCGTACACCAATTCTTTCACAAGAGGAG acidsequencefor TATATTACCCGGACAAGGTGTTCAGATCCTCCGTACTACATTCTACACAGGAC fulllengthSprotein CTATTCCTACCGTTCTTCTCTAACGTAACATGGTTCCACGCGATCCATGTCTCT with2proline GGAACAAACGGAACGAAGAGATTCGATAACCCGGTCTTGCCGTTCAACGATG substitutions,and GTGTATACTTTGCGTCCACCGAGAAGTCCAACATCATCAGAGGATGGATCTTC K417T,E484K,and GGAACCACCTTGGATTCTAAGACCCAGTCCTTGCTAATCGTCAACAACGCGAC N501Taminoacid CAACGTCGTCATCAAAGTCTGCGAATTCCAGTTCTGTAACGACCCGTTCTTGG substitutions- GAGTCTACTACCACAAGAACAACAAGTCCTGGATGGAATCCGAGTTCAGAGT optimized CTACTCTTCCGCGAACAACTGCACCTTCGAATATGTATCTCAGCCGTTCCTAAT GGACCTAGAGGGAAAGCAGGGAAACTTCAAGAACCTAAGAGAGTTCGTATTC AAGAACATCGACGGATACTTCAAGATCTACTCCAAGCACACTCCGATCAACCT AGTTAGAGATCTACCGCAAGGATTCTCTGCGCTAGAACCGTTAGTAGATTTGC CGATCGGAATCAACATCACCAGATTCCAGACACTACTAGCGCTACACAGATCT TACCTAACGCCGGGAGATTCTTCTTCTGGATGGACTGCTGGTGCTGCGGCTTA TTATGTAGGATACCTACAGCCGAGAACCTTCCTATTGAAGTACAACGAAAAC GGAACCATCACCGATGCCGTAGATTGTGCTCTAGATCCGCTATCCGAAACGAA GTGCACCCTAAAGTCTTTCACCGTCGAGAAGGGAATCTACCAGACCTCCAACT TTAGAGTACAGCCGACCGAATCCATCGTCAGATTTCCGAACATCACGAACCTA TGTCCGTTCGGAGAAGTGTTCAACGCGACAAGATTTGCGTCTGTCTATGCGTG GAACAGAAAAAGAATCAGTAACTGCGTCGCGGACTACTCCGTCCTATACAAC TCTGCCTCTTTCTCCACGTTCAAATGCTACGGTGTATCTCCGACAAAGCTAAA CGATCTATGCTTCACCAACGTCTACGCGGACTCCTTCGTAATCAGAGGAGATG AAGTTAGACAGATTGCGCCGGGACAAACTGGAACGATCGCGGATTATAACTA CAAGCTACCGGACGACTTCACCGGATGTGTAATTGCGTGGAATTCGAACAAC CTAGACTCCAAAGTCGGAGGAAACTACAACTACTTGTACAGACTATTCAGAA AGTCCAACCTAAAGCCGTTCGAGAGAGACATCTCCACCGAAATCTATCAGGC TGGATCTACACCGTGTAATGGTGTCAAGGGATTCAACTGCTACTTCCCGCTAC AGTCTTACGGATTTCAACCGACATACGGTGTAGGATATCAGCCGTACAGAGTC GTCGTACTATCCTTCGAACTACTACATGCTCCGGCGACAGTATGTGGACCGAA AAAGTCTACCAACCTAGTCAAGAACAAATGCGTCAACTTTAACTTCAACGGA CTAACCGGAACCGGTGTCCTAACCGAATCTAACAAGAAGTTTCTACCGTTCCA GCAGTTCGGAAGAGATATCGCGGATACAACAGACGCTGTCAGAGATCCGCAA ACCTTGGAGATCCTAGATATCACACCGTGTTCTTTCGGTGGTGTCTCTGTAATT ACTCCGGGAACGAACACCTCCAATCAAGTAGCGGTACTATACCAGGACGTGA ACTGTACAGAAGTACCGGTAGCTATTCACGCGGATCAACTAACACCAACTTG GAGAGTGTACTCCACCGGATCTAACGTATTCCAAACAAGAGCGGGATGTCTA ATCGGAGCGGAACACGTAAACAACTCCTACGAATGTGATATCCCGATTGGAG CGGGAATCTGTGCGTCTTACCAAACACAAACAAACTCTCCGAGAAGAGCGAG ATCTGTAGCCTCTCAATCTATTATCGCCTACACCATGTCCTTGGGAGCCGAAA ATTCTGTCGCGTACTCCAACAATTCTATCGCGATCCCGACAAACTTCACCATC TCTGTAACAACCGAGATCCTACCGGTGTCTATGACCAAGACATCTGTCGATTG CACCATGTACATCTGCGGAGATTCCACCGAGTGCTCCAACCTACTACTACAGT ACGGATCTTTCTGTACCCAGCTAAACAGAGCGTTGACTGGAATCGCTGTAGAG CAGGATAAGAACACTCAAGAGGTATTCGCGCAAGTCAAGCAGATCTATAAGA CTCCGCCGATCAAGGACTTCGGAGGTTTCAACTTCTCTCAGATCTTGCCGGAT CCGTCCAAACCGTCTAAGAGATCTTTCATCGAGGACCTACTATTCAACAAAGT CACCCTAGCTGACGCGGGATTCATCAAACAATACGGAGATTGCTTGGGAGAC ATTGCGGCGAGAGATCTAATTTGCGCGCAGAAGTTTAACGGATTGACAGTACT ACCGCCGCTACTAACCGATGAGATGATTGCGCAGTACACGTCTGCTCTATTGG CGGGAACAATTACAAGTGGATGGACATTTGGAGCCGGTGCCGCTCTACAAAT TCCGTTTGCTATGCAAATGGCGTACAGATTCAACGGAATCGGAGTAACCCAG AACGTCTTGTACGAGAACCAGAAGCTAATCGCGAACCAGTTCAATTCCGCGA TCGGAAAGATCCAGGACAGTCTATCTTCTACTGCTTCGGCGTTGGGAAAGCTA CAGGATGTAGTAAATCAAAACGCGCAGGCGCTAAACACCTTGGTCAAGCAAC TATCCTCTAACTTCGGAGCGATCTCGTCCGTCCTAAACGACATCTTATCCAGA CTAGATCCACCGGAAGCGGAGGTCCAGATCGATAGACTAATCACTGGAAGAT TGCAGTCCCTACAGACCTACGTAACACAGCAACTAATTAGAGCGGCGGAGAT TAGAGCCTCTGCTAATCTAGCTGCGACCAAGATGTCCGAATGTGTCTTGGGAC AATCCAAGAGAGTGGACTTCTGCGGAAAGGGATACCACCTAATGTCTTTCCCA CAATCTGCGCCGCATGGTGTCGTATTCCTACATGTAACATATGTGCCGGCGCA AGAAAAGAACTTCACAACAGCTCCAGCGATCTGCCATGATGGAAAAGCTCAT TTCCCGAGAGAGGGAGTCTTTGTCTCTAACGGAACTCATTGGTTCGTCACCCA GAGAAACTTCTACGAGCCGCAGATCATCACCACCGACAACACATTCGTCTCG GGAAACTGCGACGTGGTCATCGGAATCGTAAACAATACCGTCTACGATCCGTT GCAGCCGGAACTAGACTCCTTCAAAGAAGAGTTGGACAAGTACTTCAAGAAC CACACCTCTCCGGATGTGGACTTGGGAGATATCTCTGGAATCAACGCGTCCGT CGTCAACATCCAGAAAGAAATCGATAGATTGAACGAGGTCGCGAAGAACTTG AACGAGTCCCTAATCGACCTACAAGAGCTAGGAAAATACGAGCAGTACATCA AGTGGCCGTGGTACATCTGGCTAGGATTCATTGCTGGACTAATTGCGATCGTC ATGGTCACCATCATGCTATGCTGTATGACCTCCTGTTGCTCCTGTCTAAAGGG ATGTTGTTCCTGCGGATCCTGTTGCAAGTTCGATGAAGATGATAGTGAACCGG TCCTAAAGGGTGTCAAGCTACACTACACA

(180) In certain aspects, the SARS-CoV2 antigen expressed by the rMVA is a modified spike(S) protein, wherein the modified S protein comprises an S1+S2 truncated protein lacking the carboxy terminus of the protein. In some embodiments, the S1+S2 truncated protein comprises amino acids 1 to 1213 (SEQ ID NO: 13) of the SARS-CoV2 S protein, as provided for in Table 5, or an amino acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 15, which provides a nucleic acid sequence encoding the S1+S2 truncated protein derived from the native SARS-CoV2 sequence, or a nucleic acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 16, which provides an optimized nucleic acid sequence encoding the S1+S2 truncated protein, or a nucleic acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the S1+S2 truncated protein comprises amino acids 1 to 1213 and two proline substitutions at amino acids 986 and 987 (SEQ ID NO: 14) of the SARS-CoV2 S protein, as provided for in Table 5, or an amino acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 17, which provides an optimized nucleic acid sequence encoding the S1+S2 truncated protein +K986P and V987P, or a nucleic acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In certain embodiments, an additional nucleic acid sequence encoding a tag may be included in the nucleic acid sequence to be inserted into the rMVA, so that the tag is expressed at the C-terminus of the protein. In some embodiments, the nucleic acid sequence (GAGCCAGAGGCT) (SEQ ID NO: 4) encodes for the high affinity C-tag having the amino acid sequence EPEA (SEQ ID NO: 5).

(181) TABLE-US-00005 TABLE5 TruncatedS1+S2SARS-CoV2Protein SEQIDNO:13- MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFL SARS-CoV2 PFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDS truncatedS1+S2 KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNC protein(aa1-1213). TFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSA LEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLK YNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNL CPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDL CFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKV GGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTN GVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTES NKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVL YQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPI GAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVT TEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNT QEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIK QYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGA GAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASAL GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGR LQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQ SAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRN FYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDV DLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWP SEQIDNO:14- MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFL SARS-CoV2 PFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDS truncatedS1+S2 KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNC protein+K986Pand TFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSA V987P(aa1-1213). LEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLK YNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNL CPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDL CFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKV GGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTN GVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTES NKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVL YQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPI GAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVT TEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNT QEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIK QYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGA GAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASAL GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDcustom character EAEVQIDRLITGRL QSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQS APHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNF YEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVD LGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWP SEQIDNO:15- ATGTTTGTTTTTCTTGTTTTATTGCCACTAGTCTCTAGTCAGTGTGTTAATCTTA SARS-CoV2nucleic CAACCAGAACTCAATTACCCCCTGCATACACTAATTCTTTCACACGTGGTGTT acidsequencefor TATTACCCTGACAAAGTTTTCAGATCCTCAGTTTTACATTCAACTCAGGACTTG truncatedS1+S2 TTCTTACCTTTCTTTTCCAATGTTACTTGGTTCCATGCTATACATGTCTCTGGGA protein(aa1-1213). CCAATGGTACTAAGAGGTTTGATAACCCTGTCCTACCATTTAATGATGGTGTT TATTTTGCTTCCACTGAGAAGTCTAACATAATAAGAGGCTGGATTTTTGGTAC TACTTTAGATTCGAAGACCCAGTCCCTACTTATTGTTAATAACGCTACTAATGT TGTTATTAAAGTCTGTGAATTTCAATTTTGTAATGATCCATTTTTGGGTGTTTA TTACCACAAAAACAACAAAAGTTGGATGGAAAGTGAGTTCAGAGTTTATTCT AGTGCGAATAATTGCACTTTTGAATATGTCTCTCAGCCTTTTCTTATGGACCTT GAAGGAAAACAGGGTAATTTCAAAAATCTTAGGGAATTTGTGTTTAAGAATA TTGATGGTTATTTTAAAATATATTCTAAGCACACGCCTATTAATTTAGTGCGTG ATCTCCCTCAGGGTTTTTCGGCTTTAGAACCATTGGTAGATTTGCCAATAGGT ATTAACATCACTAGGTTTCAAACTTTACTTGCTTTACATAGAAGTTATTTGACT CCTGGTGATTCTTCTTCAGGTTGGACAGCTGGTGCTGCAGCTTATTATGTGGGT TATCTTCAACCTAGGACTTTTCTATTAAAATATAATGAAAATGGAACCATTAC AGATGCTGTAGACTGTGCACTTGACCCTCTCTCAGAAACAAAGTGTACGTTGA AATCCTTCACTGTAGAAAAAGGAATCTATCAAACTTCTAACTTTAGAGTCCAA CCAACAGAATCTATTGTTAGATTTCCTAATATTACAAACTTGTGCCCTTTTGGT GAAGTTTTTAACGCCACCAGATTTGCATCTGTTTATGCTTGGAACAGGAAGAG AATCAGCAACTGTGTTGCTGATTATTCTGTCCTATATAATTCCGCATCATTTTC CACTTTTAAGTGTTATGGAGTGTCTCCTACTAAATTAAATGATCTCTGCTTTAC TAATGTCTATGCAGATTCATTTGTAATTAGAGGTGATGAAGTCAGACAAATCG CTCCAGGGCAAACTGGAAAGATTGCTGATTATAATTATAAATTACCAGATGAT TTTACAGGCTGCGTTATAGCTTGGAATTCTAACAATCTTGATTCTAAGGTTGGT GGTAATTATAATTACCTGTATAGATTGTTTAGGAAGTCTAATCTCAAACCTTTT GAGAGAGATATTTCAACTGAAATCTATCAGGCCGGTAGCACACCTTGTAATG GTGTTGAAGGTTTTAATTGTTACTTTCCTTTACAATCATATGGTTTCCAACCCA CTAATGGTGTTGGTTACCAACCATACAGAGTAGTAGTACTTTCTTTTGAACTTC TACATGCACCAGCAACTGTTTGTGGACCTAAAAAGTCTACTAATTTGGTTAAA AACAAATGTGTCAATTTCAACTTCAATGGTTTAACAGGCACAGGTGTTCTTAC TGAGTCTAACAAAAAGTTTCTGCCTTTCCAACAATTTGGCAGAGACATTGCTG ACACTACTGATGCTGTCCGTGATCCACAGACACTTGAGATTCTTGACATTACA CCATGTTCTTTTGGTGGTGTCAGTGTTATAACACCAGGAACAAATACTTCTAA CCAGGTTGCTGTTCTTTATCAGGATGTTAACTGCACAGAAGTCCCTGTTGCTAT TCATGCAGATCAACTTACTCCTACTTGGCGTGTTTATTCTACAGGTTCTAATGT TTTTCAAACACGTGCAGGCTGTTTAATAGGGGCTGAACATGTCAACAACTCAT ATGAGTGTGACATACCCATTGGTGCAGGTATATGCGCTAGTTATCAGACTCAG ACTAATTCTCCTCGGCGGGCACGTAGTGTAGCTAGTCAATCCATCATTGCCTA CACTATGTCACTTGGTGCAGAAAATTCAGTTGCTTACTCTAATAACTCTATTGC CATACCCACAAATTTTACTATTAGTGTTACCACAGAAATTCTACCAGTGTCTA TGACCAAGACATCAGTAGATTGTACAATGTACATTTGTGGTGATTCAACTGAA TGCAGCAATCTTTTGTTGCAATATGGCAGTTTTTGTACACAATTAAACCGTGCT TTAACTGGAATAGCTGTTGAACAAGACAAAAACACCCAAGAAGTTTTTGCAC AAGTCAAACAAATTTACAAAACACCACCAATTAAAGATTTTGGTGGTTTTAAT TTTTCACAAATATTACCAGATCCATCAAAACCAAGCAAGAGGTCATTTATTGA AGATCTACTTTTCAACAAAGTGACACTTGCAGATGCTGGCTTCATCAAACAAT ATGGTGATTGCCTTGGTGATATTGCTGCTAGAGACCTCATTTGTGCACAAAAG TTTAACGGCCTTACTGTTTTGCCACCTTTGCTCACAGATGAAATGATTGCTCAA TACACTTCTGCACTGTTAGCGGGTACAATCACTTCTGGTTGGACCTTTGGTGC AGGTGCTGCATTACAAATACCATTTGCTATGCAAATGGCTTATAGGTTTAATG GTATTGGAGTTACACAGAATGTTCTCTATGAGAACCAAAAATTGATTGCCAAC CAATTTAATAGTGCTATTGGCAAAATTCAAGACTCACTTTCTTCCACAGCAAG TGCACTTGGAAAACTTCAAGATGTGGTCAACCAAAATGCACAAGCTTTAAAC ACGCTTGTTAAACAACTTAGCTCCAATTTTGGTGCAATTTCAAGTGTTTTAAAT GATATCCTTTCACGTCTTGACAAAGTTGAGGCTGAAGTGCAAATTGATAGGTT GATCACAGGCAGACTTCAAAGTTTGCAGACATATGTGACTCAACAATTAATTA GAGCTGCAGAAATCAGAGCTTCTGCTAATCTTGCTGCTACTAAAATGTCAGAG TGTGTACTTGGACAATCAAAAAGAGTTGATTTTTGTGGAAAGGGCTATCATCT TATGTCCTTCCCTCAGTCAGCACCTCATGGTGTAGTCTTCTTGCATGTGACTTA TGTCCCTGCACAAGAAAAGAACTTCACAACTGCTCCTGCCATTTGTCATGATG GAAAAGCACACTTTCCTCGTGAAGGTGTCTTTGTTTCAAATGGCACACACTGG TTTGTAACACAAAGGAATTTTTATGAACCACAAATCATTACTACAGACAACAC ATTTGTGTCTGGTAACTGTGATGTTGTAATAGGAATTGTCAACAACACAGTTT ATGATCCTTTGCAACCTGAATTAGACTCATTCAAGGAGGAGTTAGATAAATAT TTTAAGAATCATACATCACCAGATGTTGATTTAGGTGACATCTCTGGCATTAA TGCTTCAGTTGTAAACATTCAAAAAGAAATTGACCGCCTCAATGAGGTTGCCA AGAATTTAAATGAATCTCTCATCGATCTCCAAGAACTTGGAAAGTATGAGCAG TATATAAAATGGCCA SEQIDNO:16- ATGTTCGTGTTCCTAGTCCTACTACCGCTAGTCTCTTCTCAGTGTGTAAACCTA SARS-CoV2nucleic ACAACGAGAACACAACTACCACCGGCGTACACCAATTCTTTCACAAGAGGAG acidsequencefor TATATTACCCGGACAAGGTGTTCAGATCCTCCGTACTACATTCTACACAGGAC truncatedS1+S2 CTATTCCTACCGTTCTTCTCTAACGTAACATGGTTCCACGCGATCCATGTCTCT protein(aa1-1213). GGAACAAACGGAACGAAGAGATTCGATAACCCGGTCTTGCCGTTCAACGATG GTGTATACTTTGCGTCCACCGAGAAGTCCAACATCATCAGAGGATGGATCTTC GGAACCACCTTGGATTCTAAGACCCAGTCCTTGCTAATCGTCAACAACGCGAC CAACGTCGTCATCAAAGTCTGCGAATTCCAGTTCTGTAACGACCCGTTCTTGG GAGTCTACTACCACAAGAACAACAAGTCCTGGATGGAATCCGAGTTCAGAGT CTACTCTTCCGCGAACAACTGCACCTTCGAATATGTATCTCAGCCGTTCCTAAT GGACCTAGAGGGAAAGCAGGGAAACTTCAAGAACCTAAGAGAGTTCGTATTC AAGAACATCGACGGATACTTCAAGATCTACTCCAAGCACACTCCGATCAACCT AGTTAGAGATCTACCGCAAGGATTCTCTGCGCTAGAACCGTTAGTAGATTTGC CGATCGGAATCAACATCACCAGATTCCAGACACTACTAGCGCTACACAGATCT TACCTAACGCCGGGAGATTCTTCTTCTGGATGGACTGCTGGTGCTGCGGCTTA TTATGTAGGATACCTACAGCCGAGAACCTTCCTATTGAAGTACAACGAAAAC GGAACCATCACCGATGCCGTAGATTGTGCTCTAGATCCGCTATCCGAAACGAA GTGCACCCTAAAGTCTTTCACCGTCGAGAAGGGAATCTACCAGACCTCCAACT TTAGAGTACAGCCGACCGAATCCATCGTCAGATTTCCGAACATCACGAACCTA TGTCCGTTCGGAGAAGTGTTCAACGCGACAAGATTTGCGTCTGTCTATGCGTG GAACAGAAAAAGAATCAGTAACTGCGTCGCGGACTACTCCGTCCTATACAAC TCTGCCTCTTTCTCCACGTTCAAATGCTACGGTGTATCTCCGACAAAGCTAAA CGATCTATGCTTCACCAACGTCTACGCGGACTCCTTCGTAATCAGAGGAGATG AAGTTAGACAGATTGCGCCGGGACAAACTGGAAAGATCGCGGATTATAACTA CAAGCTACCGGACGACTTCACCGGATGTGTAATTGCGTGGAATTCGAACAAC CTAGACTCCAAAGTCGGAGGAAACTACAACTACTTGTACAGACTATTCAGAA AGTCCAACCTAAAGCCGTTCGAGAGAGACATCTCCACCGAAATCTATCAGGC TGGATCTACACCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCCCGCTAC AGTCTTACGGATTTCAACCGACAAACGGTGTAGGATATCAGCCGTACAGAGT CGTCGTACTATCCTTCGAACTACTACATGCTCCGGCGACAGTATGTGGACCGA AAAAGTCTACCAACCTAGTCAAGAACAAATGCGTCAACTTTAACTTCAACGG ACTAACCGGAACCGGTGTCCTAACCGAATCTAACAAGAAGTTTCTACCGTTCC AGCAGTTCGGAAGAGATATCGCGGATACAACAGACGCTGTCAGAGATCCGCA AACCTTGGAGATCCTAGATATCACACCGTGTTCTTTCGGTGGTGTCTCTGTAAT TACTCCGGGAACGAACACCTCCAATCAAGTAGCGGTACTATACCAGGACGTG AACTGTACAGAAGTACCGGTAGCTATTCACGCGGATCAACTAACACCAACTT GGAGAGTGTACTCCACCGGATCTAACGTATTCCAAACAAGAGCGGGATGTCT AATCGGAGCGGAACACGTAAACAACTCCTACGAATGTGATATCCCGATTGGA GCGGGAATCTGTGCGTCTTACCAAACACAAACAAACTCTCCGAGAAGAGCGA GATCTGTAGCCTCTCAATCTATTATCGCCTACACCATGTCCTTGGGAGCCGAA AATTCTGTCGCGTACTCCAACAATTCTATCGCGATCCCGACAAACTTCACCAT CTCTGTAACAACCGAGATCCTACCGGTGTCTATGACCAAGACATCTGTCGATT GCACCATGTACATCTGCGGAGATTCCACCGAGTGCTCCAACCTACTACTACAG TACGGATCTTTCTGTACCCAGCTAAACAGAGCGTTGACTGGAATCGCTGTAGA GCAGGATAAGAACACTCAAGAGGTATTCGCGCAAGTCAAGCAGATCTATAAG ACTCCGCCGATCAAGGACTTCGGAGGTTTCAACTTCTCTCAGATCTTGCCGGA TCCGTCCAAACCGTCTAAGAGATCTTTCATCGAGGACCTACTATTCAACAAAG TCACCCTAGCTGACGCGGGATTCATCAAACAATACGGAGATTGCTTGGGAGA CATTGCGGCGAGAGATCTAATTTGCGCGCAGAAGTTTAACGGATTGACAGTA CTACCGCCGCTACTAACCGATGAGATGATTGCGCAGTACACGTCTGCTCTATT GGCGGGAACAATTACAAGTGGATGGACATTTGGAGCCGGTGCCGCTCTACAA ATTCCGTTTGCTATGCAAATGGCGTACAGATTCAACGGAATCGGAGTAACCCA GAACGTCTTGTACGAGAACCAGAAGCTAATCGCGAACCAGTTCAATTCCGCG ATCGGAAAGATCCAGGACAGTCTATCTTCTACTGCTTCGGCGTTGGGAAAGCT ACAGGATGTAGTAAATCAAAACGCGCAGGCGCTAAACACCTTGGTCAAGCAA CTATCCTCTAACTTCGGAGCGATCTCGTCCGTCCTAAACGACATCTTATCCAG ACTAGATAAGGTCGAAGCGGAGGTCCAGATCGATAGACTAATCACTGGAAGA TTGCAGTCCCTACAGACCTACGTAACACAGCAACTAATTAGAGCGGCGGAGA TTAGAGCCTCTGCTAATCTAGCTGCGACCAAGATGTCCGAATGTGTCTTGGGA CAATCCAAGAGAGTGGACTTCTGCGGAAAGGGATACCACCTAATGTCTTTCCC ACAATCTGCGCCGCATGGTGTCGTATTCCTACATGTAACATATGTGCCGGCGC AAGAAAAGAACTTCACAACAGCTCCAGCGATCTGCCATGATGGAAAAGCTCA TTTCCCGAGAGAGGGAGTCTTTGTCTCTAACGGAACTCATTGGTTCGTCACCC AGAGAAACTTCTACGAGCCGCAGATCATCACCACCGACAACACATTCGTCTC GGGAAACTGCGACGTGGTCATCGGAATCGTAAACAATACCGTCTACGATCCG TTGCAGCCGGAACTAGACTCCTTCAAAGAAGAGTTGGACAAGTACTTCAAGA ACCACACCTCTCCGGATGTGGACTTGGGAGATATCTCTGGAATCAACGCGTCC GTCGTCAACATCCAGAAAGAAATCGATAGATTGAACGAGGTCGCGAAGAACT TGAACGAGTCCCTAATCGACCTACAAGAGCTAGGAAAATACGAGCAGTACAT CAAGTGGCCG SEQIDNO:17- ATGTTCGTGTTCCTAGTCCTACTACCGCTAGTCTCTTCTCAGTGTGTAAACCTA SARS-CoV2nucleic ACAACGAGAACACAACTACCACCGGCGTACACCAATTCTTTCACAAGAGGAG acidsequencefor TATATTACCCGGACAAGGTGTTCAGATCCTCCGTACTACATTCTACACAGGAC truncatedS1+S2 CTATTCCTACCGTTCTTCTCTAACGTAACATGGTTCCACGCGATCCATGTCTCT protein GGAACAAACGGAACGAAGAGATTCGATAACCCGGTCTTGCCGTTCAACGATG (aa1-1213)+ GTGTATACTTTGCGTCCACCGAGAAGTCCAACATCATCAGAGGATGGATCTTC K986PandV987P- GGAACCACCTTGGATTCTAAGACCCAGTCCTTGCTAATCGTCAACAACGCGAC optimized. CAACGTCGTCATCAAAGTCTGCGAATTCCAGTTCTGTAACGACCCGTTCTTGG GAGTCTACTACCACAAGAACAACAAGTCCTGGATGGAATCCGAGTTCAGAGT CTACTCTTCCGCGAACAACTGCACCTTCGAATATGTATCTCAGCCGTTCCTAAT GGACCTAGAGGGAAAGCAGGGAAACTTCAAGAACCTAAGAGAGTTCGTATTC AAGAACATCGACGGATACTTCAAGATCTACTCCAAGCACACTCCGATCAACCT AGTTAGAGATCTACCGCAAGGATTCTCTGCGCTAGAACCGTTAGTAGATTTGC CGATCGGAATCAACATCACCAGATTCCAGACACTACTAGCGCTACACAGATCT TACCTAACGCCGGGAGATTCTTCTTCTGGATGGACTGCTGGTGCTGCGGCTTA TTATGTAGGATACCTACAGCCGAGAACCTTCCTATTGAAGTACAACGAAAAC GGAACCATCACCGATGCCGTAGATTGTGCTCTAGATCCGCTATCCGAAACGAA GTGCACCCTAAAGTCTTTCACCGTCGAGAAGGGAATCTACCAGACCTCCAACT TTAGAGTACAGCCGACCGAATCCATCGTCAGATTTCCGAACATCACGAACCTA TGTCCGTTCGGAGAAGTGTTCAACGCGACAAGATTTGCGTCTGTCTATGCGTG GAACAGAAAAAGAATCAGTAACTGCGTCGCGGACTACTCCGTCCTATACAAC TCTGCCTCTTTCTCCACGTTCAAATGCTACGGTGTATCTCCGACAAAGCTAAA CGATCTATGCTTCACCAACGTCTACGCGGACTCCTTCGTAATCAGAGGAGATG AAGTTAGACAGATTGCGCCGGGACAAACTGGAAAGATCGCGGATTATAACTA CAAGCTACCGGACGACTTCACCGGATGTGTAATTGCGTGGAATTCGAACAAC CTAGACTCCAAAGTCGGAGGAAACTACAACTACTTGTACAGACTATTCAGAA AGTCCAACCTAAAGCCGTTCGAGAGAGACATCTCCACCGAAATCTATCAGGC TGGATCTACACCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCCCGCTAC AGTCTTACGGATTTCAACCGACAAACGGTGTAGGATATCAGCCGTACAGAGT CGTCGTACTATCCTTCGAACTACTACATGCTCCGGCGACAGTATGTGGACCGA AAAAGTCTACCAACCTAGTCAAGAACAAATGCGTCAACTTTAACTTCAACGG ACTAACCGGAACCGGTGTCCTAACCGAATCTAACAAGAAGTTTCTACCGTTCC AGCAGTTCGGAAGAGATATCGCGGATACAACAGACGCTGTCAGAGATCCGCA AACCTTGGAGATCCTAGATATCACACCGTGTTCTTTCGGTGGTGTCTCTGTAAT TACTCCGGGAACGAACACCTCCAATCAAGTAGCGGTACTATACCAGGACGTG AACTGTACAGAAGTACCGGTAGCTATTCACGCGGATCAACTAACACCAACTT GGAGAGTGTACTCCACCGGATCTAACGTATTCCAAACAAGAGCGGGATGTCT AATCGGAGCGGAACACGTAAACAACTCCTACGAATGTGATATCCCGATTGGA GCGGGAATCTGTGCGTCTTACCAAACACAAACAAACTCTCCGAGAAGAGCGA GATCTGTAGCCTCTCAATCTATTATCGCCTACACCATGTCCTTGGGAGCCGAA AATTCTGTCGCGTACTCCAACAATTCTATCGCGATCCCGACAAACTTCACCAT CTCTGTAACAACCGAGATCCTACCGGTGTCTATGACCAAGACATCTGTCGATT GCACCATGTACATCTGCGGAGATTCCACCGAGTGCTCCAACCTACTACTACAG TACGGATCTTTCTGTACCCAGCTAAACAGAGCGTTGACTGGAATCGCTGTAGA GCAGGATAAGAACACTCAAGAGGTATTCGCGCAAGTCAAGCAGATCTATAAG ACTCCGCCGATCAAGGACTTCGGAGGTTTCAACTTCTCTCAGATCTTGCCGGA TCCGTCCAAACCGTCTAAGAGATCTTTCATCGAGGACCTACTATTCAACAAAG TCACCCTAGCTGACGCGGGATTCATCAAACAATACGGAGATTGCTTGGGAGA CATTGCGGCGAGAGATCTAATTTGCGCGCAGAAGTTTAACGGATTGACAGTA CTACCGCCGCTACTAACCGATGAGATGATTGCGCAGTACACGTCTGCTCTATT GGCGGGAACAATTACAAGTGGATGGACATTTGGAGCCGGTGCCGCTCTACAA ATTCCGTTTGCTATGCAAATGGCGTACAGATTCAACGGAATCGGAGTAACCCA GAACGTCTTGTACGAGAACCAGAAGCTAATCGCGAACCAGTTCAATTCCGCG ATCGGAAAGATCCAGGACAGTCTATCTTCTACTGCTTCGGCGTTGGGAAAGCT ACAGGATGTAGTAAATCAAAACGCGCAGGCGCTAAACACCTTGGTCAAGCAA CTATCCTCTAACTTCGGAGCGATCTCGTCCGTCCTAAACGACATCTTATCCAG ACTAGATcustom character GAAGCGGAGGTCCAGATCGATAGACTAATCACTGGAAG ATTGCAGTCCCTACAGACCTACGTAACACAGCAACTAATTAGAGCGGCGGAG ATTAGAGCCTCTGCTAATCTAGCTGCGACCAAGATGTCCGAATGTGTCTTGGG ACAATCCAAGAGAGTGGACTTCTGCGGAAAGGGATACCACCTAATGTCTTTCC CACAATCTGCGCCGCATGGTGTCGTATTCCTACATGTAACATATGTGCCGGCG CAAGAAAAGAACTTCACAACAGCTCCAGCGATCTGCCATGATGGAAAAGCTC ATTTCCCGAGAGAGGGAGTCTTTGTCTCTAACGGAACTCATTGGTTCGTCACC CAGAGAAACTTCTACGAGCCGCAGATCATCACCACCGACAACACATTCGTCTC GGGAAACTGCGACGTGGTCATCGGAATCGTAAACAATACCGTCTACGATCCG TTGCAGCCGGAACTAGACTCCTTCAAAGAAGAGTTGGACAAGTACTTCAAGA ACCACACCTCTCCGGATGTGGACTTGGGAGATATCTCTGGAATCAACGCGTCC GTCGTCAACATCCAGAAAGAAATCGATAGATTGAACGAGGTCGCGAAGAACT TGAACGAGTCCCTAATCGACCTACAAGAGCTAGGAAAATACGAGCAGTACAT CAAGTGGCCG

(182) In certain aspects, the SARS-CoV2 antigen expressed by the rMVA is a modified spike(S) protein, wherein the modified S protein comprises an S1+S2 truncated protein lacking the carboxy terminus of the protein, and further comprises one or more amino acid substitutions or deletions. In some embodiments, the S1+S2 truncated protein comprises amino acids 1 to 1213 (SEQ ID NO: 18) of the SARS-CoV2 S protein with K417T, E484K, and N501Y substitutions, as provided for in Table 6, or an amino acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the S1+S2 truncated protein comprises amino acids 1 to 1213 and two proline substitutions at amino acids 986 and 987, and amino acid substitutions K417T, E484K, and N501Y (SEQ ID NO: 19) of the SARS-CoV2 S protein, as provided for in Table 6, or an amino acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto.

(183) In some embodiments, the S protein expressed by the rMVA is a modified spike(S) protein, wherein the modified S protein comprises an S1+S2 truncated protein lacking the carboxy terminus of the protein, and further comprises one or more substitutions selected from K417T, E484K or N501Y of SEQ ID NO: 13 or 14, or an amino acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the mutation is K417N.

(184) In some embodiments, the S protein expressed by the rMVA is a modified spike(S) protein, wherein the modified S protein comprises an S1+S2 truncated protein lacking the carboxy terminus of the protein, and further comprises a deletion of one or more spike protein amino acids H69, V70, or Y144, or combinations thereof, of SEQ ID NO: 13 or 14, or an amino acid sequence 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the S protein expressed by the rMVA is a modified spike(S) protein, wherein the modified S protein comprises an S1+S2 truncated protein lacking the carboxy terminus of the protein, and further comprises one or more substitutions selected from D614G, A570D, P681H, T716I, S982A, D1118H, K417N, K417T, D215G, A701V, L18F, R246I, Y453F, 1692V, M1229I, N439K, A222V, S477N, or A376T, or combinations thereof, of SEQ ID NO: 13 or 14. In some embodiments, the S protein expressed by the rMVA is a modified spike(S) protein, wherein the modified S protein comprises an S1+S2 truncated protein lacking the carboxy terminus of the protein, and further comprises a deletion at amino acids 242-244 of SEQ ID NO: 13 or 14. In some embodiments, the S protein expressed by the rMVA is a modified spike(S) protein, wherein the modified S protein comprises an S1+S2 truncated protein lacking the carboxy terminus of the protein, and further comprises the following deletions and substitutions: deletion of amino acids 69-70, deletion of amino acid Y144, amino acid substitution N501Y, amino acid substitution A570D, amino acid substitution D614G, amino acid substitution P681H, amino acid substitution T716I, amino acid substitution S982A, and amino acid substitution D1118H, of SEQ ID NO: 13 or 14. In some embodiments, the S protein expressed by the rMVA is a modified spike(S) protein, wherein the modified S protein comprises an S1+S2 truncated protein lacking the carboxy terminus of the protein, and further comprises the following deletions and substitutions: N501Y, K417N or K417T, E484K, D80A, A701V, L18F, and amino acid deletion at amino acids 242-244, of SEQ ID NO: 13 or 14. In some embodiments, the S protein expressed by the rMVA is a modified spike(S) protein, wherein the modified S protein comprises an S1+S2 truncated protein lacking the carboxy terminus of the protein, and further comprises one or more of the following substitutions: D614G; D936Y; P1263L; L5F; N439K; R211; D839Y; L54F; A879S; L18F; F1121L; R847K; T478I; A829T; Q675H; S477N; H49Y; T29I; G769V; G1124V; V1176F; K1073N; P479S; Y145 deletion; E583D; R214L; A1020V; Q1208H; D215G; H146Y; S98F; T95I; G1219C; A846V; I197V; R102I; V367F; T572I; A1078S; A831V; P1162L; T73I; A845S; H245Y; L8V; Q675R; S254F; V483A; Q677H; D138H; D80Y; D1146H; E654D; H655Y; S50L; S939F; S943P; G485R; Q613H; T76I; V341I; M153I; S221L; T859I; W258L; L242F; P681L; V289I; A520S; V1104L; L176F; T307I; T716I; L141; A1087S; P26S; P330S; P384L; R765L; S940F; T323I; V826L; E1202Q; L1203F; L611F; V615I; A262S; A522V; A688V; A706V; A892S; E554D; Q836H; T1027I; T221; A222V; A27S; A626V; K1191N; M731I; P26L; S1147L; S255F; V308L; D80A; I670L; P251L; P631S; A344S; A771S; A879T; D1084Y; D253G; H1101Y; L1200F; Q14H; Q239K; A623V; D215Y; E1150D; G476S; K77M; M177I; P812S; S704L; T51I; T547I; T791I; V1122L; Y145H; D574Y; G142D; G181V; 1834T; N370S; P812L; S12F; T791P; V90F; W152L; A292S; A570V; A647S; A845V; D1163Y; G181R; L84I; L938F; P1143L; P809S; R78M; T1160I; V1133F; V213L; V615F; A831V; D839Y; D839N; D839E; S943P; or V622F; and combinations thereof, of SEQ ID NO: 13 or 14.

(185) In certain embodiments, an additional nucleic acid sequence encoding a tag may be included in the nucleic acid sequence to be inserted into the rMVA, so that the tag is expressed at the C-terminus of the protein. In some embodiments, the nucleic acid sequence (GAGCCAGAGGCT) (SEQ ID NO: 4) encodes for the high affinity C-tag having the amino acid sequence EPEA (SEQ ID NO: 5).

(186) TABLE-US-00006 TABLE6 TruncatedS1+S2SARS-CoV2Proteinwith SEQIDNO:18- MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFL SARS-CoV2 PFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDS truncatedS1+S2 KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNC protein(aa1-1213). TFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSA K417T,E484K,and LEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLK N501Y YNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNL CPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDL CFTNVYADSFVIRGDEVRQIAPGQTGcustom character IADYNYKLPDDFTGCVIAWNSNNLDSKV GGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVcustom character GFNCYFPLQSYGFQPT custom character GVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTE SNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVL YQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPI GAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVT TEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNT QEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIK QYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGA GAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASAL GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGR LQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQ SAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRN FYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDV DLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWP SEQIDNO:19- MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFL SARS-CoV2 PFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDS truncatedS1+S2 KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNC protein+K986Pand TFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSA V987P(aa1-1213)+ LEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLK K417T,E484K,and YNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNL N501Y. CPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDL CFTNVYADSFVIRGDEVRQIAPGQTGcustom character IADYNYKLPDDFTGCVIAWNSNNLDSKV GGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVcustom character GFNCYFPLQSYGFQPT custom character GVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTE SNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVL YQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPI GAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVT TEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNT QEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIK QYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGA GAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASAL GKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDcustom character EAEVQIDRLITGRL QSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQS APHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNF YEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVD LGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWP

(187) In certain aspects, the SARS-CoV2 antigen is a linear epitope of the S protein. In a particular embodiment, the linear epitope of the S protein is the receptor biding domain (RBD) of the SARS-CoV2 S protein. In some embodiments, the linear S epitope comprises amino acids 327 to 524 of the S protein (SEQ ID NO: 20), provided in Table 7 below, or an amino acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 22, which provides a nucleic acid sequence encoding the linear S epitope of amino acids 327 to 524 of the S Protein derived from the native sequence of SARS-CoV2, or a nucleic acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 24, which provides an optimized nucleic acid sequence encoding the linear S epitope of amino acids 327 to 524 of the S Protein, or a nucleic acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the linear S epitope comprises amino acids 331 to 524 of the S protein (SEQ ID NO: 21), provided in Table 7 below, or an amino acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 23, which provides a nucleic acid sequence encoding the linear S epitope of amino acids 331 to 524 of the S Protein derived from the native sequence of SARS-CoV2, or a nucleic acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 24, which provides an optimized nucleic acid sequence encoding the linear S epitope of amino acids 331 to 524 of the S Protein, or a nucleic acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the linear S epitope comprises amino acids 504 to 524 (SEQ ID NO: 26) of the RBD region of the SARS-CoV2 S protein, or an amino acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 27, which provides a nucleic acid sequence encoding the linear S epitope of amino acids 504 to 524 derived from the native sequence of SARS-CoV2, or a nucleic acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 28, which provides an optimized nucleic acid sequence encoding the linear S epitope of amino acids 504 to 524 of the RBD region of the SARS-CoV2 S protein, or a nucleic acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the linear S epitope comprises amino acids 473 to 490 (SEQ ID NO: 29) of the RBD region of the SARS-CoV2 S protein, or an amino acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the rMVA encodes SEQ ID NO:30, which provides a nucleic acid sequence encoding the linear S epitope of amino acids 473 to 490 derived from the native sequence of SARS-CoV2, or an amino acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises SEQ ID NO: 31, which provides an optimized nucleic acid sequence encoding the linear S epitope of amino acids 473 to 490 of the RBD region of the SARS-CoV2 S protein, or a nucleic acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto.

(188) In some embodiments, the linear epitope of the S protein is a receptor biding domain (RBD) consensus sequence.

(189) In certain embodiments, an additional nucleic acid sequence encoding a tag may be included in the nucleic acid sequence to be inserted into the rMVA, so that the tag is expressed at the C-terminus of the protein. In some embodiments, the nucleic acid sequence (GAGCCAGAGGCT) (SEQ ID NO: 4) encodes for the high affinity C-tag having the amino acid sequence EPEA (SEQ ID NO: 5).

(190) In some embodiments, the S protein RBD linear epitope includes the amino acid methionine at the NH-terminus encoded by the nucleic acid sequence ATG.

(191) TABLE-US-00007 TABLE7 ExemplarySARS-CoV2LinearSProteinRBDEpitopes SEQIDNO:20- VRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYG SARS-CoV2S VSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIA proteinRBDlinear WNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCY epitope(aa327-524) FPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATV SEQIDNO:21- NITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPT SARS-CoV2S KLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSN proteinRBDlinear NLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQS epitope(aa331-524) YGFQPTNGVGYQPYRVVVLSFELLHAPATV SEQIDNO:22- GTTAGATTTCCTAATATTACAAACTTGTGCCCTTTTGGTGAAGTTTTTAACGC SARS-CoV2nucleic CACCAGATTTGCATCTGTTTATGCTTGGAACAGGAAGAGAATCAGCAACTGT acidencodingS GTTGCTGATTATTCTGTCCTATATAATTCCGCATCATTTTCCACTTTTAAGTGT proteinRBDlinear TATGGAGTGTCTCCTACTAAATTAAATGATCTCTGCTTTACTAATGTCTATGC epitope(aa327-524) AGATTCATTTGTAATTAGAGGTGATGAAGTCAGACAAATCGCTCCAGGGCAA ACTGGAAAGATTGCTGATTATAATTATAAATTACCAGATGATTTTACAGGCT GCGTTATAGCTTGGAATTCTAACAATCTTGATTCTAAGGTTGGTGGTAATTAT AATTACCTGTATAGATTGTTTAGGAAGTCTAATCTCAAACCTTTTGAGAGAG ATATTTCAACTGAAATCTATCAGGCCGGTAGCACACCTTGTAATGGTGTTGA AGGTTTTAATTGTTACTTTCCTTTACAATCATATGGTTTCCAACCCACTAATG GTGTTGGTTACCAACCATACAGAGTAGTAGTACTTTCTTTTGAACTTCTACAT GCACCAGCAACTGTTTGTGGACCTAAAAAGTCTACTAATTTGGTTAAAAACA AATGTGTCAAT SEQIDNO:23- AATATTACAAACTTGTGCCCTTTTGGTGAAGTTTTTAACGCCACCAGATTTGC SARS-CoV2nucleic ATCTGTTTATGCTTGGAACAGGAAGAGAATCAGCAACTGTGTTGCTGATTAT acidencodingS TCTGTCCTATATAATTCCGCATCATTTTCCACTTTTAAGTGTTATGGAGTGTCT proteinRBDlinear CCTACTAAATTAAATGATCTCTGCTTTACTAATGTCTATGCAGATTCATTTGT epitope(aa331-524) AATTAGAGGTGATGAAGTCAGACAAATCGCTCCAGGGCAAACTGGAAAGAT TGCTGATTATAATTATAAATTACCAGATGATTTTACAGGCTGCGTTATAGCTT GGAATTCTAACAATCTTGATTCTAAGGTTGGTGGTAATTATAATTACCTGTAT AGATTGTTTAGGAAGTCTAATCTCAAACCTTTTGAGAGAGATATTTCAACTG AAATCTATCAGGCCGGTAGCACACCTTGTAATGGTGTTGAAGGTTTTAATTG TTACTTTCCTTTACAATCATATGGTTTCCAACCCACTAATGGTGTTGGTTACC AACCATACAGAGTAGTAGTACTTTCTTTTGAACTTCTACATGCACCAGCAACT GTTTGTGGACCTAAAAAGTCTACTAATTTGGTTAAAAACAAATGTGTCAAT SEQIDNO:24- GTCAGATTTCCGAACATCACGAACCTATGTCCGTTCGGAGAAGTGTTCAACG SARS-CoV2nucleic CGACAAGATTTGCGTCTGTCTATGCGTGGAACAGAAAAAGAATCAGTAACTG acidencodingS CGTCGCGGACTACTCCGTCCTATACAACTCTGCCTCTTTCTCCACGTTCAAAT proteinRBDlinear GCTACGGTGTATCTCCGACAAAGCTAAACGATCTATGCTTCACCAACGTCTA epitope(aa327-524)- CGCGGACTCCTTCGTAATCAGAGGAGATGAAGTTAGACAGATTGCGCCGGG optimized ACAAACTGGAAAGATCGCGGATTATAACTACAAGCTACCGGACGACTTCACC GGATGTGTAATTGCGTGGAATTCGAACAACCTAGACTCCAAAGTCGGAGGA AACTACAACTACTTGTACAGACTATTCAGAAAGTCCAACCTAAAGCCGTTCG AGAGAGACATCTCCACCGAAATCTATCAGGCTGGATCTACACCGTGTAATGG TGTCGAAGGATTCAACTGCTACTTCCCGCTACAGTCTTACGGATTTCAACCGA CAAACGGTGTAGGATATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAACT ACTACATGCTCCGGCGACAGTA SEQIDNO:25- AACATCACGAACCTATGTCCGTTCGGAGAAGTGTTCAACGCGACAAGATTTG SARS-CoV2nucleic CGTCTGTCTATGCGTGGAACAGAAAAAGAATCAGTAACTGCGTCGCGGACTA acidencodingS CTCCGTCCTATACAACTCTGCCTCTTTCTCCACGTTCAAATGCTACGGTGTAT proteinRBDlinear CTCCGACAAAGCTAAACGATCTATGCTTCACCAACGTCTACGCGGACTCCTT epitope(aa331-524)- CGTAATCAGAGGAGATGAAGTTAGACAGATTGCGCCGGGACAAACTGGAAA optimized GATCGCGGATTATAACTACAAGCTACCGGACGACTTCACCGGATGTGTAATT GCGTGGAATTCGAACAACCTAGACTCCAAAGTCGGAGGAAACTACAACTAC TTGTACAGACTATTCAGAAAGTCCAACCTAAAGCCGTTCGAGAGAGACATCT CCACCGAAATCTATCAGGCTGGATCTACACCGTGTAATGGTGTCGAAGGATT CAACTGCTACTTCCCGCTACAGTCTTACGGATTTCAACCGACAAACGGTGTA GGATATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACATGCTC CGGCGACAGTA SEQIDNO:26- YQPYRVVVLSFELLHAPATV SARS-CoV2S proteinRBDlinear epitope(aa504to 524) SEQIDNO:27- TACCAACCATACAGAGTAGTAGTACTTTCTTTTGAACTTCTACATGCACCAGC SARS-CoV2nucleic AACTGTT acidencodingS proteinRBDlinear epitope(aa504to 524) SEQIDNO:28- TATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACATGCTCCGGC SARS-CoV2nucleic GACAGTA acidencodingS proteinRBDlinear epitope(aa504to 524)-optimized SEQIDNO:29- YQAGSTPCNGVEGFNCYF SARS-CoV2S proteinRBDlinear epitope(aa473to 490) SEQIDNO:30- TATCAGGCCGGTAGCACACCTTGTAATGGTGTTGAAGGTTTTAATTGTTACTT SARS-CoV2nucleic T acidencodingS proteinRBDlinear epitope(aa473to 490) SEQIDNO:31- TATCAGGCTGGATCTACACCGTGTAATGGTGTCGAAGGATTCAACTGCTACT SARS-CoV2nucleic TC acidencodingS proteinRBDlinear epitope(aa473to 490)-optimized

(192) In some embodiments, the linear epitope of the S protein is the receptor biding domain (RBD) of the SARS-CoV2 S protein comprising one or more mutations or deletions. In some embodiments, the linear S epitope comprises amino acids 327 to 524 of the S protein (SEQ ID NO: 32), provided in Table 8 below, or an amino acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the linear S epitope comprises amino acids 331 to 524 of the S protein (SEQ ID NO: 33), provided in Table 8 below, or an amino acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto.

(193) In some embodiments, the receptor biding domain (RBD) of the SARS-CoV2 S protein comprises one or more mutations or deletions selected from K417T, K417N, E484K, or N501Y substitutions.

(194) In some embodiments, the S protein expressed by the rMVA is the receptor biding domain (RBD) of the SARS-CoV2 S protein comprising one or more substitutions selected from K417N, K417T, Y453F, N439K, S477N, or A376T, or combinations thereof, of SEQ ID NO: 20 or 21, or an amino acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto. In some embodiments, the S protein expressed by the rMVA is the receptor biding domain (RBD) of the SARS-CoV2 S protein comprising one or more of the following substitutions: N439K; T478I; S477N; P479S; V367F; V341I; P330S; P384L; A522V; and combinations thereof, of SEQ ID NO: 20 or 21, or an amino acid sequence 80%, 85%, 90%, 95%, 95%, or 99% homologous thereto.

(195) In certain embodiments, an additional nucleic acid sequence encoding a tag may be included in the nucleic acid sequence to be inserted into the rMVA, so that the tag is expressed at the C-terminus of the protein. In some embodiments, the nucleic acid sequence (GAGCCAGAGGCT) (SEQ ID NO: 4) encodes for the high affinity C-tag having the amino acid sequence EPEA (SEQ ID NO: 5).

(196) In some embodiments, the S protein RBD linear epitope includes the amino acid methionine at the NH-terminus encoded by the nucleic acid sequence ATG.

(197) TABLE-US-00008 TABLE8 ExemplarySARS-CoV2LinearSProteinRBDEpitopeswithK417T,E484K,and N501Ymutations SEQIDNO:32- VRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYG SARS-CoV2S VSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGcustom character IADYNYKLPDDFTGCVIA proteinRBDlinear WNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVcustom character GFNCY epitope(aa327-524) FPLQSYGFQPTcustom character GVGYQPYRVVVLSFELLHAPATV comprisingK417T, E484K,andN501Y SEQIDNO:33- NITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPT SARS-CoV2S KLNDLCFTNVYADSFVIRGDEVRQIAPGQTGcustom character IADYNYKLPDDFTGCVIAWNSN proteinRBDlinear NLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVcustom character GFNCYFPLQS epitope(aa331-524) YGFQPTcustom character GVGYQPYRVVVLSFELLHAPATV comprisingK417T, E484K,andN501Y

(198) In certain aspects, two or more linear epitopes of the S protein are encoded by the rMVA, wherein the two or more linear epitopes are separated by a spacer, for example a GPGPG spacer polypeptide. In some embodiments, the sequence inserted into the rMVA viral vector encodes linear epitopes separated by a spacer, wherein the linear epitopes include different S protein RBD peptides, for example (RBD Seq. 1-spacer-RBD Seq. 2), wherein RBD Seq. 1 is a first S protein RBD peptide, and RBD Seq. 2 is a second S protein RBD peptide. In some embodiments, the sequence inserted into the rMVA viral vector encodes a tandem repeat sequence, for example (RBD-spacer-RBD-spacer) x or (RBD Seq. 1-spacer-RBD Seq. 2-spacer) x, wherein x=2, 3, 4, 5, 6, 7, 8, 9, 10. In some embodiments, the RBD peptides are selected from one or more peptides derived from amino acids 331 to 524 of the SARS-CoV2 S protein. In some embodiments, the linear epitopes encoded by the rMVA are selected from the amino acids 504 to 524 and amino acids 473 to 490 of the SARS-CoV2 S protein. In some embodiments, the linear epitopes encoded by the rMVA are the amino acids 504 to 524 and amino acids 473 to 490 of the SARS-CoV2 S protein. In some embodiments, the sequence inserted into the MVA viral vector encodes a S protein RBD peptide containing tandem repeat sequence ((aa504-524)-spacer-(aa473-490)-spacer) x, wherein x=2, 3, 4, 5, 6, 7, 8, 9, 10. In some embodiments, x=3-7. In some embodiments, x=5. In some embodiments, the sequence inserted into the MVA viral vector encodes a S protein RBD peptide containing tandem repeat sequence ((aa504-524)-GPGPG-(aa473-490)-GPGPG) x, wherein x=2, 3, 4, 5, 6, 7, 8, 9, 10. In some embodiments, x=3-7. In some embodiments, x=5.

(199) In some embodiments, the MVA comprises a nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 34 provided in Table 9 below, which provides an exemplary amino acid sequence encoding S protein RBD peptides in a tandem repeat sequence ((aa504-524)-GPGPG-(aa473-490)-GPGPG)x. In some embodiment, the MVA comprises a nucleic acid sequence of SEQ ID NO: 35, which provides a nucleic acid sequence which encodes the tandem repeat sequence ((aa504-524)-GPGPG-(aa473-490)-GPGPG) x derived from the native SARS-CoV2 genomic sequence encoding amino acids 504-524 and amino acids 473-490, and including a nucleic acid sequence encoding the linker amino acid sequence GPGPG. In some embodiments, the MVA comprises a nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 36, which provides an amino acid sequence of S protein RBD peptides in a tandem repeat sequence ((aa504-524)-GPGPG-(aa473-490)-GPGPG) x, wherein in x=5, and SEQ ID NO: 37 provides a nucleic acid sequence encoding same which has been optimized. In some embodiments, the MVA comprises a nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 38 provided in Table 9 below, which provides an exemplary amino acid sequence encoding S protein RBD peptides in a tandem repeat sequence ((aa504-524)-GPGPG-(aa473-490)-GPGPG) x, and further comprising the substitution E484K. In some embodiments, the MVA comprises a nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 39, which provides an amino acid sequence of S protein RBD peptides in a tandem repeat sequence ((aa504-524)-GPGPG-(aa473-490)-GPGPG) x, wherein in x=5, and further comprising the substitution E484K. In some embodiments, the S protein RBD tandem repeats include the amino acid methionine at the NH-terminus encoded by the nucleic acid sequence ATG.

(200) TABLE-US-00009 TABLE9 SARS-CoV2SARS-CoV2SProteinRBDTandemRepeatSequences SEQIDNO: (YQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVEGFNCYFGPGPG)x,whereinx=2,3, 34-amino 4,5,6,7,8,9,10,ormorethan10. acidsequence ofSARS- CoV2S ProteinRBD Tandem Repeat Sequence. SEQIDNO: (TACCAACCATACAGAGTAGTAGTACTTTCTTTTGAACTTCTACATGCACCAGCAACTG 35-nucleic TTGGTCCTGGACCCGGTTATCAGGCCGGTAGCACACCTTGTAATGGTGTTGAAGGTTTT acidsequence AATTGTTACTTTGGTCCTGGACCCGGT)x,whereinx=2,3,4,5,6,7,8,9,10,ormorethan ofSARS- 10. CoV2S ProteinRBD Tandem Repeat Sequence. SEQIDNO: YQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVEGFNCYFGPGPGYQPYRVVVLSFE 36-amino LLHAPATVGPGPGYQAGSTPCNGVEGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGP acidsequence GYQAGSTPCNGVEGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNG ofSARS- VEGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVEGFNCYFGPGP CoV2S G ProteinRBD Tandem Repeat Sequence,x= 5. SEQIDNO: TATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACATGCTCCGGCGACAG 37-nucleic TAGGTCCTGGACCCGGTTATCAGGCTGGATCTACACCGTGTAATGGTGTCGAAGGATT acidsequence CAACTGCTACTTCGGTCCTGGACCCGGTTATCAGCCGTACAGAGTCGTCGTACTATCCT ofSARS- TCGAACTACTACATGCTCCGGCGACAGTAGGTCCTGGACCCGGTTATCAGGCTGGATC CoV2S TACACCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCGGTCCTGGACCCGGTTAT ProteinRBD CAGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACATGCTCCGGCGACAGTAG Tandem GTCCTGGACCCGGTTATCAGGCTGGATCTACACCGTGTAATGGTGTCGAAGGATTCAA Repeat CTGCTACTTCGGTCCTGGACCCGGTTATCAGCCGTACAGAGTCGTCGTACTATCCTTCG Sequence,x= AACTACTACATGCTCCGGCGACAGTAGGTCCTGGACCCGGTTATCAGGCTGGATCTAC 5;optimized ACCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCGGTCCTGGACCCGGTTATCAG CCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACATGCTCCGGCGACAGTAGGTC CTGGACCCGGTTATCAGGCTGGATCTACACCGTGTAATGGTGTCGAAGGATTCAACTG CTACTTCGGTCCTGGACCCGGT SEQIDNO: (YQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVKGFNCYFGPGPG)x,whereinx=2, 38-amino 3,4,5,6,7,8,9,10,ormorethan10. acidsequence ofSARS- CoV2S ProteinRBD Tandem Repeat Sequence (E484K) SEQIDNO: YQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVKGFNCYFGPGPGYQPYRVVVLSFE 39-amino LLHAPATVGPGPGYQAGSTPCNGVKGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGP acidsequence GYQAGSTPCNGVKGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNG ofSARS- VKGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVKGFNCYFGPGP CoV2S G ProteinRBD Tandem Repeat Sequence,x= 5(E484K)
Envelope (E) Protein

(201) The E protein is the smallest of the major structural proteins. During the replication cycle of, for example SARS, E is abundantly expressed inside the infected cell, but only a small portion is incorporated into the virion envelope. Venkatagopalan et al., Coronavirus envelope (E) protein remains at the site of assembly. Virology. 2015; 478:75-85. The majority of the protein in SARS infections, for example, is localized at the site of intracellular trafficking, viz. the ER, Golgi, and ERGIC, where it participates in CoV assembly and budding. Nieto-Torres et al., Subcellular location and topology of severe acute respiratory syndrome coronavirus envelope protein. Virology. 2011; 415 (2): 69-82.

(202) The amino acid sequence of the SARS-CoV2 envelope (E) protein is 75 amino acids in length. The E protein has been reported at GenBank Accession number QHD43418, and is reproduced in Table 10 (SEQ ID NO: 40) along with its corresponding nucleic acid sequence (SEQ ID NO: 41), which has been reported at GenBank Accession No. MN908947.3, and is located at nucleic acids 26245 to 26472 of the SARS-CoV2 genome. In some embodiments, the nucleic acid inserted into the MVA viral vector encodes an amino acid of SEQ ID NO: 40, or an amino acid 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the nucleic acid inserted into the MVA viral vector is SEQ ID NO: 41, or a nucleic acid 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the nucleic acid sequence encoding the E protein inserted into the MVA viral vector has been optimized, for example, as provided in SEQ ID NO: 42, or a nucleic acid 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto.

(203) In some embodiments, the nucleic acid inserted into the MVA viral vector encodes an amino acid of SEQ ID NO: 40, having one or more substitutions selected from S68F, L73F, P71L, S55F, R69I, T9I, V24M, D72H, T30I, S68C, V75L, V58F, V75F, or L21F, and combinations thereof, or an amino acid 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto.

(204) In certain embodiments, an additional nucleic acid sequence encoding a tag may be included in the nucleic acid sequence to be inserted into the rMVA, so that the tag is expressed at the C-terminus of the protein. In some embodiments, the nucleic acid sequence (GAGCCAGAGGCT) (SEQ ID NO: 4) encodes for the high affinity C-tag having the amino acid sequence EPEA (SEQ ID NO: 5).

(205) TABLE-US-00010 TABLE10 SARS-CoV2Envelope(E)Protein SEQIDNO:40- MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSF SARS-CoV2E YVYSRVKNLNSSRVPDLLV proteinaminoacid sequence SEQIDNO:41- ATGTACTCATTCGTTTCGGAAGAGACAGGTACGTTAATAGTTAATAGCGTAC SARS-CoV2nucleic TTCTTTTTCTTGCTTTCGTGGTATTCTTGCTAGTTACACTAGCCATCCTTACTG acidsequenceforE CGCTTCGATTGTGTGCGTACTGCTGCAATATTGTTAACGTGAGTCTTGTAAAA protein CCTTCTTTTTACGTTTACTCTCGTGTTAAAAATCTGAATTCTTCTAGAGTTCCT GATCTTCTGGTC SEQIDNO:42- ATGTACTCCTTCGTGTCCGAAGAAACCGGAACCTTGATCGTCAACTCCGTCCT SARS-CoV2nucleic ACTATTCCTAGCGTTCGTCGTGTTCCTACTAGTAACCCTAGCTATCCTAACCG acidsequenceforE CGCTAAGACTATGTGCGTACTGCTGCAACATCGTCAACGTGTCCCTAGTGAA protein-optimized GCCGTCCTTCTACGTCTACTCCAGAGTCAAGAACCTAAACTCCTCTAGAGTCC CGGACCTACTAGTT
Membrane (M) Protein

(206) The coronavirus M protein is the most abundant structural protein and defines the shape of the viral envelope. Neuman et al., A structural analysis of M protein in coronavirus assembly and morphology. J Struct Biol. 2011; 174 (1): 11-22. It is also regarded as the central organizer of CoV assembly, interacting with all other major coronaviral structural proteins. Masters PS. The molecular biology of coronaviruses. Adv Virus Res. 2006; 66:193-292. Homotypic interactions between, for example, the SARS M proteins are the major driving force behind virion envelope formation but, alone, is not sufficient for virion formation. Neuman et al., J Struct Biol. 2011; 174 (1): 11-22; de Haan et al., Assembly of the coronavirus envelope: homotypic interactions between the M proteins. J Virol. 2000; 74 (11): 4967-78. With respect to, for example SARS, M and E make up the viral envelope and their interaction is sufficient for the production and release of VLPs. Mortola & Roy. Efficient assembly and release of SARS coronavirus-like particles by a heterologous expression system. FEBS Lett. 2004; 576 (1-2): 174-8.

(207) The amino acid sequence of the SARS-CoV2 membrane (M) protein is 222 amino acids in length. The M protein has been reported at GenBank Accession No. QHD43419, reproduced below in Table 11 as SEQ ID NO: 43, and its nucleic acid sequence, which is located at nucleic acids 26523 to 27191 of the SARS-CoV2 genome has been reported at GenBank Accession No. MN908947.3, and is reproduced below as SEQ ID NO: 44.

(208) In some embodiments, the nucleic acid sequence inserted into the MVA viral vector encodes an amino acid of SEQ ID NO: 43, or an amino acid 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the nucleic acid sequence inserted into the MVA viral vector is SEQ ID NO: 44, or a nucleic acid 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto. In some embodiments, the nucleic acid sequence encoding the M protein inserted into the MVA viral vector has been optimized, for example, as provided in SEQ ID NO: 45, or a nucleic acid 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto.

(209) In some embodiments, the nucleic acid sequence inserted into the MVA viral vector encodes an amino acid of SEQ ID NO: 43, further comprising one or more substitutions selected from T175M, D3G, V23L, W31C, A2V, V70F, W75L, M1091, 152T, L46F, V70I, D3Y, K162N, H125Y, K15R, D209Y, R146H, R158C, L87F, A2S, A69S, S214I, T208I, L124F, or S4F, and combinations thereof, or an amino acid 80%, 85%, 90%, 95%, 98%, or 99% homologous thereto.

(210) In certain embodiments, an additional nucleic acid sequence encoding a tag may be included in the nucleic acid sequence to be inserted into the rMVA, so that the tag is expressed at the C-terminus of the protein. In some embodiments, the nucleic acid sequence (GAGCCAGAGGCT) (SEQ ID NO: 4) encodes for the high affinity C-tag having the amino acid sequence EPEA (SEQ ID NO: 5).

(211) TABLE-US-00011 TABLE11 SARS-CoV2MProtein SEQIDNO:43- MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWL SARS-CoV2M LWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMW proteinaminoacid SFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEI sequence. TVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ SEQIDNO:44- ATGGCAGATTCCAACGGTACTATTACCGTTGAAGAGCTTAAAAAGCTCCTTG SARS-CoV2nucleic AACAATGGAACCTAGTAATAGGTTTCCTATTCCTTACATGGATTTGTCTTCTA acidsequenceforM CAATTTGCCTATGCCAACAGGAATAGGTTTTTGTATATAATTAAGTTAATTTT protein. CCTCTGGCTGTTATGGCCAGTAACTTTAGCTTGTTTTGTGCTTGCTGCTGTTTA CAGAATAAATTGGATCACCGGTGGAATTGCTATCGCAATGGCTTGTCTTGTA GGCTTGATGTGGCTCAGCTACTTCATTGCTTCTTTCAGACTGTTTGCGCGTAC GCGTTCCATGTGGTCATTCAATCCAGAAACTAACATTCTTCTCAACGTGCCAC TCCATGGCACTATTCTGACCAGACCGCTTCTAGAAAGTGAACTCGTAATCGG AGCTGTGATCCTTCGTGGACATCTTCGTATTGCTGGACACCATCTAGGACGCT GTGACATCAAGGACCTGCCTAAAGAAATCACTGTTGCTACATCACGAACGCT TTCTTATTACAAATTGGGAGCTTCGCAGCGTGTAGCAGGTGACTCAGGTTTTG CTGCATACAGTCGCTACAGGATTGGCAACTATAAATTAAACACAGACCATTC CAGTAGCAGTGACAATATTGCTTTGCTTGTACAG SEQIDNO:45- ATGGCGGATTCTAACGGAACCATCACCGTCGAAGAGTTGAAGAAGCTACTA SARS-CoV2nucleic GAGCAGTGGAACCTAGTCATCGGATTCCTATTCCTAACCTGGATCTGCCTACT acidsequenceforM ACAGTTCGCGTACGCGAACAGGAACAGATTCTTGTACATCATCAAGCTAATC protein-optimized TTCCTATGGCTACTATGGCCGGTCACCTTGGCCTGCTTCGTTCTAGCTGCGGT CTACAGAATCAACTGGATCACAGGTGGAATCGCGATCGCTATGGCTTGTCTA GTAGGACTAATGTGGCTATCCTACTTCATCGCCTCCTTCAGACTATTCGCGAG AACCAGATCTATGTGGTCGTTCAACCCGGAGACGAACATCCTATTGAACGTA CCGCTACATGGAACCATCCTAACCAGACCGCTATTGGAATCCGAATTGGTTA TCGGAGCGGTCATCCTAAGAGGACATCTAAGAATTGCGGGACACCACCTAG GAAGATGTGACATCAAGGACCTACCGAAGGAGATCACCGTAGCGACCTCTA GAACCCTATCGTACTATAAGTTGGGAGCCTCTCAAAGAGTCGCGGGAGATTC TGGATTTGCGGCGTATTCTAGATACAGAATCGGGAACTACAAGCTAAACACC GACCACTCCTCCAGTTCCGATAATATCGCTCTACTAGTCCAG
Modified Vaccinia Ankara (MVA) Viral Vector

(212) As provided herein, a nucleic acid sequence encoding one or more SARS-CoV2 antigens or antigenic fragments thereof are inserted into the vaccinia virus strain modified vaccinia Ankara (MVA), which, when administered to the subject, is capable of expressing the one or more SARS-CoV2 antigens or antigenic fragments in the cells of a subject. The term modified vaccinia Ankara, modified vaccinia ankara, Modified Vaccinia Ankara, or MVA refers to a highly attenuated strain of vaccinia virus developed by Dr. Anton Mayr by serial passage on chick embryo fibroblast cells; or variants or derivatives thereof. MVA is reviewed in (Mayr, A. et al. 1975 Infection 3:6-14; Swiss U.S. Pat. No. 568,392). The complete genomic sequence of MVA is available as Genbank Accession No. U94848.

(213) Modified vaccinia Ankara (MVA) has been generated by long-term serial passages of the Ankara strain of vaccinia virus (CVA) on chicken embryo fibroblasts (for review see Mayr, A. et al. 1975 Infection 3:6-14; Swiss U.S. Pat. No. 568,392). The MVA virus is publicly available from American Type Culture Collection as ATCC No. VR-1508. MVA is distinguished by its great attenuation, as demonstrated by diminished virulence and reduced ability to replicate in primate cells, while maintaining good immunogenicity. The MVA virus has been analyzed to determine alterations in the genome relative to the parental CVA strain. Six major deletions of genomic DNA (deletion I, II, III, IV, V, and VI) totaling 31,000 base pairs have been identified (Meyer, H. et al. 1991 J Gen Virol 72:1031-1038). The resulting MVA virus is host cell restricted to avian cells.

(214) MVA replication in human cells has been found to be blocked late in infection preventing the assembly to mature infectious virions. Nevertheless, MVA is able to express viral and recombinant heterologous genes at high levels even in non-permissive cells (Sutter, G. and Moss, B. 1992 PNAS USA 89:10847-10851). Recombinant MVA can be prepared as set out hereinafter. In general, a DNA-construct which contains a DNA-sequence which codes for one or more SARS-CoV2 (heterologous) polypeptides flanked by MVA DNA sequences adjacent to a predetermined insertion site (as described further below) can be introduced into cells infected with MVA (for example chicken embryo fibroblast (CEF) cell, to allow homologous recombination. Once the DNA-construct has been introduced into the eukaryotic cell and the foreign DNA has recombined with the viral DNA, it is possible to isolate the desired recombinant MVA. The DNA-construct to be inserted can be linear or circular. A plasmid or polymerase chain reaction product is preferred. Such methods of making recombinant MVA vectors are described in, e.g., U.S. Pat. No. 9,453,239 incorporated by reference herein.

(215) For the expression of a heterologous DNA sequence or gene, it is necessary for regulatory sequences such as promoters, which are required for the transcription of the gene, to be present on the DNA. Because MVA is a cytoplasmic virus, suitable promoters include those derived from naturally occurring poxviral promoters. Poxviral genes, promoters, and transcription factors are divided into early, intermediate, and late classes, depending on their expression timing during poxvirus infections. See, e.g., Assarsson et al., Kinetic analysis of a complete poxvirus transcriptome reveals an immediate-early class of genes. PNAS 2008; 105 (6): 2140-2145. Yang Zet al., Genome-wide analysis of the 5 and 3 ends of vaccinia virus early mRNAs delineates regulatory sequences of annotated and anomalous transcripts. J Virol. 2011; 85 (12): 5897-5909. MVA replication in most mammalian cells (non-permissive cells) ceases during the assembly of progeny virions after all stages of expression occur. This supports the utility of all promoter classes, including late promoters, for controlling transgene expression. Sancho et al., The block in assembly of modified vaccinia virus Ankara in Hela cells reveals new insights into vaccinia virus morphogenesis. J Virol. 2002; 76 (16): 8318-8334; Geiben-Lynn et al., Kinetics of recombinant adenovirus type 5, vaccinia virus, modified vaccinia ankara virus, and DNA antigen expression in vivo and the induction of memory T-lymphocyte responses. Clin Vaccine Immunol. 2008; 15 (4): 691-696. Some poxviral promoters have both early and late elements, allowing their open-reading frames (ORFs) or recombinant antigens to be expressed early in the virus infection and late after the viral genome replication, respectively. Broyles SS, Vaccinia virus transcription. J Gen Virol. 2003; 84 (Pt 9): 2293-2303. Poxviral promoters can be utilised cross-strain. See Prideaux et al., Comparative analysis of vaccinia virus promoter activity in fowlpox and vaccinia virus recombinants. Virus Res. 1990; 16 (1): 43-57; Tripathy et al., Regulation of foreign gene in fowlpox virus by a vaccinia virus promoter. Avian Dis. 1990; 34 (1): 218-220. Such regulatory sequences are known to those skilled in the art, and include for example the p11 promoter, which drives expression of the 11 k protein encoded by the F17R ORF (Wittek et al., Mapping of a gene coding for a major late structural polypeptide on the vaccinia virus genome. J Virol. 1984; 49 (2): 371-378); the p7.5 promoter (Cochran et al., In vitro mutagenesis of the promoter region for a vaccinia virus gene: evidence for tandem early and late regulatory signals. J Virol. 1985; 54 (1): 30-37); the pI1L promoter (Schmitt et al., Sequence and transcriptional analysis of the vaccinia virus HindIII I fragment. J Virol. 1988; 62 (6): 1889-1897); the pTK promoter (Weir and Moss, Determination of the promoter region of an early vaccinia virus gene encoding thymidine kinase. Virology. 1987; 158 (1): 206-210); the pF7L promoter (Coupar et al., Effect of in vitro mutations in a vaccinia virus early promoter region monitored by herpes simplex virus thymidine kinase expression in recombinant vaccinia virus. J Gen Virol. 1987; 68 (Pt 9): 2299-2309); the pH5 promoter (Perkus et al., Cloning and expression of foreign genes in vaccinia virus, using a host range selection system. J Virol. 1989; 63 (9): 3829-3836); the short synthetic promoter pSyn (Chakrabarti et al., Compact, synthetic, vaccinia virus early/late promoter for protein expression. Biotechniques. 1997; 23 (6): 1094-1097; Hammond et al., A synthetic vaccinia virus promoter with enhanced early and late activity. J Virol Methods. 1997; 66 (1): 135-1380); the pH5 promoter (Wyatt et al., Development of a replication-deficient recombinant vaccinia virus vaccine effective against parainfluenza virus 3 infection in an animal model. Vaccine. 1996; 14 (15): 1451-1458); the pmH5 promoter (Wyatt et al., Development of a replication-deficient recombinant vaccinia virus vaccine effective against parainfluenza virus 3 infection in an animal model. Vaccine. 1996; 14 (15): 1451-1458); the pHyb promoter (Sancho et al., The block in assembly of modified vaccinia virus Ankara in Hela cells reveals new insights into vaccinia virus morphogenesis. J Virol. 2002; 76 (16): 8318-8334); the LEO promoter (Wyatt et al., Correlation of immunogenicities and in vitro expression levels of recombinant modified vaccinia virus Ankara HIV vaccines. Vaccine. 2008; 26 (4): 486-493); the pB8 promoter (Orubu et al., Expression and cellular immunogenicity of a transgenic antigen driven by endogenous poxviral early promoters at their authentic loci in MVA. PLOS One. 2012; 7 (6): e40167); the pF11 promoter (Orubu et al., Expression and cellular immunogenicity of a transgenic antigen driven by endogenous poxviral early promoters at their authentic loci in MVA. PLOS One. 2012; 7 (6): e40167).

(216) In some embodiments, the promoter is a pmH5 promoter. In some embodiments, the comprises SEQ ID NO: promoter 154 (AAAAATTGAAAATAAATACAAAGGTTCTTGAGGGTTGTGTTAAATTGAAAGCGAGA AATAATCATAA).

(217) In some embodiments, the promoter is a p11 promoter. In some embodiments, the promoter comprises SEQ ID NO: 155 (TTTCATTTTGTTTTTTTCTATGCTATAA).

(218) The DNA-construct can be introduced into the MVA infected cells by transfection, for example by means of calcium phosphate precipitation (Graham et al. 1973 Virol 52:456-467; Wigler et al. 1979 Cell 16:777-785), by means of electroporation (Neumann et al. 1982 EMBO J. 1:841-845), by microinjection (Graessmann et al. 1983 Meth Enzymol 101:482-492), by means of liposomes (Straubinger et al. 1983 Meth Enzymol 101:512-527), by means of spheroplasts (Schaffher 1980 PNAS USA 77:2163-2167) or by other methods known to those skilled in the art.

(219) The present MVA vector design and methods of manufacture are useful in producing effective MVA vaccine vectors for eliciting effective T-cell and antibody immune responses against SARS-CoV2. In some embodiments, the MVA vaccine vectors described herein are capable of eliciting effective immune responses and antibody production after a single homologous prime boost.

(220) In some embodiments, the present invention provides recombinant viral vector (e.g., an MVA vector) comprising one or more nucleic acid sequences encoding a SARS-CoV2 protein or immunogenic fragments thereof. The viral vector (e.g., an MVA vector) may be constructed using conventional techniques known to one of skill in the art. The one or more heterologous SARS-CoV2 gene inserts encode a polypeptide having desired immunogenicity, i.e., a polypeptide that can induce an immune reaction, cellular immunity and/or humoral immunity, in vivo by administration thereof. In the introduction of a gene encoding a polypeptide having immunogenicity, an appropriate promoter may be operatively linked upstream of the gene encoding a polypeptide having desired immunogenicity.

(221) One or more nucleic acid sequences may be optimized for use in an MVA vector. Optimization includes codon optimization, which employs silent mutations to change selected codons from the native sequences into synonymous codons that are optimally expressed by the host-vector system. Other types of optimization include the use of silent mutations to interrupt homopolymer stretches or transcription terminator motifs. Each of these optimization strategies can improve the stability of the gene, improve the stability of the transcript, or improve the level of protein expression from the sequence. In exemplary embodiments, the number of homopolymer stretches in the heterologous DNA insert sequence will be reduced to stabilize the construct. A silent mutation may be provided for anything similar to a vaccinia termination signal.

(222) In exemplary embodiments, the sequences are codon optimized for expression in MVA; sequences with runs of >5 deoxyguanosines, >5 deoxycytidines, >5 deoxyadenosines, and >5 deoxythymidines are interrupted by silent mutation to minimize loss of expression due to frame shift mutations.

(223) In particular, the nucleic acid for insertion can be optimized by codon optimizing the original DNA sequence. For example, the Invitrogen GeneArt Gene Software can be used to codon optimize the DNA sequence. To fully optimize the gene sequence, homopolymer sequences (G/C or T/A rich areas) are interrupted via silent mutation(s). To the extent present in the nucleic acid insert sequence, the MVA transcription terminator (T5NT (UUUUUNU)) is interrupted via silent mutation(s). Further optimizations can include, for example, adding a Kozak sequence (GCCACC/ATG), adding a second stop codon, and adding a vaccinia virus transcription terminator, specifically TTTTTAT, or variations and/or combinations thereof.

(224) The DNA insert encoding the one or more SARS-CoV2 proteins or fragments thereof can be inserted into the MVA genome at any suitable location, for example, a natural deletion site, a modified natural deletion site, in a non-essential MVA gene, for example the MVA thymidine kinase locus, or in an intergenic region between essential or non-essential MVA genes. Suitable insertion sites have been described, for example, in U.S. Pat. Nos. 6,998,252, 9,133,478, Ober et al., Immunogenicity and safety of defective vaccinia virus lister: comparison with modified vaccinia virus Ankara. J. Virol., August 2002 (pg. 7713-7723), U.S. Pat. Nos. 9,133,480, 8,288,125, each of which is incorporated herein by reference.

(225) In some embodiments, the SARS-CoV2 peptide encoding sequence is inserted into a natural deletion site, for example a deletion site selected from the natural deletion sites I, II, III, IV, V or VI, a modified natural deletion site, for example the restructured and modified deletion III site between the MVA genes A50R and B1R (see, e.g., U.S. Pat. No. 9,133,480), between non-essential MVA genes, between essential MVA genes, for example I8R and GIL or A5R and A6L or other suitable insertion site, in a non-essential locus, for example in the MVA TK locus, or a combination thereof.

(226) Recombinant Modified Vaccinia Ankara (rMVA) Vaccine Constructs

(227) Provided herein are recombinant modified vaccinia Ankara (rMVA) viral vectors comprising heterologous nucleic acid inserts encoding one or more SARS-CoV2 proteins, peptides, or fragments thereof, operably linked to a promoter compatible with poxvirus expression systems that, upon expression, are capable of inducing protective immunity without inducing the immuno-pathologies associated with previous rMVA-related coronavirus vaccination strategies.

(228) SARS-CoV/2 S-E-M VLPs

(229) In one aspect, the recombinant MVA vaccine expresses the M and E proteins of SARS-CoV2, and the SARS-CoV2 S protein, or a fragment or variant thereof, as provided further below. Upon expression in a host cell, the SARS-CoV2 are capable of forming a non-infectious virus-like particle (VLP), enhancing epitope display, and inducing potent anti-viral immune responses.

(230) In some embodiments, an rMVA viral vector is provided which encodes the spike(S) protein (or fragment thereof), the envelope (E) protein, and the membrane (M) protein of the SARS-CoV2, wherein, upon expression of the S, E, and M protein, a VLP is formed. In some embodiments, the nucleic acid is arranged so that the S, E, and M encoding sequences are linearly adjacent. A linear representation of a single MVA insert encoding an S, E, and M protein suitable for forming a VLP upon expression is provided for in FIG. 1A. In some embodiments, the S protein is expressed as a full-length protein, for example, as provided for in SEQ ID NO: 1, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector comprising a nucleic acid sequence encoding SEQ ID NOS: 1, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the S protein is expressed as a full-length protein, for example, as provided for in SEQ ID NO: 6, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector comprising a nucleic acid sequence encoding SEQ ID NOS: 6, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 2, 41, and 44 or a sequence at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the full-length S, E, and M proteins, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 3, 42, and 45. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for detection of the expressed proteins in an assay. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence known in the art. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of each protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences comprising the adjacent coding sequences of the full-length S, E, and M proteins are provided below in as SEQ ID NOS: 46, 47, or 156. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 46 (FIG. 1B-1C-1D), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 47 (FIG. 1E-1F-1G), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 156 (FIG. 1H-1I-1J), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(231) Alternatively, an rMVA viral vector is provided which encodes the spike(S) protein, the envelope (E) protein, and the membrane (M) protein of the SARS-CoV2, wherein the S protein has been stabilized with one or more amino acid proline substitutions that stabilize the S protein trimer in the prefusion conformation, and wherein upon expression, the proteins form a VLP. In some embodiments, the nucleic acid is arranged so that the stabilized S, E, and M encoding sequences are linearly adjacent. In some embodiments, the S protein is expressed as a full-length protein and contains one or more proline substitutions at or near the boundary between a Heptad Repeat 1 (HR1) and a central helix of the promoters of the S ectodomain trimer. In some embodiments, the proline substitutions occur between amino acid residues 970 to 990 of the promoters in the trimer. In some embodiments, the S protein is expressed as a full-length protein and contains two proline substitutions at amino acids K986 and V987. A linear representation of a single MVA insert encoding a stabilized S, an E, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 2A. In some embodiments, the S protein is expressed as a full-length protein comprising two proline substitutions at amino acids 986 and 987 of the S protein, for example, as provided for in SEQ ID NO: 8, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 8, 40, and 43, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the S protein is expressed as a full-length protein comprising two proline substitutions at amino acids 986 and 987 of the S protein, for example, as provided for in SEQ ID NO: 11, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 11, 40, and 43, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 9, 41, and 44, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the full-length proline substituted S protein, the E protein, and M protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 10, 42, and 45, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the full-length proline substituted S protein, the E protein, and M protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 12, 42, and 45, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the full-length stabilized S protein, the E protein, and the M protein are provided below as SEQ ID NOS: 48, 49, 50, or 156. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 48 (FIG. 2B-2C-2D), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 49 (FIG. 2E-2F-2G), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 50 (2H-2I-2J), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 157 (2K-2L-2M), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 159 (2N-2O-2P), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 160 (2Q-2R-2S), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(232) Alternatively, an rMVA viral vector is provided which encodes a partial spike(S) protein, the envelope (E) protein, and the membrane (M) protein of the SARS-CoV2, wherein the partial S protein is the receptor biding domain (RBD) of the SARS-CoV2 S protein. In some embodiments, the linear S epitope comprises amino acids 327 to 524 of the S protein, and optionally further comprises an initial methionine amino acid residue at the NH-terminus. In some embodiments, the RBD sequence is a coronavirus consensus sequence. In some embodiments, the nucleic acid is arranged so that the S RBD, E, and M encoding sequences are linearly adjacent. A linear representation of a single MVA insert encoding a partial S protein encoding amino acids 327 to 524, an E protein, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 3D. In some embodiments, the partial S protein is expressed as provided for in SEQ ID NO: 20, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 22, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 24, 41, and 44, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the partial S protein, the E protein, and M protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 24, 42, and 45, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the partial S protein is expressed as provided for in SEQ ID NO: 32, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(233) In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the S protein RBD region, the E protein, and the M protein are provided as SEQ ID NOS: 51 or 52. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 51 (FIG. 3E), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 52 (FIG. 3F), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(234) Alternatively, in some embodiments, the linear S epitope comprises amino acids 331 to 524 of the S protein, and optionally further comprises a methionine at the NH-terminus of the RBD. In some embodiments, the nucleic acid is arranged so that the S RBD (aa 331-524), E, and M encoding sequences are linearly adjacent. A linear representation of a single MVA insert encoding a partial S protein encoding amino acids 331 to 524, an E protein, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 3A. In some embodiments, the partial S protein is expressed as provided for in SEQ ID NO: 21, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 23, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 25, 41, and 44, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the partial S protein, the E protein, and M protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 25, 42, and 45, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the partial S protein is expressed as provided for in SEQ ID NO: 33, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(235) In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the S protein RBD (aa 331-524) region, the E protein, and the M protein are provided as SEQ ID NOS: 53 or 54. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 53 (FIG. 3B), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 54 (FIG. 3C), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(236) In some embodiments, an rMVA viral vector is provided which encodes a partial spike(S) protein, the envelope (E) protein, and the membrane (M) protein of the SARS-CoV2, wherein the partial S protein is the receptor biding domain (RBD) of the SARS-CoV2 S protein, and wherein the RBD binding protein is flanked on its NH-terminus by a S protein signal peptide derived from amino acids 1 to 13 of the S protein, and flanked on its carboxy terminus by a S protein transmembrane domain derived from amino acids 1214 to 1273, or a fragment thereof. The flanking S protein signal peptide (SP) is provided below in Table 12 as SEQ ID NO: 55, and its nucleic acid sequence is provided as SEQ ID NO: 56. An optimized nucleic acid sequence of the SP is provided in SEQ ID NO: 59. The S protein transmembrane domain (STM) is provided below in Table 8 as SEQ ID NO: 57, and its nucleic acid sequence is provided as SEQ ID NO: 58, and an optimized nucleic acid sequence provided as SEQ ID NO: 60. In some embodiments, the linear S epitope comprises amino acids 327 to 524 of the S protein, flanked by the SP and STM. The SP-RBD (aa 327-524)-STM peptide is provided in SEQ ID NO: 61. In some embodiments, the linear S epitope comprises amino acids 331 to 524 of the S protein, flanked by the SP and STM. The SP-RBD (aa 331-524)-STM peptide is provided in SEQ ID NO: 62. In some embodiments, the nucleic acid is arranged so that the S SP-RBD-TM, E, and M encoding sequences are linearly adjacent. A linear representation of a single MVA insert encoding a partial S protein encoding amino acids 1-13 (SP), 331 to 524 (RBD), and 1214-1273 (STM), an E protein, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 3G. A linear representation of a single MVA insert encoding a partial S protein encoding amino acids 1-13 (SP), 327 to 524 (RBD), and 1214-1273 (STM), an E protein, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 3H. In some embodiments, the partial S protein SP-RBD (aa 327-524)-STM is expressed as provided for in SEQ ID NO: 61, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the partial S protein SP-RBD (aa 331-524)-STM is expressed as provided for in SEQ ID NO: 62, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 61 or 62, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 67 or 68, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 63 or 64, 41, and 44, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the partial S protein, the E protein, and M protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 65 or 66, 42, and 45, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the S protein SP-RBD (327-524)-STM region, the E protein, and the M protein are provided as SEQ ID NOS: 69 or 70. Exemplary nucleic acid sequences for insertion encoding the S protein SP-RBD (331-524)-STM region, the E protein, and the M protein are provided as SEQ ID NOS: 71 or 72. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NO: 69 (FIG. 3I-3J), 70 (FIG. 3K-3L), 71 (FIG. 3M-3N), or 72 (FIG. 3O-3P), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(237) In an alternate embodiment, the nucleic acid insert encodes a linear S epitope which further comprises a signal peptide, the E protein, and the M protein (see, e.g., FIG. 3Q, FIG. 3R, FIG. 3S, FIG. 3T). The S protein signal peptide can comprise or be derived from, for example, amino acids 1-13 (MFVFLVLLPLVSS) (SEQ ID NO: 55) of the SARS-CoV2 S protein. In some embodiments, the S protein encoded comprises an RBD consensus sequence. In some embodiments, the RBD consensus sequence further comprises an S protein signal peptide, for example derived from SEQ ID NO: 55. In some embodiments, the rMVA expresses the linear RBD epitope comprising amino acids 327-524. In some embodiments, the rMVA expresses the amino acid sequences comprising SEQ ID NOS: 55 and 20, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA expresses the linear RBD epitope comprising amino acids 331-524. In some embodiments, the rMVA expresses the amino acid sequences comprising SEQ ID NOS: 55 and 21, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA expresses the linear RBD epitope comprising amino acids 327-598. In some embodiments, the rMVA expresses the amino acid sequences comprising SEQ ID NOS: 55 and 161, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA expresses the linear RBD epitope comprising amino acids 331-598. In some embodiments, the rMVA expresses the amino acid sequences comprising SEQ ID NOS: 55 and 162, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the RBD peptide comprises substitutions K417T, E484K, and N501Y. In some embodiments, the rMVA expresses the amino acid sequences comprising SEQ ID NOS: 55 and 32, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA expresses the amino acid sequences comprising SEQ ID NOS: 55 and 33, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA expresses the amino acid sequences comprising SEQ ID NOS: 55 and 163, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA expresses the amino acid sequences comprising SEQ ID NOS: 55 and 164, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA encodes an amino acid sequence comprising SEQ ID NOS: 55, 20, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA encodes an amino acid sequence of SEQ ID NO: 55, 21, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA encodes amino acid sequences of SEQ ID NOS: 55, 32, 40, and 43 or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA encodes amino acid sequences comprising SEQ ID NOS: 55, 33, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA encodes amino acid sequences comprising SEQ ID NOS: 55, 161, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA encodes amino acid sequences comprising SEQ ID NOS: 55, 162, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA encodes amino acid sequences comprising SEQ ID NOS: 55, 163, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the rMVA encodes amino acid sequences comprising SEQ ID NOS: 164, 33, 40, and 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. In some embodiments, the rMVA comprises SEQ ID NO: 158 (FIG. 3U-3V), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(238) TABLE-US-00012 TABLE12 SPPeptide,TMPeptide,SP-RBD-STMPeptideSequences SEQIDNO:55- MFVFLVLLPLVSS Sproteinsignal peptideamino acids1to13 SEQIDNO:56- ATGTTTGTTTTTCTTGTTTTATTGCCACTAGTCTCTAGT Sproteinsignal peptidenucleic acidsequence SEQIDNO:57- WYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVK Sprotein LHYT transmembrane domainamino acids1214to1273 SEQIDNO:58- TGGTACATTTGGCTAGGTTTTATAGCTGGCTTGATTGCCATAGTAATGGTGACAA Sprotein TTATGCTTTGCTGTATGACCAGTTGCTGTAGTTGTCTCAAGGGCTGTTGTTCTTG transmembrane TGGATCCTGCTGCAAATTTGATGAAGACGACTCTGAGCCAGTGCTCAAAGGAGT domainnucleic CAAATTACATTACACA acidsequence SEQIDNO:59- ATGTTCGTGTTCCTAGTCCTACTACCGCTAGTCTCTTCT Sproteinsignal peptidenucleic acidsequence- optimized SEQIDNO:60- TGGTACATCTGGCTAGGATTCATTGCTGGACTAATTGCGATCGTCATGGTCACC Sprotein ATCATGCTATGCTGTATGACCTCCTGTTGCTCCTGTCTAAAGGGATGTTGTTCCT transmembrane GCGGATCCTGTTGCAAGTTCGATGAAGATGATAGTGAACCGGTCCTAAAGGGTG domainnucleic TCAAGCTACACTACACA acidsequence- optimized Seq.IDNo.61- MFVFLVLLPLVSSVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYN SP-RBD(aa327- SASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPD 524)-STMpeptide DFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGV aminoacid EGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVWYIWLGFIAGLIAIV sequence MVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT Seq.IDNo.62- MFVFLVLLPLVSSNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASF SP-RBD(aa331- STFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTG 524)-STMpeptide CVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFN aminoacid CYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVWYIWLGFIAGLIAIVMVTIM sequence LCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT SEQIDNO:63- ATGTTTGTTTTTCTTGTTTTATTGCCACTAGTCTCTAGTGTTAGATTTCCTAATAT SP-RBD(aa327- TACAGTTAGATTTCCTAATATTACAAACTTGTGCCCTTTTGGTGAAGTTTTTAAC 524)-STMpeptide GCCACCAGATTTGCATCTGTTTATGCTTGGAACAGGAAGAGAATCAGCAACTGT nucleicacid GTTGCTGATTATTCTGTCCTATATAATTCCGCATCATTTTCCACTTTTAAGTGTTA sequence TGGAGTGTCTCCTACTAAATTAAATGATCTCTGCTTTACTAATGTCTATGCAGAT TCATTTGTAATTAGAGGTGATGAAGTCAGACAAATCGCTCCAGGGCAAACTGGA AAGATTGCTGATTATAATTATAAATTACCAGATGATTTTACAGGCTGCGTTATA GCTTGGAATTCTAACAATCTTGATTCTAAGGTTGGTGGTAATTATAATTACCTGT ATAGATTGTTTAGGAAGTCTAATCTCAAACCTTTTGAGAGAGATATTTCAACTG AAATCTATCAGGCCGGTAGCACACCTTGTAATGGTGTTGAAGGTTTTAATTGTT ACTTTCCTTTACAATCATATGGTTTCCAACCCACTAATGGTGTTGGTTACCAACC ATACAGAGTAGTAGTACTTTCTTTTGAACTTCTACATGCACCAGCAACTGTTTGT GGACCTAAAAAGTCTACTAATTTGGTTAAAAACAAATGTGTCAATTGGTACATT TGGCTAGGTTTTATAGCTGGCTTGATTGCCATAGTAATGGTGACAATTATGCTTT GCTGTATGACCAGTTGCTGTAGTTGTCTCAAGGGCTGTTGTTCTTGTGGATCCTG CTGCAAATTTGATGAAGACGACTCTGAGCCAGTGCTCAAAGGAGTCAAATTACA TTACACA SEQIDNO:64- ATGTTTGTTTTTCTTGTTTTATTGCCACTAGTCTCTAGTAATATTACAAACTTGTG SP-RBD(aa331- CCCTTTTGGTGAAGTTTTTAACGCCACCAGATTTGCATCTGTTTATGCTTGGAAC 524)-STMpeptide AGGAAGAGAATCAGCAACTGTGTTGCTGATTATTCTGTCCTATATAATTCCGCA nucleicacid TCATTTTCCACTTTTAAGTGTTATGGAGTGTCTCCTACTAAATTAAATGATCTCT sequence GCTTTACTAATGTCTATGCAGATTCATTTGTAATTAGAGGTGATGAAGTCAGAC AAATCGCTCCAGGGCAAACTGGAAAGATTGCTGATTATAATTATAAATTACCAG ATGATTTTACAGGCTGCGTTATAGCTTGGAATTCTAACAATCTTGATTCTAAGGT TGGTGGTAATTATAATTACCTGTATAGATTGTTTAGGAAGTCTAATCTCAAACCT TTTGAGAGAGATATTTCAACTGAAATCTATCAGGCCGGTAGCACACCTTGTAAT GGTGTTGAAGGTTTTAATTGTTACTTTCCTTTACAATCATATGGTTTCCAACCCA CTAATGGTGTTGGTTACCAACCATACAGAGTAGTAGTACTTTCTTTTGAACTTCT ACATGCACCAGCAACTGTTTGTGGACCTAAAAAGTCTACTAATTTGGTTAAAAA CAAATGTGTCAATTGGTACATTTGGCTAGGTTTTATAGCTGGCTTGATTGCCATA GTAATGGTGACAATTATGCTTTGCTGTATGACCAGTTGCTGTAGTTGTCTCAAGG GCTGTTGTTCTTGTGGATCCTGCTGCAAATTTGATGAAGACGACTCTGAGCCAGT GCTCAAAGGAGTCAAATTACATTACACA SEQIDNO:65- ATGTTCGTGTTCCTAGTCCTACTACCGCTAGTCTCTTCTGTCAGATTTCCGAACA SP-RBD(aa327- TCACGAACCTATGTCCGTTCGGAGAAGTGTTCAACGCGACAAGATTTGCGTCTG 524)-STMpeptide TCTATGCGTGGAACAGAAAAAGAATCAGTAACTGCGTCGCGGACTACTCCGTCC nucleicacid TATACAACTCTGCCTCTTTCTCCACGTTCAAATGCTACGGTGTATCTCCGACAAA sequence GCTAAACGATCTATGCTTCACCAACGTCTACGCGGACTCCTTCGTAATCAGAGG optimized AGATGAAGTTAGACAGATTGCGCCGGGACAAACTGGAAAGATCGCGGATTATA ACTACAAGCTACCGGACGACTTCACCGGATGTGTAATTGCGTGGAATTCGAACA ACCTAGACTCCAAAGTCGGAGGAAACTACAACTACTTGTACAGACTATTCAGAA AGTCCAACCTAAAGCCGTTCGAGAGAGACATCTCCACCGAAATCTATCAGGCTG GATCTACACCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCCCGCTACAGT CTTACGGATTTCAACCGACAAACGGTGTAGGATATCAGCCGTACAGAGTCGTCG TACTATCCTTCGAACTACTACATGCTCCGGCGACAGTATGGTACATCTGGCTAG GATTCATTGCTGGACTAATTGCGATCGTCATGGTCACCATCATGCTATGCTGTAT GACCTCCTGTTGCTCCTGTCTAAAGGGATGTTGTTCCTGCGGATCCTGTTGCAAG TTCGATGAAGATGATAGTGAACCGGTCCTAAAGGGTGTCAAGCTACACTACACA SEQIDNO:66- ATGTTCGTGTTCCTAGTCCTACTACCGCTAGTCTCTTCTAACATCACGAACCTAT SP-RBD(aa331- GTCCGTTCGGAGAAGTGTTCAACGCGACAAGATTTGCGTCTGTCTATGCGTGGA 524)-STMpeptide ACAGAAAAAGAATCAGTAACTGCGTCGCGGACTACTCCGTCCTATACAACTCTG nucleicacid CCTCTTTCTCCACGTTCAAATGCTACGGTGTATCTCCGACAAAGCTAAACGATCT sequence ATGCTTCACCAACGTCTACGCGGACTCCTTCGTAATCAGAGGAGATGAAGTTAG optimized ACAGATTGCGCCGGGACAAACTGGAAAGATCGCGGATTATAACTACAAGCTAC CGGACGACTTCACCGGATGTGTAATTGCGTGGAATTCGAACAACCTAGACTCCA AAGTCGGAGGAAACTACAACTACTTGTACAGACTATTCAGAAAGTCCAACCTAA AGCCGTTCGAGAGAGACATCTCCACCGAAATCTATCAGGCTGGATCTACACCGT GTAATGGTGTCGAAGGATTCAACTGCTACTTCCCGCTACAGTCTTACGGATTTCA ACCGACAAACGGTGTAGGATATCAGCCGTACAGAGTCGTCGTACTATCCTTCGA ACTACTACATGCTCCGGCGACAGTATGGTACATCTGGCTAGGATTCATTGCTGG ACTAATTGCGATCGTCATGGTCACCATCATGCTATGCTGTATGACCTCCTGTTGC TCCTGTCTAAAGGGATGTTGTTCCTGCGGATCCTGTTGCAAGTTCGATGAAGAT GATAGTGAACCGGTCCTAAAGGGTGTCAAGCTACACTACACA Seq.IDNo.67- MFVFLVLLPLVSSVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYN SP-RBD(aa327- SASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGTIADYNYKLPD 524)-STMpeptide DFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGV aminoacid KGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVWYIWLGFIAGLIAIV sequence(K417T, MVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT E484K,N501Y) Seq.IDNo.68- MFVFLVLLPLVSSNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASF SP-RBD(aa331- STFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGTIADYNYKLPDDFTG 524)-STMpeptide CVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFN aminoacid CYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVWYIWLGFIAGLIAIVMVTIM sequence(K417T, LCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT E484K,N501Y) SEQIDNO:161 MFVFLVLLPLVSSVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYN SP-RBD(aa327- SASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGTIADYNYKLPD 598)peptide DFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGV aminoacid KGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKC Sequence VNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVS SEQIDNO:162 MFVFLVLLPLVSSNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASF SP-RBD(aa331- STFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTG 598)peptide CVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFN aminoacid CYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNF Sequence NGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVS SEQIDNO:163 MFVFLVLLPLVSSVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYN SP-RBD(aa327- SASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPD 598)peptide DFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGV aminoacid EGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCV Sequence(K417T, NFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVS E484K,N501Y) SEQIDNO:164 MFVFLVLLPLVSSNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASF SP-RBD(aa331- STFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGTIADYNYKLPDDFTG 598)peptide CVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFN aminoacid CYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVWYIWLGFIAGLIAIVMVTIM Sequence(K417T, LCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYTCGPKKSTNLVKNKCV E484K,N501Y) NFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVS

(239) Alternatively, an rMVA viral vector is provided which encodes a tandem repeat sequence, the envelope (E) protein, and the membrane (M) protein of the SARS-CoV2, wherein the tandem repeat sequence is derived from linear epitopes of the S protein RBD domain. In some embodiments, the tandem repeat is for example (RBD-spacer-RBD-spacer) x or (RBD Seq. 1-spacer-RBD Seq. 2-spacer) x, wherein RBD is any S protein RBD peptide, RBD Seq. 1 is a first S protein RBD peptide, and RBD Seq. 2 is a second S protein RBD peptide, and wherein x=2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, the tandem repeat optionally comprises a methionine amino acid at the NH-terminus. In some embodiments, the RBD peptides are selected from one or more peptides derived from amino acids 331 to 524 of the SARS-CoV2 S protein or 327-524 of the SARS-CoV2 S protein. In some embodiments, the linear epitopes encoded by the rMVA are selected from the amino acids 504 to 524 and amino acids 473 to 490 of the SARS-CoV2 S protein. In some embodiments, the linear epitopes encoded by the rMVA are the amino acids 504 to 524 and amino acids 473 to 490 of the SARS-CoV2 S protein. In some embodiments, the sequence inserted into the MVA viral vector encodes a S protein RBD peptide containing tandem repeat sequence ((aa504-524)-spacer-(aa473-490)-spacer) x, wherein x=2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, x=3-7. In some embodiments, x=5.

(240) In some embodiments, the nucleic acid is arranged so that the tandem repeat, E, and M encoding sequences are linearly adjacent. A linear representation of a single MVA insert encoding a tandem repeat, an E protein, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 4A. In some embodiments, the tandem repeat is expressed as provided for in SEQ ID NO: 34, further optionally comprising a methionine at the NH-terminus, wherein x is 2-10, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NO: 34, wherein x is 2-10 or more than 10, SEQ ID NO: 40, and SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NO: 38, wherein x is 2-10 or more than 10, SEQ ID NO: 40, and SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NO: 39, wherein x is 2-10 or more than 10, SEQ ID NO: 40, and SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NO: 35, wherein x is 2-10 or more than 10, SEQ ID NO: 41, and SEQ ID NO: 44, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NO: 36, SEQ ID NO: 41, and SEQ ID NO: 44, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding a tandem repeat, the E protein, and M protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 37, 42, and 45, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the tandem repeat, the E protein, and the M protein is provided as SEQ ID NOS: 73 or 74. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 73 (FIG. 4B-4C), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises a nucleic acid sequence of SEQ ID NO: 74 (FIG. 4D-4E), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(241) Alternatively, an rMVA viral vector is provided which encodes a tandem repeat sequence, the envelope (E) protein, and the membrane (M) protein of the SARS-CoV2, wherein the tandem repeat sequence is derived from linear epitopes of the S protein RBD domain, and is flanked on its NH-terminus by a SP peptide, for example, SEQ ID NO: 55, and flanked on its carboxy terminus by an STM, for example SEQ ID NO: 57. In some embodiments, the tandem repeat is for example (RBD-spacer-RBD-spacer) x or (RBD Seq. 1-spacer-RBD Seq. 2-spacer) x, wherein RBD is any S protein RBD peptide, RBD Seq. 1 is a first S protein RBD peptide, and RBD Seq. 2 is a second S protein RBD peptide, and wherein x=2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, the RBD peptides are selected from one or more peptides derived from amino acids 331 to 524 of the SARS-CoV2 S protein or from amino acids 327 to 524 of the SARS-CoV2 S protein. In some embodiments, the linear epitopes encoded by the rMVA are selected from the amino acids 504 to 524 and amino acids 473 to 490 of the SARS-CoV2 S protein. In some embodiments, the linear epitopes encoded by the rMVA are the amino acids 504 to 524 and amino acids 473 to 490 of the SARS-CoV2 S protein. In some embodiments, the sequence inserted into the MVA viral vector encodes a S protein RBD peptide containing tandem repeat sequence ((aa504-524)-spacer-(aa473-490)-spacer) x, wherein x=2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, x=3-7. In some embodiments, x=5.

(242) In some embodiments, the nucleic acid is arranged so that the SP-tandem repeat-TM, E, and M encoding sequences are linearly adjacent. A linear representation of a single MVA insert encoding a SP-tandem repeat-TM, an E protein, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 4F. In some embodiments, the SP-tandem repeat-TM is expressed as provided for in SEQ ID NO: 75, wherein x is 2-10, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NO: 77, SEQ ID NO: 40, and SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NO: 76, wherein x is 2-10, SEQ ID NO: 41, and SEQ ID NO: 44, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NO: 78, SEQ ID NO: 41, and SEQ ID NO: 44, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding a SP-tandem repeat-TM, the E protein, and M protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 76 or 78, 42, and 45, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(243) In some embodiments, the SP-tandem repeat-TM is expressed as provided for in SEQ ID NO: 79, wherein x is 2-10, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NO: 80, SEQ ID NO: 40, and SEQ ID NO: 43, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(244) In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the tandem repeat, the E protein, and the M protein are provided as SEQ ID NOS: 81 or 82. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NO: 81 (FIG. 4G-4H), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NO: 82 (FIG. 4I-4J), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(245) TABLE-US-00013 TABLE13 SP-RBDTandemRepeat-TM SEQIDNO: MFVFLVLLPLVSS(YQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVEGFNCYFGPG 75-amino PG)xWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKL acidsequence HYT,whereinx=2,3,4,5,6,7,8,9,or10. ofSARS- CoV2S ProteinSP- RBDTandem Repeat-TM Sequence. SEQIDNO: ATGTTTGTTTTTCTTGTTTTATTGCCACTAGTCTCTAGT(TACCAACCATACAGAGTAG 76-nucleic TAGTACTTTCTTTTGAACTTCTACATGCACCAGCAACTGTTGGTCCTGGACCCGGTTA acidsequence TCAGGCCGGTAGCACACCTTGTAATGGTGTTGAAGGTTTTAATTGTTACTTTGGTCCT ofSARS- GGACCCGGT)xTGGTACATTTGGCTAGGTTTTATAGCTGGCTTGATTGCCATAGTAATG CoV2S GTGACAATTATGCTTTGCTGTATGACCAGTTGCTGTAGTTGTCTCAAGGGCTGTTGTT ProteinSP- CTTGTGGATCCTGCTGCAAATTTGATGAAGACGACTCTGAGCCAGTGCTCAAAGGAG RBDTandem TCAAATTACATTACACA Repeat-TM whereinx=2,3,4,5,6,7,8,9,or10. Sequence. SEQIDNO: MFVFLVLLPLVSSYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVEGFNCYFGPGP 77-amino GYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVEGFNCYFGPGPGYQPYRVVVLS acidsequence FELLHAPATVGPGPGYQAGSTPCNGVEGFNCYFGPGPGYQPYRVVVLSFELLHAPATVG ofSARS- PGPGYQAGSTPCNGVEGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTP CoV2S CNGVEGFNCYFGPGPGWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFD ProteinSP- EDDSEPVLKGVKLHYT RBDTandem Repeat Sequence,x= 5-TM SEQIDNO: ATGTTCGTGTTCCTAGTCCTACTACCGCTAGTCTCTTCTTATCAGCCGTACAGAGTCGT 78-nucleic CGTACTATCCTTCGAACTACTACATGCTCCGGCGACAGTAGGTCCTGGACCCGGTTAT acidsequence CAGGCTGGATCTACACCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCGGTCCTG ofSARS- GACCCGGTTATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACATGCTCC CoV2S GGCGACAGTAGGTCCTGGACCCGGTTATCAGGCTGGATCTACACCGTGTAATGGTGT ProteinRED CGAAGGATTCAACTGCTACTTCGGTCCTGGACCCGGTTATCAGCCGTACAGAGTCGTC Tandem GTACTATCCTTCGAACTACTACATGCTCCGGCGACAGTAGGTCCTGGACCCGGTTATC Repeat AGGCTGGATCTACACCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCGGTCCTGG Sequence,x= ACCCGGTTATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACATGCTCCG 5;optimized GCGACAGTAGGTCCTGGACCCGGTTATCAGGCTGGATCTACACCGTGTAATGGTGTC GAAGGATTCAACTGCTACTTCGGTCCTGGACCCGGTTATCAGCCGTACAGAGTCGTC GTACTATCCTTCGAACTACTACATGCTCCGGCGACAGTAGGTCCTGGACCCGGTTATC AGGCTGGATCTACACCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCGGTCCTGG ACCCGGTTGGTACATCTGGCTAGGATTCATTGCTGGACTAATTGCGATCGTCATGGTC ACCATCATGCTATGCTGTATGACCTCCTGTTGCTCCTGTCTAAAGGGATGTTGTTCCT GCGGATCCTGTTGCAAGTTCGATGAAGATGATAGTGAACCGGTCCTAAAGGGTGTCA AGCTACACTACACA SEQIDNO: MFVFLVLLPLVSS(YQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVKGFNCYFGPG 79-amino PG)xWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKL acidsequence HYT,whereinx=2,3,4,5,6,7,8,9,or10. ofSARS- CoV2S ProteinSP- RBDTandem Repeat-TM Sequence (E484K) SEQIDNO: MFVFLVLLPLVSSYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVEGFNCYFGPGP 80-amino GYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVKGFNCYFGPGPGYQPYRVVVLS acidsequence FELLHAPATVGPGPGYQAGSTPCNGVEGFNCYFGPGPGYQPYRVVVLSFELLHAPATVG ofSARS- PGPGYQAGSTPCNGVEGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTP CoV2S CNGVEGFNCYFGPGPGWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFD ProteinSP- EDDSEPVLKGVKLHYT RBDTandem Repeat Sequence,x= 5-TM (E484K)

(246) Alternatively, an rMVA viral vector is provided which encodes a modified, truncated form of the spike(S) protein, the envelope (E) protein, and the membrane (M) protein of the SARS-CoV2, wherein the truncated S protein comprises a S1+S2 region and lacks the carboxy terminus, and wherein upon expression, the proteins form a VLP. In some embodiments, the nucleic acid is arranged so that the truncated S, E, and M encoding sequences are linearly adjacent. In some embodiments, the truncated S protein comprises amino acids 1 to 1213 (SEQ ID NO: 13). A linear representation of a single MVA insert encoding a truncated S, an E, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 6A. In some embodiments, the truncated S protein contains two proline substitutions at amino acids 986 and 987, for example, as exemplified in FIG. 6H. In some embodiments, the truncated S protein is expressed as provided for in SEQ ID NO: 13 or 14 or 18 or 19, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, and the M protein is expressed as a full length protein, as provided for in SEQ ID NO: 43, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 13 or 14 or 18 or 19, 40, and 43, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 15 or 17, 41, and 44, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the truncated S protein, the E protein, and M protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 16 or 17, 42, and 45, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequence for insertion encoding the truncated S protein, the E protein, and the M protein are provided below as SEQ ID NO: 83 or 84. Exemplary nucleic acid sequence for insertion encoding the truncated S protein +K986P and V987P, the E protein, and the M protein are provided below as SEQ ID NO: 85 or 86. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NOS: 83 (FIG. 6B-6C-6D), 84 (FIG. 6E-6F-6G), 85 (FIG. 6I-6J-6K), or 86 (FIG. 6L-6M-6N), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(247) S Fragment-GP Fusion VLPs

(248) In an alternative aspect, provided herein is a rMVA viral vector designed to express one or more SARS-CoV2 S protein antigenic peptides as an in-frame fusion protein, wherein the fusion protein comprises a signal sequence of an envelope glycoprotein (GPS), SARS-CoV2 S protein or protein fragment, a transmembrane domain of an envelope glycoprotein (GPTM), and, optionally, a cytosolic domain of an envelope glycoprotein (GPCD), wherein the envelope glycoprotein is not derived from a coronavirus. The rMVA viral vector is further designed to express a matrix protein from the same virus the envelope glycoprotein was derived from. By providing the SARS-CoV2 S protein fragment as a fusion with a GP protein, the S protein fragment-GP fusion can form a VLP with the rMVA expressed matrix protein. In some embodiments, the rMVA viral vector further expresses the membrane (M) protein and the envelope (E) protein of the SARS-CoV2, which, when expressed, are capable of forming a separate VLP. Thus, from a single rMVA viral vector, two VLPs are capable of being produced displaying antigenic epitopes of the SARS-CoV2.

(249) Suitable glycoproteins and matrix proteins for use in the present invention include, but are not limited to, those derived from: a Filoviridae, for example Marburg virus, Ebola virus, or Sudan virus; a Retroviridae, for example human immunodeficiency virus type 1 (HIV-1); an Arenaviridaea, for example Lassa virus; a Flaviviridae, for example Dengue virus and Zika virus.

(250) In particular embodiments, the glycoprotein and matrix proteins are derived from Marburg virus (MARV). In particular embodiments, the glycoprotein is derived from the MARV GP protein (Genbank accession number AFV31202.1). The amino acid sequence of the MARV GP protein is provided as SEQ ID NO: 87 in Table 14 below. In particular embodiments, the MARV GPS domain comprises amino acids 1 to 19 of the glycoprotein (MWTTCFFISLILIQGIKTL) (SEQ ID NO: 88, which can be encoded by, for example the MVA optimized nucleic acid sequence of SEQ ID NO: 89), the GPTM domain comprises amino acid sequences 644-673 of the glycoprotein (WWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG) (SEQ ID NO: 90, which can be encoded by, for example the MVA optimized nucleic acid sequence of SEQ ID NO: 91).

(251) The MARV VP40 amino acid sequence is available at GenBank accession number JX458834, and provided below in Table 14 as SEQ ID NO: 92, which can be encoded by, for example, the MVA optimized nucleic acid sequence of SEQ ID NO: 93. In some embodiments, the nucleic acid inserted into the rMVA is Seq.ID. No. 94, or a nucleic acid sequence 70%, 75%, 80%, 85%, 90%, 95% or more homologous thereto.

(252) TABLE-US-00014 TABLE14 MARVGlycoproteinDomainsforuseinSProteinFusionConstructs SEQIDNO:87- MWTTCFFISLILIQGIKTLPILEIASNDQPQNVDSVCSGTLQKTEDVHLMGFTLSGQK GPMARVamino VADSPLEASKRWAFRTGVPPKNVEYTEGEEAKTCYNISVTDPSGKSLLLDPPTNVR acidsequence DYPKCKTIHHIQGQNPHAQGIALHLWGAFFLYDRIASTTMYRGKVFTEGNIAAMIV NKTVHKMIFSRQGQGYRHMNLTSTNKYWTSSNGTQTNDTGCFGTLQEYNSTKNQ TCAPSKTPPPPPTAHPEIKPTSTPTDATRLNTTNPNSDDEDLTTSGSGSGEQEPYTTS DAVTKQGLSSTMPPTLSPQPGTPQQGGNNTNHSQDAATELDNTNTTAQPPMPSHN TTTISTNNTSKHNLSTLSEPPQNTTNPNTQSMATENEKTSAPPKTTLPPTESPTTEKS TNNTKSPTTMEPNTTNGHFTSPSSTPNSTTQHLIYFRRKRSILWREGDMFPFLDGLI NAPIDFDPVPNTKTIFDESSSSGASAEEDQHASSNISLTLSYLPHTSENTAYSGENEN DCDAELRIWSVQEDDLAAGLSWIPFFGPGIEGLYTAGLIKNQNNLVCRLRRLANQT AKSLELLLRVTTEERTFSLINRHAIDFLLTRWGGTCKVLGPDCCIGIEDLSRNISEQI DQIKKDEQKEGTGWGLGGKWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYI G SEQIDNO:88- MWTTCFFISLILIQGIKTL Signalpeptide aminoacid sequenceofGP MARV SEQIDNO:89- ATGTGGACGACCTGCTTCTTCATCTCCCTAATCCTAATCCAGGGAATCAAGACC Signalpeptide CTA nucleicacid sequenceofGP MARV-optimized SEQIDNO:90- WWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG Transmembrane domainaminoacid sequenceofGP MARV SEQIDNO:91- TGGTGGACATCTGACTGGGGAGTCCTAACGAACCTAGGAATCCTACTACTATT Transmembrane GTCGATCGCGGTCCTAATCGCGCTATCCTGTATCTGTAGAATCTTCACCAAGTA domainnucleic CATCGGA acidsequenceof GPMARV- optimized SEQIDNO:92- MASSSNYNTYMQYLNPPPYADHGANQLIPADQLSNQHGITPNYVGDLNLDDQFK MARVVP40 GNVCHAFTLEAIIDISAYNERTVKGVPAWLPLGIMSNFEYPLAHTVAALLTGSYTIT aminoacid QFTHNGQKFVRVNRLGTGIPAHPLRMLREGNQAFIQNMVIPRNFSTNQFTYNLTNL sequence VLSVQKLPDDAWRPSKDKLIGNTMHPAISIHPNLPPIVLPTVKKQAYRQHKNPNNG PLLAISGILHQLRVEKVPEKTSLFRISLPADMFSVKEGMMKKRGESSPVVYFQAPEN FPLNGFNNRQVVLAYANPTLSAI SEQIDNO:93- ATGGCGTCTAGTTCTAATTATAATACTTATATGCAATATCTAAATCCACCACCA MARVVP40 TATGCGGATCATGGTGCTAATCAACTAATTCCAGCGGATCAACTATCTAATCAA nucleicacid CATGGAATTACACCAAATTATGTTGGAGATCTAAATCTAGATGATCAGTTTAA sequence AGGAAATGTTTGTCATGCGTTTACACTAGAAGCGATTATTGATATTTCTGCGTA optimized TAATGAAAGAACAGTAAAAGGTGTACCAGCTTGGCTACCACTAGGAATTATGT CTAATTTTGAATATCCACTAGCGCATACAGTAGCGGCGCTATTGACAGGATCTT ATACAATTACACAGTTTACACATAATGGACAAAAGTTTGTTAGAGTAAATAGA CTAGGAACTGGAATACCAGCGCATCCACTAAGAATGCTAAGAGAAGGAAATC AAGCTTTTATTCAAAATATGGTTATTCCAAGAAATTTCTCTACAAATCAGTTTA CTTATAATCTAACTAATCTAGTACTATCTGTACAAAAGCTACCAGATGATGCTT GGAGACCATCTAAAGATAAACTAATTGGAAATACAATGCATCCAGCGATTTCT ATTCATCCAAATCTACCACCAATAGTACTACCAACTGTAAAGAAACAAGCGTA TAGACAACATAAGAATCCAAATAATGGACCACTATTGGCGATTTCTGGAATTC TACATCAACTAAGAGTAGAAAAGGTACCAGAAAAGACATCTTTGTTTAGAATT TCTCTACCAGCGGATATGTTTTCTGTAAAAGAAGGAATGATGAAGAAAAGAGG AGAATCTTCTCCAGTAGTATATTTTCAAGCGCCAGAAAATTTTCCATTGAATGG TTTTAATAATAGACAAGTAGTACTAGCGTATGCGAATCCAACACTATCTGCGAT ATAATAA SEQIDNO:94- AAAAATTGAAAATAAATACAAAGGTTCTTGAGGGTTGTGTTAAATTGAAAGCG MarburgVP40 AGAAATAATCATAAATGGCGTCTAGTTCTAATTATAATACTTATATGCAATATC OptimizedmH5 TAAATCCACCACCATATGCGGATCATGGTGCTAATCAACTAATTCCAGCGGAT VacciniaPromoter CAACTATCTAATCAACATGGAATTACACCAAATTATGTTGGAGATCTAAATCTA GATGATCAGTTTAAAGGAAATGTTTGTCATGCGTTTACACTAGAAGCGATTATT GATATTTCTGCGTATAATGAAAGAACAGTAAAAGGTGTACCAGCTTGGCTACC ACTAGGAATTATGTCTAATTTTGAATATCCACTAGCGCATACAGTAGCGGCGCT ATTGACAGGATCTTATACAATTACACAGTTTACACATAATGGACAAAAGTTTGT TAGAGTAAATAGACTAGGAACTGGAATACCAGCGCATCCACTAAGAATGCTAA GAGAAGGAAATCAAGCTTTTATTCAAAATATGGTTATTCCAAGAAATTTCTCTA CAAATCAGTTTACTTATAATCTAACTAATCTAGTACTATCTGTACAAAAGCTAC CAGATGATGCTTGGAGACCATCTAAAGATAAACTAATTGGAAATACAATGCAT CCAGCGATTTCTATTCATCCAAATCTACCACCAATAGTACTACCAACTGTAAAG AAACAAGCGTATAGACAACATAAGAATCCAAATAATGGACCACTATTGGCGAT TTCTGGAATTCTACATCAACTAAGAGTAGAAAAGGTACCAGAAAAGACATCTT TGTTTAGAATTTCTCTACCAGCGGATATGTTTTCTGTAAAAGAAGGAATGATGA AGAAAAGAGGAGAATCTTCTCCAGTAGTATATTTTCAAGCGCCAGAAAATTTT CCATTGAATGGTTTTAATAATAGACAAGTAGTACTAGCGTATGCGAATCCAAC ACTATCTGCGATATAATAATAATAATTTTTAT

(253) In one alternative, a rMVA viral vector is provided which encodes for an S protein or protein fragment fused with a GP protein, the E protein from SARS-CoV2, the M protein from SARS-CoV2, and a matrix protein. In some embodiments, the S protein or protein fragment-GP fusion, E, and M protein encoding nucleic acid sequences are inserted in a single insertion site in the rMVA, and the MARV VP40 encoding nucleic acid sequence is inserted at a separated insertion site. In some embodiments, the S protein or protein fragment-GP fusion, E, and M protein, and MARV VP40 encoding nucleic acid sequences are inserted in a single insertion site in the rMVA.

(254) In some embodiments, the S protein fragment-GP fusion protein comprises an S protein receptor biding domain (RBD). In some embodiments, the RBD peptide is derived from amino acids 327 to 524 of the S protein. In some embodiments, the RBD peptide is derived from amino acids 331 to 524 of the S protein. In some embodiments, the RBD is a consensus coronavirus sequence. The RBD peptide is flanked on its NH-terminus side by a signal peptide derived from amino acids 1-19 of the MARV glycoprotein (SEQ ID NO: 88), and on its carboxy-terminus side by the transmembrane domain of the MARV glycoprotein (SEQ ID NO: 90). The GPS-RBD (aa 327-524)-GPTM peptide expressed is provided in SEQ ID NO: 95 in Table 15 below, which can be encoded by, for example, an MVA optimized nucleic acid sequence for example provided in SEQ ID NO: 97. The GPS-RBD (aa 331-524)-GPTM peptide expressed is provided in SEQ ID NO: 96 in Table 15 below, which can be encoded by, for example, an MVA optimized nucleic acid sequence for example provided in SEQ ID NO: 98. In some embodiments, the nucleic acid is arranged so that the GPS-RBD-GPTM, E, and M encoding sequences are linearly adjacent. A linear representation of a rMVA comprising a MARV VP 40 insert and a separate, single MVA insert encoding GPS-RBD-TM, an E protein, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 7A. A linear representation of a rMVA comprising a MARV VP 40 insert and a separate, single MVA insert encoding GPS-RBD (aa 331-524)-TM, an E protein, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 7B. A linear representation of a rMVA comprising a MARV VP 40 insert and a separate, single MVA insert encoding GPS-RBD (aa 327-524)-TM, an E protein, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 7G. In some embodiments, GPS-RBD-GPTM is expressed as provided for in SEQ ID NO: 95 (RBD aa 327-524) or SEQ ID NO: 96 (RBD aa 331-524) or SEQ ID NO: 99 (RBD aa 327-524, E484K) or SEQ ID NO: 100 (RBD aa 331-524; E484K), the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, and the MARV VP protein is expressed as provided for in SEQ ID NO: 92, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 95 or 96 or 99 or 100, 40, 43, and 92, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 97 or 98, 41, and 44, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the GPS-RBD-GPTM, the E protein, and M protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 97 or 98, 42, and 45, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the GPS-RBD-GPTM, the E protein, and the M protein are provided as SEQ ID NOS: 101, 102, 103, and 104. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NOS: 101 (FIG. 7H-7I), 102 (FIG. 7J-7K), 103 (FIG. 7C-7D), or 104 (FIG. 7E-7F), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA further comprises a nucleic acid sequence of SEQ ID NO: 93 or 94, or a sequence at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(255) TABLE-US-00015 TABLE15 GPS-RBD-GPTMFusions SEQIDNO:95-GPS-RBD MWTTCFFISLILIQGIKTLVRFPNITNLCPFGEVFNATRFASVYAWNRKRIS (aa327-524)-GPTMFusion NCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQ Peptideaminoacidsequence IAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRK SNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYR VVVLSFELLHAPATVWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYI G SEQIDNO:96-GPS-RBD MWTTCFFISLILIQGIKTLNITNLCPFGEVFNATRFASVYAWNRKRISNCVA (aa331-524)-GPTMFusion DYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQ Peptideaminoacidsequence TGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKP FERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLS FELLHAPATVWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG SEQIDNO:97-GPS-RBD ATGTGGACGACCTGCTTCTTCATCTCCCTAATCCTAATCCAGGGAATCA (aa327-524)-GPTMFusion AGACCCTAGTCAGATTTCCGAACATCACGAACCTATGTCCGTTCGGAG Peptidenucleicacid AAGTGTTCAACGCGACAAGATTTGCGTCTGTCTATGCGTGGAACAGAA sequence-optimized AAAGAATCAGTAACTGCGTCGCGGACTACTCCGTCCTATACAACTCTG CCTCTTTCTCCACGTTCAAATGCTACGGTGTATCTCCGACAAAGCTAAA CGATCTATGCTTCACCAACGTCTACGCGGACTCCTTCGTAATCAGAGG AGATGAAGTTAGACAGATTGCGCCGGGACAAACTGGAAAGATCGCGG ATTATAACTACAAGCTACCGGACGACTTCACCGGATGTGTAATTGCGT GGAATTCGAACAACCTAGACTCCAAAGTCGGAGGAAACTACAACTAC TTGTACAGACTATTCAGAAAGTCCAACCTAAAGCCGTTCGAGAGAGAC ATCTCCACCGAAATCTATCAGGCTGGATCTACACCGTGTAATGGTGTC GAAGGATTCAACTGCTACTTCCCGCTACAGTCTTACGGATTTCAACCG ACAAACGGTGTAGGATATCAGCCGTACAGAGTCGTCGTACTATCCTTC GAACTACTACATGCTCCGGCGACAGTATGGTGGACATCTGACTGGGGA GTCCTAACGAACCTAGGAATCCTACTACTATTGTCGATCGCGGTCCTA ATCGCGCTATCCTGTATCTGTAGAATCTTCACCAAGTACATCGGA SEQIDNO:98-GPS-RBD ATGTGGACGACCTGCTTCTTCATCTCCCTAATCCTAATCCAGGGAATCA (aa331-524)-GPTMFusion AGACCCTAAACATCACGAACCTATGTCCGTTCGGAGAAGTGTTCAACG Peptidenucleicacid CGACAAGATTTGCGTCTGTCTATGCGTGGAACAGAAAAAGAATCAGTA sequence-optimized ACTGCGTCGCGGACTACTCCGTCCTATACAACTCTGCCTCTTTCTCCAC GTTCAAATGCTACGGTGTATCTCCGACAAAGCTAAACGATCTATGCTT CACCAACGTCTACGCGGACTCCTTCGTAATCAGAGGAGATGAAGTTAG ACAGATTGCGCCGGGACAAACTGGAAAGATCGCGGATTATAACTACA AGCTACCGGACGACTTCACCGGATGTGTAATTGCGTGGAATTCGAACA ACCTAGACTCCAAAGTCGGAGGAAACTACAACTACTTGTACAGACTAT TCAGAAAGTCCAACCTAAAGCCGTTCGAGAGAGACATCTCCACCGAA ATCTATCAGGCTGGATCTACACCGTGTAATGGTGTCGAAGGATTCAAC TGCTACTTCCCGCTACAGTCTTACGGATTTCAACCGACAAACGGTGTA GGATATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACAT GCTCCGGCGACAGTATGGTGGACATCTGACTGGGGAGTCCTAACGAAC CTAGGAATCCTACTACTATTGTCGATCGCGGTCCTAATCGCGCTATCCT GTATCTGTAGAATCTTCACCAAGTACATCGGA SEQIDNO:99-GPS-RBD MWTTCFFISLILIQGIKTLVRFPNITNLCPFGEVFNATRFASVYAWNRKRIS (aa327-524)-GPTMFusion NCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQ Peptideaminoacidsequence IAPGQTGTIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKS (K417T;E484K;N501Y) NLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRV VVLSFELLHAPATVWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG SEQIDNO:100-GPS- MWTTCFFISLILIQGIKTLNITNLCPFGEVFNATRFASVYAWNRKRISNCVA RBD(aa331-524)-GPTM DYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQ FusionPeptideaminoacid TGTIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKP sequence(K417T;E484K; FERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLS N501Y) FELLHAPATVWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG

(256) In one alternative, a rMVA viral vector is provided which encodes for an S protein peptide fused with a GP protein, the E protein from SARS-CoV2, the M protein from SARS-CoV2, and a matrix protein, wherein the S protein fragment-GP fusion protein comprises an S protein tandem repeat sequence. The S protein tandem repeat sequence is flanked on its NH-terminus side by a signal peptide derived from amino acids 1-19 of the MARV glycoprotein (SEQ ID NO: 88), and on its carboxy-terminus side by the transmembrane domain of the MARV glycoprotein (SEQ ID NO: 90). In some embodiments, the tandem repeat is for example (RBD-spacer-RBD-spacer) x or (RBD Seq. 1-spacer-RBD Seq. 2-spacer) x, wherein RBD is any S protein RBD peptide, RBD Seq. 1 is a first S protein RBD peptide, and RBD Seq. 2 is a second S protein RBD peptide, and wherein X=2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, the RBD peptides are selected from one or more peptides derived from amino acids 331 to 524 of the SARS-CoV2 S protein. In some embodiments, the linear epitopes encoded by the rMVA are selected from the amino acids 504 to 524 and amino acids 473 to 490 of the SARS-CoV2 S protein. In some embodiments, the linear epitopes encoded by the rMVA are the amino acids 504 to 524 and amino acids 473 to 490 of the SARS-CoV2 S protein. In some embodiments, the tandem repeat sequence is ((aa504-524)-spacer-(aa473-490)-spacer) x, wherein x=2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, x=3-7. In some embodiments, x=5. An exemplary amino acid sequence comprising a GPS-tandem repeat-GPTM is provided for in Table 16 as SEQ ID NO: 105, which can be encoded by the MVA optimized nucleic acid sequence of SEQ ID NO: 106. An exemplary amino acid sequence comprising a GPS-tandem repeat-GPTM, wherein x=5 for the tandem repeat, is provided for in Table 16 as SEQ ID NO: 107, which can be encoded by the MVA optimized nucleic acid sequence of SEQ ID NO: 108.

(257) In some embodiments, the nucleic acid is arranged so that the GPS-tandem repeat-GPTM peptide, E, and M encoding sequences are linearly adjacent. A linear representation of a rMVA comprising a MARV VP 40 insert and a separate, single MVA insert encoding GPS-tandem repeat-GPTM peptide, an E protein, and M protein suitable for forming a VLP upon expression is provided for in FIG. 8A. In some embodiments, GPS-tandem repeat-GPTM peptide is expressed as provided for in SEQ ID NO: 105 or 107 or 109 or 110, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, and the MARV VP protein is expressed as provided for in SEQ ID NO: 92, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 105 or 107 or 109 or 110, 40, and 43, and 92, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 106 or 108, 41, and 44, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the GPS-tandem repeat-GPTM peptide, the E protein, and M protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 106 or 108, 42, and 45, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the GPS-tandem repeat-GPTM peptide, the E protein, and the M protein are provided as SEQ ID NO: 111 and 112. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NO: 111 (FIG. 8B-8C) or 112 (FIG. 8D-8E), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA further comprises a nucleic acid sequence of SEQ ID NO: 93 or 94, or a sequence at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(258) TABLE-US-00016 TABLE16 GPS-RBDTandemRepeat-GPTM SEQIDNO:105-GPS- MWTTCFFISLILIQGIKTL(YQPYRVVVLSFELLHAPATVGPGPGYQAGSTPC RBDTandemRepeat- NGVEGFNCYFGPGPG)xWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKY GPTMaminoacid IG sequence whereinx=2,3,4,5,6,7,8,9,or10. SEQIDNO:106-GPS- ATGTGGACGACCTGCTTCTTCATCTCCCTAATCCTAATCCAGGGAATCA RBDTandemRepeat- AGACCCTA(TACCAACCATACAGAGTAGTAGTACTTTCTTTTGAACTTCT GPTMnucleicacid ACATGCACCAGCAACTGTTGGTCCTGGACCCGGTTATCAGGCCGGTAGC sequence-optimized ACACCTTGTAATGGTGTTGAAGGTTTTAATTGTTACTTTGGTCCTGGACC CGGT)xTGGTGGACATCTGACTGGGGAGTCCTAACGAACCTAGGAATCC TACTACTATTGTCGATCGCGGTCCTAATCGCGCTATCCTGTATCTGTAGA ATCTTCACCAAGTACATCGGA whereinx=2,3,4,5,6,7,8,9,or10. SEQIDNO:107-GPS- MWTTCFFISLILIQGIKTLYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPC RBDTandemRepeat- NGVEGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNG GPTMaminoacid VEGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVE sequence,whereinx= GFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVEGF 5 NCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVEGFNC YFGPGPGWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG SEQIDNO:108-GPS- ATGTGGACGACCTGCTTCTTCATCTCCCTAATCCTAATCCAGGGAATCA REDTandemRepeat- AGACCCTATATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACT GPTMnucleicacid ACATGCTCCGGCGACAGTAGGTCCTGGACCCGGTTATCAGGCTGGATCT sequence-optimized, ACACCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCGGTCCTGGAC whereinx=5 CCGGTTATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACA TGCTCCGGCGACAGTAGGTCCTGGACCCGGTTATCAGGCTGGATCTACA CCGTGTAATGGTGTCGAAGGATTCAACTGCTACTTCGGTCCTGGACCCG GTTATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACATGC TCCGGCGACAGTAGGTCCTGGACCCGGTTATCAGGCTGGATCTACACCG TGTAATGGTGTCGAAGGATTCAACTGCTACTTCGGTCCTGGACCCGGTT ATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACATGCTCC GGCGACAGTAGGTCCTGGACCCGGTTATCAGGCTGGATCTACACCGTGT AATGGTGTCGAAGGATTCAACTGCTACTTCGGTCCTGGACCCGGTTATC AGCCGTACAGAGTCGTCGTACTATCCTTCGAACTACTACATGCTCCGGC GACAGTAGGTCCTGGACCCGGTTATCAGGCTGGATCTACACCGTGTAAT GGTGTCGAAGGATTCAACTGCTACTTCGGTCCTGGACCCGGTTGGTGGA CATCTGACTGGGGAGTCCTAACGAACCTAGGAATCCTACTACTATTGTC GATCGCGGTCCTAATCGCGCTATCCTGTATCTGTAGAATCTTCACCAAG TACATCGGA SEQIDNO:109-GPS- MWTTCFFISLILIQGIKTL(YQPYRVVVLSFELLHAPATVGPGPGYQAGSTPC REDTandemRepeat- NGVKGFNCYFGPGPG)xWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTK GPTMaminoacid YIG sequence(E484K) whereinx=2,3,4,5,6,7,8,9,or10. SEQIDNO:110-GPS- MWTTCFFISLILIQGIKTLYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPC REDTandemRepeat- NGVKGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNG GPTMaminoacid VKGFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVK sequence,whereinx= GFNCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVKGF 5(E484K) NCYFGPGPGYQPYRVVVLSFELLHAPATVGPGPGYQAGSTPCNGVKGFNC YFGPGPGWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG

(259) In one alternative, a rMVA viral vector is provided which encodes for a modified S protein peptide fused with a GP protein, the E protein from SARS-CoV2, the M protein from SARS-CoV2, and a matrix protein, wherein the modified S protein comprises an S1+S2 truncated protein lacking the carboxy terminus of the protein. In some embodiments, the S1+S2 truncated protein comprises amino acids 2 to 1213 of the S protein. In some embodiments, the S1+S2 truncated protein comprises amino acids 2 to 1213 of the S protein, and a proline substitution at amino acid 986 and/or 987 (S1+S2 truncated+K986P and V987P). In some embodiments, the truncated S protein-GP fusion, E, and M protein encoding nucleic acid sequences are inserted in a single insertion site in the rMVA, and the MARV VP40 encoding nucleic acid sequence is inserted at a separated insertion site.

(260) In some embodiments, the truncated S protein-GP fusion protein comprises amino acids 2-1213 of the S Protein. The truncated S protein is flanked on its NH-terminus side by a signal peptide derived from amino acids 1-19 of the MARV glycoprotein (SEQ ID NO: 88), and on its carboxy-terminus side by the transmembrane domain of the MARV glycoprotein (SEQ ID NO: 90). The GPS-truncated S protein-GPTM peptide expressed is provided in SEQ ID NO: 113 in Table 17 below, which can be encoded by, for example, an MVA optimized nucleic acid sequence for example provided in SEQ ID NO: 115. The GPS-truncated S protein+K986P and V987P)-GPTM peptide expressed is provided in SEQ ID NO: 114 in Table 17 below, which can be encoded by, for example, an MVA optimized nucleic acid sequence for example provided in SEQ ID NO: 116. The GPS-truncated S protein-GPTM peptide expressed is provided in SEQ ID NO: 117 in Table 17 below, which further includes substitution K417T, E484K, and N501Y. The GPS-truncated S protein+K986P, V987P, K417T, E484K, and N501Y)-GPTM peptide expressed is provided in SEQ ID NO: 118 in Table 17 below. In some embodiments, the nucleic acid is arranged so that the GPS-truncated S-GPTM, E, and M encoding sequences are linearly adjacent. A linear representation of a rMVA comprising a MARV VP 40 insert and a separate, single MVA insert encoding GPS-truncated S-TM, an E protein, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 9A. In some embodiments, the nucleic acid is arranged so that the GPS-truncated S+K986P and V987P-GPTM, E, and M encoding sequences are linearly adjacent. A linear representation of a rMVA comprising a MARV VP 40 insert and a separate, single MVA insert encoding GPS-truncated S+K986P and V987P-TM, an E protein, and an M protein suitable for forming a VLP upon expression is provided for in FIG. 9H. In some embodiments, GPS-Truncated S-GPTM is expressed as provided for in SEQ ID NO: 113 or SEQ ID NO: 114 or SEQ ID NO: 117 or SEQ ID NO: 118, the E protein is expressed as a full-length protein, as provided for in SEQ ID NO: 40, the M protein is expressed as a full-length protein, as provided for in SEQ ID NO: 43, and the MARV VP protein is expressed as provided for in SEQ ID NO: 92, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 113 or 114 or 117 or 118, 40, and 43, and 92, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 115 or 116, 41, and 44, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the GPS-truncated S-GPTM, the E protein, and M protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 115 or 116, 42, and 45, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the GPS-truncated S-GPTM or GPS-truncated S+K986P and V987P), the E protein, and the M protein are provided as SEQ ID NOS: 119, 120, 121, or 122. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NO: 119 (FIG. 9B-9C-9D), 120 (FIG. 9E-9F-9G), 121 (FIG. 9I-9J-9K), or 122 (FIG. 9L-9M-9N), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA further comprises a nucleic acid sequence of SEQ ID NO: 93 or 94, or a sequence at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(261) TABLE-US-00017 TABLE17 GPS-TruncatedS-GPTM SEQIDNO:113-GPS- MWTTCFFISLILIQGIKTLFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGV truncatedS-GPTM YYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFND aminoacidsequence GVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLG VYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFV FKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSY LTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWN RKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEV RQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRK SNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVV VLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQ QFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVN CTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAG ICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTT EILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKN TQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADA GFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITS GWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQD SLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVE AEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVD FCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREG VFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELD SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL QELGKYEQYIKWPWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG SEQIDNO:114-GPS- MWTTCFFISLILIQGIKTLFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGV truncatedS+K986P YYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFND andV987P-GPTMamino GVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLG acidsequence VYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFV FKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSY LTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWN RKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEV RQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRK SNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVV VLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQ QFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVN CTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAG ICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTT EILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKN TQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADA GFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITS GWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQD SLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDcustom character EA EVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDF CGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREG VFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELD SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL QELGKYEQYIKWPWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG SEQIDNO:115-GPS- ATGTGGACGACCTGCTTCTTCATCTCCCTAATCCTAATCCAGGGAATCAAG truncatedS-GPTM ACCCTATTCGTGTTCCTAGTCCTACTACCGCTAGTCTCTTCTCAGTGTGTA nucleicacidsequence- AACCTAACAACGAGAACACAACTACCACCGGCGTACACCAATTCTTTCAC optimized AAGAGGAGTATATTACCCGGACAAGGTGTTCAGATCCTCCGTACTACATT CTACACAGGACCTATTCCTACCGTTCTTCTCTAACGTAACATGGTTCCACG CGATCCATGTCTCTGGAACAAACGGAACGAAGAGATTCGATAACCCGGTC TTGCCGTTCAACGATGGTGTATACTTTGCGTCCACCGAGAAGTCCAACAT CATCAGAGGATGGATCTTCGGAACCACCTTGGATTCTAAGACCCAGTCCT TGCTAATCGTCAACAACGCGACCAACGTCGTCATCAAAGTCTGCGAATTC CAGTTCTGTAACGACCCGTTCTTGGGAGTCTACTACCACAAGAACAACAA GTCCTGGATGGAATCCGAGTTCAGAGTCTACTCTTCCGCGAACAACTGCA CCTTCGAATATGTATCTCAGCCGTTCCTAATGGACCTAGAGGGAAAGCAG GGAAACTTCAAGAACCTAAGAGAGTTCGTATTCAAGAACATCGACGGAT ACTTCAAGATCTACTCCAAGCACACTCCGATCAACCTAGTTAGAGATCTA CCGCAAGGATTCTCTGCGCTAGAACCGTTAGTAGATTTGCCGATCGGAAT CAACATCACCAGATTCCAGACACTACTAGCGCTACACAGATCTTACCTAA CGCCGGGAGATTCTTCTTCTGGATGGACTGCTGGTGCTGCGGCTTATTATG TAGGATACCTACAGCCGAGAACCTTCCTATTGAAGTACAACGAAAACGGA ACCATCACCGATGCCGTAGATTGTGCTCTAGATCCGCTATCCGAAACGAA GTGCACCCTAAAGTCTTTCACCGTCGAGAAGGGAATCTACCAGACCTCCA ACTTTAGAGTACAGCCGACCGAATCCATCGTCAGATTTCCGAACATCACG AACCTATGTCCGTTCGGAGAAGTGTTCAACGCGACAAGATTTGCGTCTGT CTATGCGTGGAACAGAAAAAGAATCAGTAACTGCGTCGCGGACTACTCCG TCCTATACAACTCTGCCTCTTTCTCCACGTTCAAATGCTACGGTGTATCTC CGACAAAGCTAAACGATCTATGCTTCACCAACGTCTACGCGGACTCCTTC GTAATCAGAGGAGATGAAGTTAGACAGATTGCGCCGGGACAAACTGGAA AGATCGCGGATTATAACTACAAGCTACCGGACGACTTCACCGGATGTGTA ATTGCGTGGAATTCGAACAACCTAGACTCCAAAGTCGGAGGAAACTACA ACTACTTGTACAGACTATTCAGAAAGTCCAACCTAAAGCCGTTCGAGAGA GACATCTCCACCGAAATCTATCAGGCTGGATCTACACCGTGTAATGGTGT CGAAGGATTCAACTGCTACTTCCCGCTACAGTCTTACGGATTTCAACCGA CAAACGGTGTAGGATATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAA CTACTACATGCTCCGGCGACAGTATGTGGACCGAAAAAGTCTACCAACCT AGTCAAGAACAAATGCGTCAACTTTAACTTCAACGGACTAACCGGAACCG GTGTCCTAACCGAATCTAACAAGAAGTTTCTACCGTTCCAGCAGTTCGGA AGAGATATCGCGGATACAACAGACGCTGTCAGAGATCCGCAAACCTTGG AGATCCTAGATATCACACCGTGTTCTTTCGGTGGTGTCTCTGTAATTACTC CGGGAACGAACACCTCCAATCAAGTAGCGGTACTATACCAGGACGTGAA CTGTACAGAAGTACCGGTAGCTATTCACGCGGATCAACTAACACCAACTT GGAGAGTGTACTCCACCGGATCTAACGTATTCCAAACAAGAGCGGGATGT CTAATCGGAGCGGAACACGTAAACAACTCCTACGAATGTGATATCCCGAT TGGAGCGGGAATCTGTGCGTCTTACCAAACACAAACAAACTCTCCGAGAA GAGCGAGATCTGTAGCCTCTCAATCTATTATCGCCTACACCATGTCCTTGG GAGCCGAAAATTCTGTCGCGTACTCCAACAATTCTATCGCGATCCCGACA AACTTCACCATCTCTGTAACAACCGAGATCCTACCGGTGTCTATGACCAA GACATCTGTCGATTGCACCATGTACATCTGCGGAGATTCCACCGAGTGCT CCAACCTACTACTACAGTACGGATCTTTCTGTACCCAGCTAAACAGAGCG TTGACTGGAATCGCTGTAGAGCAGGATAAGAACACTCAAGAGGTATTCGC GCAAGTCAAGCAGATCTATAAGACTCCGCCGATCAAGGACTTCGGAGGTT TCAACTTCTCTCAGATCTTGCCGGATCCGTCCAAACCGTCTAAGAGATCTT TCATCGAGGACCTACTATTCAACAAAGTCACCCTAGCTGACGCGGGATTC ATCAAACAATACGGAGATTGCTTGGGAGACATTGCGGCGAGAGATCTAAT TTGCGCGCAGAAGTTTAACGGATTGACAGTACTACCGCCGCTACTAACCG ATGAGATGATTGCGCAGTACACGTCTGCTCTATTGGCGGGAACAATTACA AGTGGATGGACATTTGGAGCCGGTGCCGCTCTACAAATTCCGTTTGCTAT GCAAATGGCGTACAGATTCAACGGAATCGGAGTAACCCAGAACGTCTTGT ACGAGAACCAGAAGCTAATCGCGAACCAGTTCAATTCCGCGATCGGAAA GATCCAGGACAGTCTATCTTCTACTGCTTCGGCGTTGGGAAAGCTACAGG ATGTAGTAAATCAAAACGCGCAGGCGCTAAACACCTTGGTCAAGCAACTA TCCTCTAACTTCGGAGCGATCTCGTCCGTCCTAAACGACATCTTATCCAGA CTAGATAAGGTCGAAGCGGAGGTCCAGATCGATAGACTAATCACTGGAA GATTGCAGTCCCTACAGACCTACGTAACACAGCAACTAATTAGAGCGGCG GAGATTAGAGCCTCTGCTAATCTAGCTGCGACCAAGATGTCCGAATGTGT CTTGGGACAATCCAAGAGAGTGGACTTCTGCGGAAAGGGATACCACCTA ATGTCTTTCCCACAATCTGCGCCGCATGGTGTCGTATTCCTACATGTAACA TATGTGCCGGCGCAAGAAAAGAACTTCACAACAGCTCCAGCGATCTGCCA TGATGGAAAAGCTCATTTCCCGAGAGAGGGAGTCTTTGTCTCTAACGGAA CTCATTGGTTCGTCACCCAGAGAAACTTCTACGAGCCGCAGATCATCACC ACCGACAACACATTCGTCTCGGGAAACTGCGACGTGGTCATCGGAATCGT AAACAATACCGTCTACGATCCGTTGCAGCCGGAACTAGACTCCTTCAAAG AAGAGTTGGACAAGTACTTCAAGAACCACACCTCTCCGGATGTGGACTTG GGAGATATCTCTGGAATCAACGCGTCCGTCGTCAACATCCAGAAAGAAAT CGATAGATTGAACGAGGTCGCGAAGAACTTGAACGAGTCCCTAATCGACC TACAAGAGCTAGGAAAATACGAGCAGTACATCAAGTGGCCGTGGTGGAC ATCTGACTGGGGAGTCCTAACGAACCTAGGAATCCTACTACTATTGTCGA TCGCGGTCCTAATCGCGCTATCCTGTATCTGTAGAATCTTCACCAAGTACA TCGGA SEQIDNO:116-GPS- ATGTGGACGACCTGCTTCTTCATCTCCCTAATCCTAATCCAGGGAATCAAG truncatedS-GPTM ACCCTATTCGTGTTCCTAGTCCTACTACCGCTAGTCTCTTCTCAGTGTGTA nucleicacidsequence- AACCTAACAACGAGAACACAACTACCACCGGCGTACACCAATTCTTTCAC optimized AAGAGGAGTATATTACCCGGACAAGGTGTTCAGATCCTCCGTACTACATT CTACACAGGACCTATTCCTACCGTTCTTCTCTAACGTAACATGGTTCCACG CGATCCATGTCTCTGGAACAAACGGAACGAAGAGATTCGATAACCCGGTC TTGCCGTTCAACGATGGTGTATACTTTGCGTCCACCGAGAAGTCCAACAT CATCAGAGGATGGATCTTCGGAACCACCTTGGATTCTAAGACCCAGTCCT TGCTAATCGTCAACAACGCGACCAACGTCGTCATCAAAGTCTGCGAATTC CAGTTCTGTAACGACCCGTTCTTGGGAGTCTACTACCACAAGAACAACAA GTCCTGGATGGAATCCGAGTTCAGAGTCTACTCTTCCGCGAACAACTGCA CCTTCGAATATGTATCTCAGCCGTTCCTAATGGACCTAGAGGGAAAGCAG GGAAACTTCAAGAACCTAAGAGAGTTCGTATTCAAGAACATCGACGGAT ACTTCAAGATCTACTCCAAGCACACTCCGATCAACCTAGTTAGAGATCTA CCGCAAGGATTCTCTGCGCTAGAACCGTTAGTAGATTTGCCGATCGGAAT CAACATCACCAGATTCCAGACACTACTAGCGCTACACAGATCTTACCTAA CGCCGGGAGATTCTTCTTCTGGATGGACTGCTGGTGCTGCGGCTTATTATG TAGGATACCTACAGCCGAGAACCTTCCTATTGAAGTACAACGAAAACGGA ACCATCACCGATGCCGTAGATTGTGCTCTAGATCCGCTATCCGAAACGAA GTGCACCCTAAAGTCTTTCACCGTCGAGAAGGGAATCTACCAGACCTCCA ACTTTAGAGTACAGCCGACCGAATCCATCGTCAGATTTCCGAACATCACG AACCTATGTCCGTTCGGAGAAGTGTTCAACGCGACAAGATTTGCGTCTGT CTATGCGTGGAACAGAAAAAGAATCAGTAACTGCGTCGCGGACTACTCCG TCCTATACAACTCTGCCTCTTTCTCCACGTTCAAATGCTACGGTGTATCTC CGACAAAGCTAAACGATCTATGCTTCACCAACGTCTACGCGGACTCCTTC GTAATCAGAGGAGATGAAGTTAGACAGATTGCGCCGGGACAAACTGGAA AGATCGCGGATTATAACTACAAGCTACCGGACGACTTCACCGGATGTGTA ATTGCGTGGAATTCGAACAACCTAGACTCCAAAGTCGGAGGAAACTACA ACTACTTGTACAGACTATTCAGAAAGTCCAACCTAAAGCCGTTCGAGAGA GACATCTCCACCGAAATCTATCAGGCTGGATCTACACCGTGTAATGGTGT CGAAGGATTCAACTGCTACTTCCCGCTACAGTCTTACGGATTTCAACCGA CAAACGGTGTAGGATATCAGCCGTACAGAGTCGTCGTACTATCCTTCGAA CTACTACATGCTCCGGCGACAGTATGTGGACCGAAAAAGTCTACCAACCT AGTCAAGAACAAATGCGTCAACTTTAACTTCAACGGACTAACCGGAACCG GTGTCCTAACCGAATCTAACAAGAAGTTTCTACCGTTCCAGCAGTTCGGA AGAGATATCGCGGATACAACAGACGCTGTCAGAGATCCGCAAACCTTGG AGATCCTAGATATCACACCGTGTTCTTTCGGTGGTGTCTCTGTAATTACTC CGGGAACGAACACCTCCAATCAAGTAGCGGTACTATACCAGGACGTGAA CTGTACAGAAGTACCGGTAGCTATTCACGCGGATCAACTAACACCAACTT GGAGAGTGTACTCCACCGGATCTAACGTATTCCAAACAAGAGCGGGATGT CTAATCGGAGCGGAACACGTAAACAACTCCTACGAATGTGATATCCCGAT TGGAGCGGGAATCTGTGCGTCTTACCAAACACAAACAAACTCTCCGAGAA GAGCGAGATCTGTAGCCTCTCAATCTATTATCGCCTACACCATGTCCTTGG GAGCCGAAAATTCTGTCGCGTACTCCAACAATTCTATCGCGATCCCGACA AACTTCACCATCTCTGTAACAACCGAGATCCTACCGGTGTCTATGACCAA GACATCTGTCGATTGCACCATGTACATCTGCGGAGATTCCACCGAGTGCT CCAACCTACTACTACAGTACGGATCTTTCTGTACCCAGCTAAACAGAGCG TTGACTGGAATCGCTGTAGAGCAGGATAAGAACACTCAAGAGGTATTCGC GCAAGTCAAGCAGATCTATAAGACTCCGCCGATCAAGGACTTCGGAGGTT TCAACTTCTCTCAGATCTTGCCGGATCCGTCCAAACCGTCTAAGAGATCTT TCATCGAGGACCTACTATTCAACAAAGTCACCCTAGCTGACGCGGGATTC ATCAAACAATACGGAGATTGCTTGGGAGACATTGCGGCGAGAGATCTAAT TTGCGCGCAGAAGTTTAACGGATTGACAGTACTACCGCCGCTACTAACCG ATGAGATGATTGCGCAGTACACGTCTGCTCTATTGGCGGGAACAATTACA AGTGGATGGACATTTGGAGCCGGTGCCGCTCTACAAATTCCGTTTGCTAT GCAAATGGCGTACAGATTCAACGGAATCGGAGTAACCCAGAACGTCTTGT ACGAGAACCAGAAGCTAATCGCGAACCAGTTCAATTCCGCGATCGGAAA GATCCAGGACAGTCTATCTTCTACTGCTTCGGCGTTGGGAAAGCTACAGG ATGTAGTAAATCAAAACGCGCAGGCGCTAAACACCTTGGTCAAGCAACTA TCCTCTAACTTCGGAGCGATCTCGTCCGTCCTAAACGACATCTTATCCAGA CTAGATcustom character GAAGCGGAGGTCCAGATCGATAGACTAATCACTGGAA GATTGCAGTCCCTACAGACCTACGTAACACAGCAACTAATTAGAGCGGCG GAGATTAGAGCCTCTGCTAATCTAGCTGCGACCAAGATGTCCGAATGTGT CTTGGGACAATCCAAGAGAGTGGACTTCTGCGGAAAGGGATACCACCTA ATGTCTTTCCCACAATCTGCGCCGCATGGTGTCGTATTCCTACATGTAACA TATGTGCCGGCGCAAGAAAAGAACTTCACAACAGCTCCAGCGATCTGCCA TGATGGAAAAGCTCATTTCCCGAGAGAGGGAGTCTTTGTCTCTAACGGAA CTCATTGGTTCGTCACCCAGAGAAACTTCTACGAGCCGCAGATCATCACC ACCGACAACACATTCGTCTCGGGAAACTGCGACGTGGTCATCGGAATCGT AAACAATACCGTCTACGATCCGTTGCAGCCGGAACTAGACTCCTTCAAAG AAGAGTTGGACAAGTACTTCAAGAACCACACCTCTCCGGATGTGGACTTG GGAGATATCTCTGGAATCAACGCGTCCGTCGTCAACATCCAGAAAGAAAT CGATAGATTGAACGAGGTCGCGAAGAACTTGAACGAGTCCCTAATCGACC TACAAGAGCTAGGAAAATACGAGCAGTACATCAAGTGGCCGTGGTGGAC ATCTGACTGGGGAGTCCTAACGAACCTAGGAATCCTACTACTATTGTCGA TCGCGGTCCTAATCGCGCTATCCTGTATCTGTAGAATCTTCACCAAGTACA TCGGA SEQIDNO:117-GPS- MWTTCFFISLILIQGIKTLFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGV truncatedS-GPTM YYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFND aminoacidsequence GVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLG (K417T;E484K; VYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFV N501Y) FKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSY LTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWN RKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEV RQIAPGQTGTIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKS NLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVV VLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQ QFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVN CTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAG ICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTT EILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKN TQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADA GFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITS GWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQD SLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVE AEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVD FCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREG VFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELD SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL QELGKYEQYIKWPWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG SEQIDNO:118-GPS- MWTTCFFISLILIQGIKTLFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGV truncatedS+K986P YYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFND andV987P-GPTMamino GVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLG acidsequence(K417T; VYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFV E484K;N501Y) FKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSY LTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWN RKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEV RQIAPGQTGTIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKS NLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVV VLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQ QFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVN CTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAG ICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTT EILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKN TQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADA GFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITS GWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQD SLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDcustom character EA EVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDF CGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREG VFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELD SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL QELGKYEQYIKWPWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG

(262) In an alternative aspect, provided herein is a rMVA viral vector designed to express one or more SARS-CoV2 S protein antigenic peptides as an in-frame fusion protein, wherein the fusion protein comprises a signal sequence of an envelope glycoprotein (GPS), SARS-CoV2 S protein fragment, a transmembrane domain of an envelope glycoprotein (GPTM), and a cytosolic domain of an envelope glycoprotein (GPCD), wherein the envelope glycoprotein is not derived from a coronavirus. The rMVA viral vector is further designed to express a matrix protein from the same virus the envelope glycoprotein was derived from. By providing the SARS-CoV2 S protein fragment as a fusion with a GP protein, the S protein fragment-GP fusion can form a VLP with the rMVA expressed matrix protein.

(263) Suitable glycoproteins and matrix proteins for use in the present invention include, but are not limited to, those derived from: a Filoviridae, for example Marburg virus, Ebola virus, or Sudan virus; a Retroviridae, for example human immunodeficiency virus type 1 (HIV-1); an Arenaviridaea, for example Lassa virus; a Flaviviridae, for example Dengue virus and Zika virus. In particular embodiments, the glycoprotein and matrix proteins are derived from Marburg virus (MARV). In particular embodiments, the glycoprotein is derived from the MARV GP protein (Genbank accession number AFV31202.1). The amino acid sequence of the MARV GP protein is provided as SEQ ID NO: 87 in Table 14. In particular embodiments, the MARV GPS domain comprises amino acids 1 to 19 of the glycoprotein (MWTTCFFISLILIQGIKTL) (SEQ ID NO: 88, which can be encoded by, for example the MVA optimized nucleic acid sequence of SEQ ID NO: 89), the GPTM domain comprises amino acid sequences 644-673 of the glycoprotein (WWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG) (SEQ ID NO: 90, which can be encoded by, for example the MVA optimized nucleic acid sequence of SEQ ID NO: 91).

(264) The MARV VP40 amino acid sequence is available at Genbank accession number JX458834, and provided in Table 14 as SEQ ID NO: 92, which can be encoded by, for example, the MVA optimized nucleic acid sequence of SEQ ID NO: 93. In some embodiments, the nucleic acid sequence encoding the viral matrix protein can be contained as a bicistronic sequence with the GPS-S protein or protein fragment-GPTM nucleic acid sequence, or contained on a separate nucleic acid sequence inserted at a separate location within the MVA genome.

(265) In one alternative, a rMVA viral vector is provided which encodes for a modified S protein peptide fused with a GP protein, wherein the modified S protein comprises an S1+S2 truncated protein lacking the carboxy terminus of the protein, and also encodes a matrix protein, for example the MARV VP40 protein. In some embodiments, the S1+S2 truncated protein comprises amino acids 2 to 1213 of the S protein. In some embodiments, the S1+S2 truncated protein comprises amino acids 2 to 1213 of the S protein and one or more proline substitutions, for example, K986P and/or V987P. In some embodiments, the truncated S protein-GP fusion and the MARV VP40 encoding nucleic acid sequence are inserted at a separated insertion site. In some embodiments, the truncated S protein-GP fusion and the MARV VP40 encoding nucleic acid sequence are inserted as a bicistronic sequence in the MVA genome.

(266) In some embodiments, the truncated S protein-GP fusion protein comprises amino acids 2-1213 of the S Protein. The truncated S protein is flanked on its NH-terminus side by a signal peptide derived from amino acids 1-19 of the MARV glycoprotein (SEQ ID NO: 88), and on its carboxy-terminus side by the transmembrane domain of the MARV glycoprotein (SEQ ID NO: 90). The GPS-truncated S protein-GPTM peptide expressed is provided in SEQ ID NO: 113 or 114 in Table 17, which can be encoded by, for example, an MVA optimized nucleic acid sequence for example provided in SEQ ID NOS: 115 or 116. Alternatively, the GPS-truncated S protein-GPTM peptide expressed is provided in SEQ ID NOS: 117 or 118 in Table 17. A linear representation of a rMVA comprising a MARV VP 40 insert and a separate, single MVA insert encoding GPS-truncated S-TM, is provided for in FIG. 10A. A linear representation of a rMVA comprising a MARV VP 40 insert and a separate, single MVA insert encoding GPS-truncated S +K986P and V987P-TM, is provided for in FIG. 10F. In some embodiments, GPS-truncated S-GPTM is expressed as provided for in SEQ ID NOS: 113 or 114 or 117 or 118, and the MARV VP protein is expressed as provided for in SEQ ID NO: 92, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing nucleic acid sequences encoding SEQ ID NOS: 113 or 114 or 117 or 118, and 92, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 70A or 70B or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the GPS-truncated S-GPTM, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 115 or 116 or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the GPS-truncated S-GPTM is provided as SEQ ID NOS: 123, 124, 125, or 126. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NOS: 123 (FIG. 10B-10C), 124 (FIG. 10D-10E), 125 (FIG. 10G-10H), or 126 (FIG. 10I-10J), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA further comprises a nucleic acid sequence of SEQ ID NOS: 93 or 94, or a sequence at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(267) In some embodiments, the truncated S protein-GP fusion and the MARV VP40 encoding nucleic acid sequence are inserted as a bicistronic sequence in the MVA genome. A linear representation of a rMVA comprising a MARV VP 40 insert and GPS-truncated S-TM as a bicistronic nucleic acid is provided for in FIG. 10K. A linear representation of a rMVA comprising a MARV VP 40 insert GPS-truncated S+K986P and V987P-TM as a bicistronic nucleic acid is provided for in FIG. 10R. Exemplary nucleic acid sequences for insertion encoding the GPS-truncated S or truncated S+K986P and V987P-GPTM/VP40 is provided as SEQ ID NOS: 127, 128, 129, or 130. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NO: 127 (FIG. 10L-10M-10N), 128 (FIG. 10O-10P-10Q), 129 (FIG. 10S-10T-10U), or 130 (FIG. 10V-10W-10X), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(268) In one alternative, a rMVA viral vector is provided which encodes for a S protein receptor binding domain (RBD) peptide fused with a GP protein, and also encodes a matrix protein, for example, the MARV VP40 protein. In some embodiments, the RBD-GP fusion and the MARV VP40 encoding nucleic acid sequence are inserted at a separated insertion site, as exemplified in FIG. 11A. In some embodiments, the RBD GP fusion are inserted as a bicistronic sequence in the MVA genome as exemplified in FIG. 11H.

(269) In some embodiments, the RBD peptide is derived from amino acids 327 to 524 of the S protein. In some embodiments, the RBD peptide is derived from amino acids 331 to 524 of the S protein. In some embodiments, the RBD is a consensus coronavirus sequence. The RBD peptide is flanked on its NH-terminus side by a signal peptide derived from amino acids 1-19 of the MARV glycoprotein (SEQ ID NO: 88), and on its carboxy-terminus side by the transmembrane domain of the MARV glycoprotein (SEQ ID NO: 90). The GPS-RBD (aa 327-524)-GPTM peptide expressed is provided in SEQ ID NO: 95 in Table 15, which can be encoded by, for example, an MVA optimized nucleic acid sequence for example provided in SEQ ID NO: 97. The GPS-RBD (aa 331-524)-GPTM peptide expressed is provided in SEQ ID NO: 96 in Table 15, which can be encoded by, for example, an MVA optimized nucleic acid sequence for example provided in SEQ ID NO: 98. Alternatively, the GPS-RBD (aa327-524)-GPTM peptide expressed is provided in SEQ ID NO: 99. Alternatively, the GPS-RBD (aa327-524)-GPTM peptide expressed is provided in SEQ ID NO: 100. A linear representation of a rMVA comprising a MARV VP 40 insert and a separate GPS-RBD-TM insert suitable for forming a VLP upon expression is provided for in FIG. 11a. A linear representation of a rMVA comprising a MARV VP 40 insert and a separate GPS-RBD (aa 331-524)-TM insert suitable for forming a VLP upon expression is provided for in FIG. 11b. A linear representation of a rMVA comprising a MARV VP 40 insert and a separate GPS-RBD (aa 327-524)-TM insert suitable for forming a VLP upon expression is provided for in FIG. 11E. In some embodiments, GPS-RBD-GPTM is expressed as provided for in SEQ ID NOS: 95 or 99 (RBD (aa 327-524) or 96 or 100 (RBD (aa 331-524) and the MARV VP protein is expressed as provided for in SEQ ID NO: 92, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 95 or 96 or 99 or 100 and 92, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 97 or 98, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the GPS-RBD-GPTM, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 97 or 98, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the GPS-RBD-GPTM is provided as SEQ ID NO: 131, 132, 133, or 134. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NOS: 131 (FIG. 11F), 132 (FIG. 11G), 133 (FIG. 11C), or 134 (FIG. 11D), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA further comprises a nucleic acid sequence of SEQ ID NO: 93 or 94, or a sequence at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(270) In some embodiments, the RBD-GP fusion and the MARV VP40 encoding nucleic acid sequence are inserted as a bicistronic sequence in the MVA genome. A linear representation of a rMVA comprising a MARV VP 40 insert and GPS-RBD (aa 331-325)-TM as a bicistronic nucleic acid is provided for in FIG. 11I. A linear representation of a rMVA comprising a MARV VP 40 insert and GPS-RBD (aa 327-325)-TM as a bicistronic nucleic acid is provided for in FIG. 11N. Exemplary nucleic acid sequences for insertion encoding the GPS-RBD-GPTM-VP40 is provided as SEQ ID NOS: 135 (FIG. 11O-11P) and 136 (FIG. 11Q-11R) (RBD (aa 327-524)) or 137 (FIG. 11J-11K) and 138 (FIG. 11L-11M) (RBD (aa 331-524)) In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NOS: 135, 136, 137, or 138, or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(271) In one alternative, a rMVA viral vector is provided which encodes for an S protein peptide fused with a GP protein and also encodes a viral matrix protein, for example a MARV VP40 protein. In some embodiments, the S protein tandem repeat sequence is flanked on its NH-terminus side by a signal peptide derived from amino acids 1-19 of the MARV glycoprotein (SEQ ID NO: 88), and on its carboxy-terminus side by the transmembrane domain of the MARV glycoprotein (SEQ ID NO: 90). In some embodiments, the tandem repeat is for example (RBD-spacer-RBD-spacer) x or (RBD Seq. 1-spacer-RBD Seq. 2-spacer) x, wherein RBD is any S protein RBD peptide, RBD Seq. 1 is a first S protein RBD peptide, and RBD Seq. 2 is a second S protein RBD peptide, and wherein x=2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, the RBD peptides are selected from one or more peptides derived from amino acids 331 to 524 or 327 to 524 of the SARS-CoV2 S protein. In some embodiments, the linear epitopes encoded by the rMVA are selected from the amino acids 504 to 524 and amino acids 473 to 490 of the SARS-CoV2 S protein. In some embodiments, the linear epitopes encoded by the rMVA are the amino acids 504 to 524 and amino acids 473 to 490 of the SARS-CoV2 S protein. In some embodiments, the tandem repeat sequence is ((aa504-524)-spacer-(aa473-490)-spacer) x, wherein x=2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, x=3-7. In some embodiments, x=5. An exemplary amino acid sequence comprising a GPS-tandem repeat-GPTM is provided for in Table 16 as SEQ ID NO: 105, which can be encoded by the MVA optimized nucleic acid sequence of SEQ ID NO: 106. Alternatively, an exemplary amino acid sequence comprising a GPS-tandem repeat-GPTM is provided for in Table 16 as SEQ ID NO: 109. An exemplary amino acid sequence comprising a GPS-tandem repeat-GPTM, wherein x=5 for the tandem repeat, is provided for in Table 16 as SEQ ID NO: 107, which can be encoded by the MVA optimized nucleic acid sequence of SEQ ID NO: 108. An alternative exemplary amino acid sequence comprising a GPS-tandem repeat-GPTM, wherein x=5 for the tandem repeat, is provided for in Table 16 as SEQ ID NO: 110.

(272) A linear representation of a rMVA comprising a MARV VP 40 insert and a separate, single MVA insert encoding GPS-tandem repeat-GPTM peptide suitable for forming a VLP upon expression is provided for in FIG. 12A. In some embodiments, GPS-tandem repeat-GPTM peptide is expressed as provided for in SEQ ID NO: 64 or 66, and the MARV VP protein is expressed as provided for in SEQ ID NO: 59, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing nucleic acid sequences encoding SEQ ID NOS: 105 or 106 or 109 or 110, and 92, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NOS: 106 or 108, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the GPS-tandem repeat-GPTM peptide, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 106 or 108 or 109 or 110, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for use during assay detection. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the GPS-tandem repeat-GPTM peptide are provided as SEQ ID NOS: 139 and 140. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NO: 139 (FIG. 12B) or 140 (FIG. 12C), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto. In some embodiments, the rMVA further comprises a nucleic acid sequence of SEQ ID NOS: 93 or 94, or a sequence at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(273) In some embodiments, the GPS-tandem repeat-GPTM and the MARV VP40 encoding nucleic acid sequence are inserted as a bicistronic sequence in the MVA genome. A linear representation of a rMVA comprising a MARV VP 40 insert and GPS-tandem repeat-GPTM as a bicistronic nucleic acid is provided for in FIG. 12D. Exemplary nucleic acid sequences for insertion encoding the GPS-tandem repeat-GPTM-VP40 are provided as SEQ ID NOS: 141 and 142. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NOS: 141 (FIG. 12E-12F) or 142 (FIG. 12G-12H), or a sequence at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(274) In some embodiments, an rMVA viral vector is provided which encodes only the spike(S) protein (or fragment thereof). A linear representation of a single MVA insert encoding an S protein is provided for in FIG. 13A. In some embodiments, the S protein is expressed as a full-length protein, for example, as provided for in SEQ ID NOS: 1 or 6, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector comprising a nucleic acid sequence encoding SEQ ID NO: 1, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector comprising a nucleic acid sequence encoding SEQ ID NO: 6, or sequences at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the full-length S protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NO: 3. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA suitable for detection of the expressed proteins in an assay. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence known in the art. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of each protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences comprising the adjacent coding sequences of the full-length S protein are provided below in as SEQ ID NOS: 143 (FIG. 13B-13C) and 144 (FIG. 13D-13E). In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NOS: 143 or 144, or a sequence at least 70%, 75%, 80%, 85%, 90%, or 95% homologous thereto.

(275) Alternatively, an rMVA viral vector is provided which encodes the spike(S) protein, wherein the S protein has been stabilized with one or more amino acid proline substitutions that stabilize the S protein trimer in the prefusion conformation. In some embodiments, the S protein is expressed as a full-length protein and contains one or more proline substitutions at or near the boundary between a Heptad Repeat 1 (HR1) and a central helix of the promoters of the S ectodomain trimer. In some embodiments, the proline substitutions occur between amino acid residues 970 to 990 of the promoters in the trimer. In some embodiments, the S protein is expressed as a full-length protein and contains two proline substitutions at amino acids K986 and V987. A linear representation of a single MVA insert encoding a stabilized S protein is provided for in FIG. 14A. In some embodiments, the S protein is expressed as a full-length protein comprising two proline substitutions at amino acids 986 and 987 of the S protein, for example, as provided for in SEQ ID NO: 8 or 11, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NO: 8 or 11 or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NO: 9 or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the full-length proline substituted S protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 10 or 12, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the full-length stabilized S protein are provided below as SEQ ID NOS: 145 and 146. In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NOS: 145 (FIG. 14B-14C) or 146 FIG. 14D-14E), or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(276) Alternatively, an rMVA viral vector is provided which encodes a modified, truncated form of the spike(S) protein, wherein the truncated S protein comprises a S1+S2 region and lacks the carboxy terminus. In some embodiments, the truncated S protein comprises amino acids 1 to 1213 (SEQ ID NO: 13 or SEQ ID NO: 18). In some embodiments, the truncated S protein contains two proline substitutions at amino acids 986 and 987 (SEQ ID NO: 14 or SEQ ID NO: 19). A linear representation of a single MVA insert encoding a truncated S protein is provided for in FIG. 15A. A linear representation of a single MVA insert encoding a truncated S protein+K986P and V987P is provided for in FIG. 15F. In some embodiments, the truncated S protein is expressed as provided for in SEQ ID NOS: 13, 14, 18, or 19, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a plasmid or MVA viral vector containing a nucleic acid sequence encoding SEQ ID NOS: 13, 14, 18, or 19, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid sequence comprising SEQ ID NO: 15, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, provided herein is a nucleic acid encoding the truncated S protein, wherein the nucleic acid has been optimized for expression in the MVA viral vector, for example as provided in SEQ ID NOS: 16 or 17, or sequences at least 75%, 80%, 85%, 90%, or 95% homologous thereto. In some embodiments, the nucleic acid sequence encodes for an additional amino acid sequence such as a tag, for example a C-terminus tag such as EPEA. The nucleic acid sequences may further comprise suitable promoter sequences such as, for example but not limited to, those derived from pmH5, p11, pSyn, pHyb, or any other suitable promoter sequence. In addition, the nucleic acid sequence for insertion may further include suitable translation initiation sequences, such as for example, a Kozak consensus sequence. In addition, the nucleic acid sequence can include appropriate stop codons, for example TAA, TAG, or TGA, or combinations or multiples thereof, at the 3end of the nucleic acid sequence following the last amino acid sequence of the protein or tag. Furthermore, the nucleic acid sequence can include a vaccinia virus termination sequence 3 of the last stop codon of each encoded protein. In addition, the nucleic acid sequence for insertion may further include restriction enzyme sites useful for generating shuttle vectors for ease of insertion of the antigenic sequence. Exemplary nucleic acid sequences for insertion encoding the truncated S protein are provided below as SEQ ID NOS: 147 (FIG. 15B-15C), 148 (FIG. 15D-15E), 149 (FIG. 15G-15H), or 150 (FIG. 15I-15J). In some embodiments, the rMVA comprises a nucleic acid sequence selected from SEQ ID NOS: 147, 148, 149, or 150, or a sequence at least 70%, 75%, 80%, 85%, 90%, 95%, or 99% homologous thereto.

(277) Pharmaceutical Compositions

(278) The recombinant viral vectors of the present invention are readily formulated as pharmaceutical compositions for veterinary or human use, either alone or in combination. The pharmaceutical composition may comprise a pharmaceutically acceptable diluent, excipient, carrier, or adjuvant.

(279) In one embodiment, the present invention is a vaccine effective to protect against and/or treat a SARS-CoV2 infection comprising a recombinant MVA vector that expresses at least one SARS-CoV2 antigenic polypeptide or an immunogenic fragment thereof. The vaccine composition may comprise one or more additional therapeutic agents.

(280) The pharmaceutical composition may comprise 1, 2, 3, 4 or more than 4 different recombinant MVA vectors.

(281) As used herein, the phrase pharmaceutically acceptable carrier encompasses any of the standard pharmaceutical carriers, such as those suitable for parenteral administration, such as, for example, by intramuscular, intraarticular (in the joints), intravenous, intradermal, intraperitoneal, and subcutaneous routes. Examples of such formulations include aqueous and non-aqueous, isotonic sterile injection solutions, which contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and nonaqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. One exemplary pharmaceutically acceptable carrier is physiological saline.

(282) Other physiologically acceptable diluents, excipients, carriers, or adjuvants and their formulations are known to those skilled in the art.

(283) In some embodiments, adjuvants are used as immune response enhancers. In various embodiments, the immune response enhancer is selected from the group consisting of alum-based adjuvants, oil based adjuvants, Specol, RIBI, TiterMax, Montanide ISA50 or Montanide ISA 720, GM-CSF, nonionic block copolymer-based adjuvants, dimethyl dioctadecyl ammoniumbromide (DDA) based adjuvants AS-1, AS-2, Ribi Adjuvant system based adjuvants, QS21, Quil A, SAF (Syntex adjuvant in its microfluidized form (SAF-m), dimethyl-dioctadecyl ammonium bromide (DDA), human complement based adjuvants m. vaccae, ISCOMS, MF-59, SBAS-2, SBAS-4, Enhanzyn, RC-529, AGPs, MPL-SE, QS7, Escin; Digitonin; Gypsophila; and Chenopodium quinoa saponins.

(284) The compositions utilized in the methods described herein can be administered by a route selected from, e.g., parenteral, intramuscular, intraarterial, intravascular, intravenous, intraperitoneal, subcutaneous, dermal, transdermal, ocular, inhalation, buccal, sublingual, perilingual, nasal, topical administration, and oral administration. The preferred method of administration can vary depending on various factors (e.g., the components of the composition being administered and the severity of the condition being treated). Formulations suitable for oral administration may consist of liquid solutions, such as an effective amount of the composition dissolved in a diluent (e.g., water, saline, or PEG-400), capsules, sachets or tablets, each containing a predetermined amount of the vaccine. The pharmaceutical composition may also be an aerosol formulation for inhalation, e.g., to the bronchial passageways. Aerosol formulations may be mixed with pressurized, pharmaceutically acceptable propellants (e.g., dichlorodifluoromethane, propane, or nitrogen).

(285) For the purposes of this invention, pharmaceutical compositions suitable for delivering a therapeutic or biologically active agent can include, e.g., tablets, gelcaps, capsules, pills, powders, granulates, suspensions, emulsions, solutions, gels, hydrogels, oral gels, pastes, eye drops, ointments, creams, plasters, drenches, delivery devices, suppositories, enemas, injectables, implants, sprays, or aerosols. Any of these formulations can be prepared by well-known and accepted methods of art. See, for example, Remington: The Science and Practice of Pharmacy (21 st ed.), ed. A. R. Gennaro, Lippincott Williams & Wilkins, 2005, and Encyclopedia of

(286) Pharmaceutical Technology, ed. J. Swarbrick, Informa Healthcare, 2006, each of which is hereby incorporated by reference.

(287) The immunogenicity of the composition (e.g., vaccine) may be significantly improved if the composition of the present invention is co-administered with an immunostimulatory agent or adjuvant. Suitable adjuvants well-known to those skilled in the art include, e.g., aluminum phosphate, aluminum hydroxide, QS21, Quil A (and derivatives and components thereof), calcium phosphate, calcium hydroxide, zinc hydroxide, glycolipid analogs, octodecyl esters of an amino acid, muramyl dipeptides, polyphosphazene, lipoproteins, ISCOM-Matrix, DC-Choi, DDA, cytokines, and other adjuvants and derivatives thereof.

(288) Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the vaccine dissolved in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a predetermined amount of the vaccine, as liquids, solids, granules or gelatin; (c) suspensions in an appropriate liquid; (d) suitable emulsions; and (e) polysaccharide polymers such as chitins. The vaccine, alone or in combination with other suitable components, may also be made into aerosol formulations to be administered via inhalation, e.g., to the bronchial passageways. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.

(289) Suitable formulations for rectal administration include, for example, suppositories, which consist of the vaccine with a suppository base. Suitable suppository bases include natural or synthetic triglycerides or paraffin hydrocarbons. In addition, it is also possible to use gelatin rectal capsules which consist of a combination of the vaccine with a base, including, for example, liquid triglycerides, polyethylene glycols, and paraffin hydrocarbons. The vaccines of the present invention may also be co-administered with cytokines to further enhance immunogenicity. The cytokines may be administered by methods known to those skilled in the art, e.g., as a nucleic acid molecule in plasmid form or as a protein or fusion protein.

(290) This invention also provides kits comprising the vaccines of the present invention. For example, kits comprising a vaccine and instructions for use are within the scope of this invention.

(291) Methods of Use

(292) The compositions of the invention can be used as vaccines for inducing an immune response to SARS-CoV2.

(293) In exemplary embodiments, the present invention provides a method of preventing a SARS-CoV2 infection to a subject in need thereof (e.g., an unexposed subject), said method comprising administering the composition of the present invention to the subject in a prophylactically effective amount. The result of the method is that the subject is partially or completely immunized against the virus.

(294) In exemplary embodiments, the present invention provides a method of treating a SARS-CoV2 infection in a subject in need thereof (e.g., an exposed subject, such as a subject who has been recently exposed but is not yet symptomatic, or a subject who has been recently exposed and is only mildly symptomatic), said method comprising administering the composition of the present invention to the subject in a therapeutically effective amount. The result of treatment is a subject that has an improved therapeutic profile.

(295) A subject to be treated according to the methods described herein (e.g., a subject infected with SARS-CoV2) may be one who has been diagnosed by a medical practitioner as having such a condition. Diagnosis may be performed by any suitable means. A subject in whom the development of an infection is being prevented may or may not have received such a diagnosis. One skilled in the art will understand that a subject to be treated according to the present invention may have been identified using standard tests or may have been identified, without examination, as one at high risk due to the presence of one or more risk factors (e.g., exposure to SARS-CoV2, etc.).

(296) Prophylactic treatment may be administered, for example, to a subject not yet exposed to or infected by SARS-CoV2 but who is susceptible to, or otherwise at risk of exposure or infection with a SARS-CoV2.

(297) Therapeutic treatment may be administered, for example, to a subject already exposed to or infected by SARS-CoV2 who is not yet ill, or showing symptoms or infection, suffering from a disorder in order to improve or stabilize the subject's condition (e.g., a patient already infected with SARS-CoV2). The result is an improved therapeutic profile. In some instances, as compared with an equivalent untreated control, treatment may ameliorate a disorder or a symptom thereof by, e.g., 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100% as measured by any standard technique. In some instances, treating can result in the inhibition of viral replication, a decrease in viral titers or viral load, eradication or clearing of the virus. In other embodiments, treatment may result in amelioration of one or more symptoms of the infection, including any symptom identified above. According to this embodiment, confirmation of treatment can be assessed by detecting an improvement in or the absence of symptoms.

(298) In other embodiments, treatment may result in reduction or elimination of the ability of the subject to transmit the infection to another, uninfected subject. Confirmation of treatment according to this embodiment is generally assessed using the same methods used to determine amelioration of the disorder, but the reduction in viral titer or viral load necessary to prevent transmission may differ from the reduction in viral titer or viral load necessary to ameliorate the disorder.

(299) In one embodiment, the present invention is a method of inducing an immune response in a subject (e.g., a human) by administering to the subject a recombinant viral vector that encodes at least one gene from SARS-CoV2. The immune response may be a cellular immune response or a humoral immune response, or a combination thereof.

(300) In a particular embodiment, the present invention is a method of inducing an immune response in a subject (e.g., a human) by administering to the subject a recombinant viral vector that encodes at least one gene from SARS-CoV2. The immune response may be a cellular immune response or a humoral immune response, or a combination thereof.

(301) In one embodiment, the immune response is a broadly neutralizing antibody response.

(302) In a particular embodiment, the present invention is a method of inducing an immune response in a subject (e.g., a human) by administering to the subject a recombinant viral vector that encodes at least one gene from SARS-CoV2. In certain embodiments, the recombinant viral vector encodes at least two genes from a SARS-CoV2. The immune response may be a cellular immune response or a humoral immune response, or a combination thereof.

(303) In another embodiment, the invention features a method of treating SARS-CoV2 infection in a subject (e.g., a human) by administering to the subject a recombinant viral vector that encodes at least one gene from SARS-CoV2. The subject being treated may not have, but is at risk of developing, an infection by SARS-CoV2.

(304) The composition may be administered, e.g., by injection (e.g., intramuscular, intraarterial, intravascular, intravenous, intraperitoneal, or subcutaneous).

(305) It will be appreciated that more than one route of administering the vaccines of the present invention may be employed either simultaneously or sequentially (e.g., boosting). In addition, the vaccines of the present invention may be employed in combination with traditional immunization approaches such as employing protein antigens, vaccinia virus and inactivated virus, as vaccines. Thus, in one embodiment, the vaccines of the present invention are administered to a subject (the subject is primed with a vaccine of the present invention) and then a different vaccine is administered (the subject is boosted with a different vaccine). In another embodiment, a different vaccine is first administered to the subject followed by administration of a vaccine of the present invention. In yet another embodiment, a different vaccine and a vaccine of the present invention are co-administered. In some embodiments, the different vaccine is mRNA-1273 (Moderna, Inc.), AZD-1222 (AstraZeneca and University of Oxford), BNT162 (Pfizer and BioNTech), CoronaVac (Sinovac), NVX-CoV 2372 (NovoVax), SCB-2019 (Sanofi and GSK), ZyCoV-D (Zydus Cadila), or CoVaxin (Bharat Biotech).

(306) While not to be bound by any specific mechanism, it is believed that upon inoculation with a pharmaceutical composition as described herein, the immune system of the host responds to the vaccine by producing antibodies, both secretory and serum, specific for SARS-CoV2 proteins; and by producing a cell-mediated immune response specific for SARS-CoV2. As a result of the vaccination, the host becomes at least partially or completely immune to SARS-CoV2 infection, or resistant to developing moderate or severe disease caused by SARS-CoV2 infection.

(307) In one aspect, methods are provided to alleviate, reduce the severity of, or reduce the occurrence of, one or more of the symptoms (e.g., fever, severe headache, muscle pain, malaise, extreme asthenia, conjunctivitis, popular rash, dysphagia, nausea, vomiting, bloody diarrhea followed by diffuse hemorrhages, delirium, shock, jaundice, thrombocytopenia, lymphocytopenia, neutrophilia, focal necrosis in various organs (e.g., kidneys and liver), and acute respiratory distress) associated with SARS-CoV2 infection comprising administering an effective amount of a pharmaceutical composition comprising a recombinant MVA viral vector that comprises a SARS-CoV2 protein or fragment thereof.

(308) In one embodiment, administration is repeated at least twice, at least 3 times, at least 4 times, at least 5 times, at least 6 times, at least 7 times, at least 8 times, or more than 8 times.

(309) In one embodiment, administration is repeated twice.

(310) In one embodiment, about 2-8, about 4-8, or about 6-8 administrations are provided.

(311) In one embodiment, about 1-4-week, 2-4 week, 3-4 week, 1 week, 2 weeks, 3 weeks, 4 weeks or more than 4 week intervals are provided between administrations.

(312) In one specific embodiment, a 4-week interval is used between 2 administrations.

(313) The invention includes methods of prevention and treatment of a SARS-CoV2 infection, including drug resistant and multidrug resistant forms of the virus and related disease states, conditions, or complications of the viral infection, including pneumonia, such as 2019 novel coronavirus-infected pneumonia (NCIP), acute lung injury (ALI), and acute respiratory distress syndrome (ARDS). Additional non-limiting complications include hypoxemic respiratory failure, acute respiratory failure (ARF), acute liver injury, acute cardiac injury, acute kidney injury, septic shock, disseminated intravascular coagulation, blood clots, multisystem inflammatory syndrome, chronic fatigue, rhabdomyolysis, and cytokine storm.

(314) In another alternative embodiment, a method to prevent transmission is provided that includes administering an effective amount of one or more of the rMVA viral vectors described herein to humans to induce a sufficient immune response that prevents transmission of SARS-CoV2.

(315) The invention is directed to a method of treating a SARS-CoV2 infection, including drug resistant and multidrug resistant forms of the virus and related disease states, conditions, or complications of the viral infection, including pneumonia, such as 2019 novel coronavirus-infected pneumonia (NCIP), acute lung injury (ALI), and acute respiratory distress syndrome (ARDS). Additional non-limiting complications include hypoxemic respiratory failure, acute respiratory failure (ARF), acute liver injury, acute cardiac injury, acute kidney injury, septic shock, disseminated intravascular coagulation, blood clots, multisystem inflammatory syndrome, chronic fatigue, rhabdomyolysis, and cytokine storm.

(316) In one embodiment, the administration of a rMVA described herein results in a reduction in the incidence of progressive respiratory insufficiency (PRI) as measured by greater than or equal to a 1-tier or even a 2-tier or more increase in respiratory support methods required to maintain satisfactory oxygenation (SpO2>93%) using the 6-tier hierarchical levels of respiratory support methods described below, wherein the subject has acquired a SARS-CoV2 infection but has previously been, or will be, administered a rMVA viral vector described herein.

(317) The scale of increasing respiratory support levels includes: Level 1: Normal oxygenation on room air (SpO2>93%), no need for supplemental O2 Level 2: Persistent hypoxemia on room air (SpO2>93) with requirement for low-level supplemental O2 by nasal cannular or mask (up to 2 L/min) to maintain SpO2>93 Level 3: Requirement for higher levels of passive supplemental 02 by nasal cannular or mask (up to 2 L/min) to maintain SpO2>93 Level 4: Requirement for oxygenation by positive-pressure devices, e.g., Continuous Positive Airway Pressure (CPAP) or Bi-level Positive Airway Pressure (BiPAP) or other non-invasive positive-pressure respiratory support methods to main satisfactory oxygenation and/or ventilation Level 5: Requires invasive respiratory support (intubated mechanical ventilation or ECMO) Level 6: Death

(318) In one embodiment, the reduction in PRI is an increase from level 5 to level 3, level 5 to level 2, or level 5 to level 1 in comparison to a non-immunized subject. In one embodiment, the reduction in PRI is an increase from level 4 to level 2 or level 4 to level 1 in comparison to a non-immunized subject. In one embodiment, the reduction in PRI is an increase from level 3 to level 1 in comparison to a non-immunized subject.

(319) In one embodiment, the administration of rMVA viral vector described herein reduces the median time to Clinical Recovery (status 6, 7, or 8 in the NIAID Clinical Status scale using an adapted National Institute of Allergy and Infectious Diseases (NIAID) ordinal scale of Clinical Status) by at least 3, 4, 5, or more days. In one embodiment, the administration of a rMVA viral vector described herein results in an improvement as measured by the adapted ordinal scale of Clinical Status in a subject that develops a SARS-CoV2 infection.

(320) From most severe disease to progressively less severe disease, the stages of the adapted ordinal scale of overall Clinical Status are defined as follows: 1. Death 2. Hospitalized, on invasive mechanical ventilation or ECMO 3. Hospitalized, on non-invasive ventilation or high flow oxygen devices 4. Hospitalized, requiring supplemental oxygen 5. Hospitalized, not requiring supplemental oxygen-requiring ongoing medical care (COVID-19 related or otherwise) 6. Hospitalized, not requiring supplemental oxygen; no longer requires close medical care for COVID-19 7. Not hospitalized, but with limitation on activities and needing close outpatient care for COVID-19 manifestations 8. Not hospitalized, no limitations on activities, no need for continued close medical care

(321) In one embodiment, the administration of a rMVA viral vector described herein reduces the median time to Clinical Recovery (status 6, 7, or 8 in the NIAID Clinical Status scale using an adapted National Institute of Allergy and Infectious Diseases (NIAID) ordinal scale of Clinical Status) by at least 5 days, at least 6 days, at least 7 days, at least 8 days, at least 9 days, or at least 10 days compared to a non-immunized subject.

(322) In one embodiment, the administration of a rMVA viral vector described herein reduces the duration of hospitalization for a patient infected with the SARS-CoV-2 virus compared to a non-immunized subject.

(323) In one embodiment, the administration of a rMVA viral vector described herein reduces the time to sustained non-detectable SARS-CoV-2 virus in the nose and/or throat in a patient infected with the SARS-CoV-2 virus compared to a non-immunized subject.

(324) In one embodiment, the administration of a rMVA viral vector described herein reduces respiratory failure or death compared to a non-immunized subject.

(325) Dosage

(326) The vaccines are administered in a manner compatible with the dosage formulation, and in such amount as will be therapeutically effective, immunogenic and protective. The quantity to be administered depends on the subject to be treated, including, for example, the capacity of the immune system of the individual to synthesize antibodies, and, if needed, to produce a cell-mediated immune response. Precise amounts of active ingredient required to be administered depend on the judgment of the practitioner and may be monitored on a patient-by-patient basis. However, suitable dosage ranges are readily determinable by one skilled in the art and generally range from about 5.010.sup.6 TCID.sub.50 to about 5.010.sup.9 TCID.sub.50. The dosage may also depend, without limitation, on the route of administration, the patient's state of health and weight, and the nature of the formulation.

(327) The pharmaceutical compositions of the invention are administered in such an amount as will be therapeutically effective, immunogenic, and/or protective against a pathogenic species of ebolavirus. The dosage administered depends on the subject to be treated (e.g., the manner of administration and the age, body weight, capacity of the immune system, and general health of the subject being treated). The composition is administered in an amount to provide a sufficient level of expression that elicits an immune response without undue adverse physiological effects. Preferably, the composition of the invention is a heterologous viral vector that includes one or more polypeptides of the SARS-CoV2 or a nucleic acid molecule encoding one or more genes of SARS-CoV2, and is administered at a dosage of, e.g., between 1.010.sup.4 and 9.910.sup.12 TCID.sub.50 of the viral vector, preferably between 1.0105 TCID.sub.50 and 1.010.sup.11 TCID.sub.50 pfu, more preferably between 1.010.sup.6 and 1.010.sup.10 TCID.sub.50 pfu, or most preferably between 5.010.sup.6 and 5.010.sup.9 TCID.sub.50. The composition may include, e.g., at least 5.0106 TCID.sub.50 of the viral vector (e.g., 1.010.sup.8 TCID.sub.50 of the viral vector). A physician or researcher can decide the appropriate amount and dosage regimen.

(328) The composition of the method may include, e.g., between 1.010.sup.4 and 9.910.sup.12 TCID.sub.50 of the viral vector, preferably between 1.010.sup.5 TCID.sub.50 and 1.010.sup.11 TCID.sub.50 pfu, more preferably between 1.010.sup.6 and 1.010.sup.10 TCID.sub.50 pfu, or most preferably between 5.010.sup.6 and 5.010.sup.9 TCID.sub.50. The composition may include, e.g., at least 5.0106 TCID.sub.50 of the viral vector (e.g., 1.010.sup.8 TCID.sub.50 of the viral vector). The method may include, e.g., administering the composition to the subject two or more times.

(329) The invention also features a method of inducing an immune response to SARS-CoV2 in a subject (e.g., a human) that includes administering to the subject an effective amount of a recombinant viral vector that encodes at least one gene from SARS-CoV2. The subject being treated may not have, but is at risk of developing, an infection by an arenavirus. Alternatively, the subject may already be infected with a SARS-CoV2. The composition may be administered, e.g., by injection (e.g., intramuscular, intraarterial, intravascular, intravenous, intraperitoneal, or subcutaneous).

(330) The term effective amount is meant the amount of a composition administered to improve, inhibit, or ameliorate a condition of a subject, or a symptom of a disorder, in a clinically relevant manner (e.g., improve, inhibit, or ameliorate infection by arenavirus or provide an effective immune response to infection by SARS-CoV2). Any improvement in the subject is considered sufficient to achieve treatment. Preferably, an amount sufficient to treat is an amount that prevents the occurrence or one or more symptoms of SARS-CoV2 or is an amount that reduces the severity of, or the length of time during which a subject suffers from, one or more symptoms of SARS-CoV2 infection (e.g., by at least 10%, 20%, or 30%, more preferably by at least 50%, 60%, or 70%, and most preferably by at least 80%, 90%, 95%, 99%, or more, relative to a control subject that is not treated with a composition of the invention). A sufficient amount of the pharmaceutical composition used to practice the methods described herein (e.g., the treatment of SARS-CoV2 infection) varies depending upon the manner of administration and the age, body weight, and general health of the subject being treated. Ultimately, the prescribers or researchers will decide the appropriate amount and dosage.

(331) In some instances, it may be desirable to combine the immunogenic SARS-CoV2 compositions of the present invention with immunogenic compositions which induce protective responses to other agents, particularly other viruses. For example, the vaccine compositions of the present invention can be administered simultaneously, separately or sequentially with other genetic immunization vaccines such as those for influenza (Ulmer, J. B. et al., Science 259:1745-1749 (1993); Raz, E. et al., PNAS (USA) 91:9519-9523 (1994)), malaria (Doolan, D. L. et al., J. Exp. Med. 183:1739-1746 (1996); Sedegah, M. et al., PNAS (USA) 91:9866-9870 (1994)), and tuberculosis (Tascon, R. C. et al., Nat. Med. 2:888-892 (1996)).

(332) Administration

(333) As used herein, the term administering refers to a method of giving a dosage of a pharmaceutical composition of the invention to a subject. The compositions utilized in the methods described herein can be administered by a route selected from, e.g., parenteral, dermal, transdermal, ocular, inhalation, buccal, sublingual, perilingual, nasal, rectal, topical administration, and oral administration. Parenteral administration includes intravenous, intraperitoneal, subcutaneous, intraarterial, intravascular, and intramuscular administration. The preferred method of administration can vary depending on various factors (e.g., the components of the composition being administered, and the severity of the condition being treated).

(334) Administration of the pharmaceutical compositions (e.g., vaccines) of the present invention can be by any of the routes known to one of skill in the art. Administration may be by, e.g., intramuscular injection. The compositions utilized in the methods described herein can also be administered by a route selected from, e.g., parenteral, dermal, transdermal, ocular, inhalation, buccal, sublingual, perilingual, nasal, rectal, topical administration, and oral administration. Parenteral administration includes intravenous, intraperitoneal, subcutaneous, and intramuscular administration. The preferred method of administration can vary depending on various factors, e.g., the components of the composition being administered, and the severity of the condition being treated.

(335) In addition, single or multiple administrations of the compositions of the present invention may be given to a subject. For example, subjects who are particularly susceptible to SARS-CoV2 infection may require multiple treatments to establish and/or maintain protection against the virus. Levels of induced immunity provided by the pharmaceutical compositions described herein can be monitored by, e.g., measuring amounts of neutralizing secretory and serum antibodies. The dosages may then be adjusted or repeated as necessary to maintain desired levels of protection against viral infection.

(336) Combinations

(337) The rMVA vaccines described herein can be administered in addition to the current standard of care for patients suffering from SARS-CoV2, or in combination or alternation with any other compound or therapy that the healthcare provider deems beneficial to the patient, as described in more detail below. The combination and/or alternation therapy can be preventative, therapeutic, adjunctive, or palliative.

(338) The method also comprises administering to a host in need thereof, typically a human, an effective amount of an rMVA described herein optionally in combination with at least one additional bioactive agent, for example, an additional anti-viral agent, further optionally in combination with a pharmaceutically acceptable carrier additive and/or excipient.

(339) In some embodiments, the rMVA described herein can be administered in combination or alternation with an additional SARS-CoV2 vaccination. In some embodiments, the additional vaccination can be selected from an mRNA-based vaccine, an adenovirus vaccine, a non-replicating vaccine, a DNA vaccine, a live attenuated vaccine, a plant-based adjuvant vaccine, a multipope peptide-based vaccine, an inactivated virus, and a peptide vaccine, or combinations thereof. Additional vaccines suitable for use with the rMVA viral vectors and methods described herein include, but are not limited to, mRNA-1273 (MODERNA COVID-19 VACCINE; Moderna, Inc.), AZD-1222 (COVIDSHIELD; AstraZeneca and University of Oxford), BNT162 (COMIRNATY; Pfizer and BioNTech), Sputnik V (Gamaleya Research Institute, Acellena Contract Drug Research and Development), CoronaVac (Sinovac), NVX-CoV 2372 (NovoVax), SCB-2019 (Sanofi and GSK), ZyCoV-D (Zydus Cadila), BBIBP-CorV (Beijing Institute of Biological Products; China National Pharmaceutical Group (Sinopharm)), EpiVacCorona (Federal Budgetary Research Institution State Research Center of Virology and Biotechnology), Convidicea (CanSino Biologics), Covid-19 Vaccine (Wuhan Institute of Biological Products; China National Pharmaceutical Group (Sinopharm), JNJ-78436735 (Johnson & Johnson), ZF2001) Anhui Zhifei Longcom Biopharmaceutical, Institute of Microbiology of the Chinese Academy of Sciences), CVnCoV (CureVac; GSK), INO-4800 (Inovio Pharmaceuticals), VIR-7831 (Medicago; GSK; Dynavax), Covid-19 adenovirus bases vaccine (ImmunityBio; NantKwest), UB-612 (COVAXX), or CoVaxin (Bharat Biotech), or combinations thereof.

(340) TherMVA viral vectors described herein can be administered on top of the current standard of care for COVID patients, or in combination or alternation with any other compound or therapy that the healthcare provider deems beneficial for the patient. The combination and/or alternation therapy can be therapeutic, adjunctive, or palliative.

(341) In some embodiments, the rMVA viral vector is administered with an anti-infective agent, for example a NS5B inhibitor including, but not limited to remdesivir, a protease inhibitor such as lopinavir or ritonavir, previously approved for HIV, may also be administered. In some embodiments, the anti-infective is selected from favipiravir, fingolimod (Gilenya), methylprednisolone, bevacizumab (Avastin), Actemra (tocilizumab), umifenovir, losartan and the monoclonal antibody combination of REGN3048 and REGN3051, ribavirin, AT-527 (Atea Pharmaceuticals, described in U.S. Pat. No. 10,519,186, incorporated by reference herein) or AT-511 (Atea Pharmaceuticals, described in U.S. Pat. No. 10,519,186, incorporated by reference herein). Any of these drugs or vaccines can be used in combination or alternation with the rMVA provided herein to treat or prevent a SARS-CoV2 viral infection susceptible to such.

Embodiments

(342) At least the following embodiments are provided herein: 1. A recombinant modified vaccinia Ankara (rMVA) viral vector comprising a heterologous nucleic acid sequence encoding a Spike(S) protein, peptide fragment, or variant thereof, a Membrane (M) protein, and an Envelope (E) protein derived from severe acute respiratory syndrome-coronavirus 2 (SARS-CoV2) operably linked to a promoter compatible with poxvirus expression systems, wherein, upon expression in a host cell, the S protein, peptide fragment, or variant thereof, M protein, and E protein are capable of together forming a virus like particle. 2. The rMVA of embodiment 1, wherein the heterologous nucleic acid sequence encodes a full-length S protein. 3. The rMVA of embodiments 1 or 2, wherein the full-length S protein comprises an amino acid sequence of SEQ ID NO: 1, or a sequence at least 95% homologous thereto. 4. The rMVA of embodiment 3, wherein the full-length S protein comprises the amino acid sequence of SEQ ID NO: 1. 5. The rMVA of embodiments 1-2, wherein the heterologous nucleic acid sequence encoding the S protein comprises SEQ ID NO: 3, or a sequence at least 95% homologous thereto. 6. The rMVA of embodiment 5, wherein the heterologous nucleic acid sequence encoding the full-length S protein comprises SEQ ID NO: 3. 7. The rMVA of embodiments 1 or 2, wherein the full-length S protein comprises an amino acid sequence of SEQ ID NO: 6, or a sequence at least 95% homologous thereto. 8. The rMVA of embodiment 7, wherein the full-length S protein comprises the amino acid sequence of SEQ ID NO: 6. 9. The rMVA of embodiments 1-8, wherein the E protein comprises an amino acid sequence of SEQ ID NO: 40, or a sequence at least 95% homologous thereto. 10. The rMVA of embodiment 9, wherein the E protein comprises the amino acid sequence of SEQ ID NO: 40. 11. The rMVA of embodiments 1-10, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 42, or a sequence at least 95% homologous thereto. 12. The rMVA of embodiment 11, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 42. 13. The rMVA of embodiments 1-12, wherein the M protein comprises an amino acid sequence of SEQ ID NO: 43, or a sequence at least 95% homologous thereto. 14. The rMVA of embodiment 13, wherein the M protein comprises the amino acid sequence of SEQ ID NO: 43. 15. The rMVA of embodiments 1-14, wherein the heterologous nucleic acid sequence encoding the M protein comprises SEQ ID NO: 45, or a sequence at least 95% homologous thereto. 16. The rMVA of embodiment 15, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 45. 17. The rMVA of embodiment 1, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 1, 40, and 43, or sequences at least 95% homologous thereto. 18. The rMVA of embodiment 17, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 1, 40, and 43. 19. The rMVA of embodiment 1, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 3, 42, and 45, or sequences at least 95% homologous thereto. 20. The rMVA of embodiments 19, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 3, 42, and 45. 21. The rMVA of embodiment 1, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 6, 40, and 43, or sequences at least 95% homologous thereto. 22. The rMVA of embodiment 21, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 6, 40, and 43. 23. The rMVA of embodiments 1-22, wherein the S protein comprises one or more amino acid substitutions selected from K986P, V987P, K417T, K417N, E484K, or N501Y. 24. The rMVA of embodiment 23, wherein the S protein comprises the amino substitutions K417T, E484K, and N501Y. 25. The rMVA of embodiments 1-24, wherein the heterologous nucleic acid sequence encoding the S protein, E protein, and M protein is operably linked to one or more promoters compatible with poxvirus expression systems selected from a p11 promoter, pmH5 promoter, pH5 promoter, p7.5 promoter, pSyn, and pHyb. 26. The rMVA of embodiment 25, wherein the promoter is p7.5 promoter. 27. The rMVA of embodiment 26, wherein the promoter is a pmH5 promoter. 28. The rMVA of embodiment 26, wherein the promoter is a p11 promoter. 29. The rMVA of embodiment 27, wherein the promoter is SEQ ID NO: 154. 30. The rMVA of embodiment 28, wherein the promoter is SEQ ID NO: 155. 31. The rMVA of embodiment 1, wherein the rMVA heterologous nucleic acid sequence comprises a nucleic acid sequence selected from SEQ ID NO: 46, 47, 156. 32. A recombinant modified vaccinia Ankara (rMVA) viral vector comprising a heterologous nucleic acid sequence encoding a stabilized Spike(S) protein, peptide fragment, or variant thereof, a Membrane (M) protein, and an Envelope (E) protein derived from severe acute respiratory syndrome-coronavirus 2 (SARS-CoV2) operably linked to a promoter compatible with poxvirus expression systems, wherein, upon expression in a host cell, the stabilized S protein, peptide fragment, or variant thereof, M protein, and E protein are capable of together forming a virus like particle. 33. The rMVA of embodiments 32, wherein the heterologous nucleic acid sequence encodes a full-length stabilized S protein. 34 The rMVA of embodiments 32 or 33, wherein the full-length stabilized S protein comprises an amino acid sequence of SEQ ID NO: 8, or a sequence at least 95% homologous thereto. 35. The rMVA of embodiment 34, wherein the full-length stabilized S protein comprises the amino acid sequence of SEQ ID NO: 8. 36. The rMVA of embodiments 32-33, wherein the heterologous nucleic acid sequence encoding the stabilized S protein comprises SEQ ID NO: 10, or a sequence at least 95% homologous thereto. 37. The rMVA of embodiment 36, wherein the heterologous nucleic acid sequence encoding the full-length stabilized S protein comprises SEQ ID NO: 10. 38. The rMVA of embodiments 32 or 33, wherein the full-length stabilized S protein comprises an amino acid sequence of SEQ ID NO: 11, or a sequence at least 95% homologous thereto. 39. The rMVA of embodiment 38, wherein the full-length stabilized S protein comprises the amino acid sequence of SEQ ID NO: 11. 40. The rMVA of embodiments 32-39, wherein the E protein comprises an amino acid sequence of SEQ ID NO: 40, or a sequence at least 95% homologous thereto. 41. The rMVA of embodiment 40, wherein the E protein comprises the amino acid sequence of SEQ ID NO: 40. 42. The rMVA of embodiment 32-41, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 42, or a sequence at least 95% homologous thereto. 43. The rMVA of embodiment 42, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 42. 44. The rMVA of embodiments 32-43, wherein the M protein comprises an amino acid sequence of SEQ ID NO: 43, or a sequence at least 95% homologous thereto. 45. The rMVA of embodiment 4, wherein the M protein comprises the amino acid sequence of SEQ ID NO: 43. 46. The rMVA of embodiments 32-45, wherein the heterologous nucleic acid sequence encoding the M protein comprises SEQ ID NO: 45, or a sequence at least 95% homologous thereto. 47. The rMVA of embodiment 46, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 45. 48. The rMVA of embodiment 32, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 8, 40, and 43, or sequences at least 95% homologous thereto. 49. The rMVA of embodiment 48, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 8, 40, and 43. 50. The rMVA of embodiment 32, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 10, 42, and 45, or sequences at least 95% homologous thereto. 51. The rMVA of embodiment 50, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 10, 42, and 45. 52. The rMVA of embodiment 32, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 11, 40, and 43, or sequences at least 95% homologous thereto. 53. The rMVA of embodiment 52, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 11, 40, and 43. 54. The rMVA of embodiment 32, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 12, 42, and 45, or sequences at least 95% homologous thereto. 55. The rMVA of embodiment 54, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 12, 42, and 45. 56. The rMVA of embodiments 32-55, wherein the heterologous nucleic acid sequence encoding the S protein, E protein, and M protein is operably linked to one or more promoters compatible with poxvirus expression systems selected from a p11 promoter, pmH5 promoter, pH5 promoter, p7.5 promoter, pSyn, and pHyb. 57. The rMVA of embodiment 56, wherein the promoter is p7.5 promoter. 58. The rMVA of embodiment 56, wherein the promoter is a pmH5 promoter. 59. The rMVA of embodiment 56, wherein the promoter is a p11 promoter. 60. The rMVA of embodiment 58, wherein the promoter is SEQ ID NO: 154. 61. The rMVA of embodiment 59, wherein the promoter is SEQ ID NO: 155. 62. The rMVA of embodiment 32, wherein the rMVA heterologous nucleic acid sequence is selected from nucleic acid sequences comprising SEQ ID NO: 48, 49, 50, 157, 159, 160, or a nucleic acid sequence at least 95% homologous thereto. 63. A recombinant modified vaccinia Ankara (rMVA) viral vector comprising a heterologous nucleic acid sequence encoding a linear epitope of the Spike(S) protein receptor binding domain (RBD), a Membrane (M) protein, and an Envelope (E) protein derived from severe acute respiratory syndrome-coronavirus 2 (SARS-CoV2) operably linked to a promoter compatible with poxvirus expression systems, wherein, upon expression in a host cell, the linear epitope, M protein, and E protein are capable of together forming a virus like particle. 64. The rMVA of embodiment 63, wherein the heterologous nucleic acid sequence encodes amino acids 331-524 of the S protein RBD domain. 65. The rMVA of embodiments 63 or 64, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 21, or a sequence at least 95% homologous thereto. 66. The rMVA of embodiment 65, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 21. 67. The rMVA of embodiments 63-66, wherein the heterologous nucleic acid sequence encoding the S protein RBD comprises SEQ ID NO: 24, or a sequence at least 95% homologous thereto. 68. The rMVA of embodiment 67, wherein the heterologous nucleic acid sequence encoding the S protein RBD comprises SEQ ID NO: 24. 69. The rMVA of embodiment 63, wherein the heterologous nucleic acid sequence encodes amino acids 327-524 of the S protein RBD domain. 70. The rMVA of embodiments 63 or 69, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 20, or a sequence at least 95% homologous thereto. 71. The rMVA of embodiment 70, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 20. 72. The rMVA of embodiments 63 or 69-71, wherein the heterologous nucleic acid sequence encoding the S protein RBD comprises SEQ ID NO: 25, or a sequence at least 95% homologous thereto. 73. The rMVA of embodiment 72, wherein the heterologous nucleic acid sequence encoding the S protein RBD comprises SEQ ID NO: 25. 74. The rMVA of embodiment 63, wherein the RBD domain comprises one or more substitutions selected from K417N, K417T, E484K, or N501Y. 75. The rMVA of embodiment 74, wherein the RBD domain comprises the substitutions K417T, E484K, and N501Y. 76. The rMVA of embodiment 63, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 33, or a sequence at least 95% homologous thereto. 77. The rMVA of embodiment 77, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 33. 78. The rMVA of embodiment 63, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 32, or a sequence at least 95% homologous thereto. 79. The rMVA of embodiment 78, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 32. 80. The rMVA of embodiments 63-79, wherein the E protein comprises an amino acid sequence of SEQ ID NO: 40, or a sequence at least 95% homologous thereto. 81. The rMVA of embodiment 80, wherein the E protein comprises the amino acid sequence of SEQ ID NO: 40. 82. The rMVA of embodiments 63-81, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 42, or a sequence at least 95% homologous thereto. 83. The rMVA of embodiment 82, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 42. 84. The rMVA of embodiments 62-83, wherein the M protein comprises an amino acid sequence of SEQ ID NO: 43, or a sequence at least 95% homologous thereto. 85. The rMVA of embodiment 84, wherein the M protein comprises the amino acid sequence of SEQ ID NO: 43. 86. The rMVA of embodiment 63-85, wherein the heterologous nucleic acid sequence encoding the M protein comprises SEQ ID NO: 45, or a sequence at least 95% homologous thereto. 87. The rMVA of embodiment 86, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 45. 88. The rMVA of embodiment 63, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 20, 40, and 43, or sequences at least 95% homologous thereto. 89. The rMVA of embodiment 88, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 20, 40, and 43. 90. The rMVA of embodiment 63, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 24, 42, and 45, or sequences at least 95% homologous thereto. 91. The rMVA of embodiment 90, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 24, 42, and 45. 92. The rMVA of embodiment 63, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 21, 40, and 43, or sequences at least 95% homologous thereto. 93. The rMVA of embodiment 92, wherein the heterologous nucleic acid sequence encodes amino acid sequences comprising SEQ ID NOS: 21, 40, and 43. 94. The rMVA of embodiment 63, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 25, 42, and 45, or sequences at least 95% homologous thereto. 95. The rMVA of embodiment 63, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 25, 42, and 45. 96. The rMVA of embodiments 63-95, wherein the S RBD domain which further comprises a signal peptide and a transmembrane peptide derived from the S protein. 97. The rMVA of embodiment 96, wherein the S signal peptide comprises SEQ ID NO: 55. 98. The rMVA of embodiments 96 or 97, wherein the S transmembrane peptide comprises SEQ ID NO: 57. 99. The rMVA of embodiments 63-98, wherein the heterologous nucleic acid sequence encoding the S protein, E protein, and M protein is operably linked to one or more promoters compatible with poxvirus expression systems selected from a p11 promoter, pmH5 promoter, pH5 promoter, p7.5 promoter, pSyn, and pHyb. 100. The rMVA of embodiment 99, wherein the promoter is p7.5 promoter. 101. The rMVA of embodiment 99, wherein the promoter is a pmH5 promoter. 102. The rMVA of embodiment 99, wherein the promoter is a p11 promoter. 103. The rMVA of embodiment 101, wherein the promoter comprises SEQ ID NO: 154. 104. The rMVA of embodiment 102, wherein the promoter comprises SEQ ID NO: 155. 105. The rMVA of embodiment 63, wherein the rMVA heterologous nucleic acid sequence is selected from the sequences comprising SEQ ID NO: 51, 52, 53, or 54, or a nucleic acid sequence at least 95% homologous thereto. 106. A recombinant modified vaccinia Ankara (rMVA) viral vector comprising a heterologous nucleic acid sequence encoding a linear epitope of the Spike(S) protein receptor binding domain (RBD), a Membrane (M) protein, and an Envelope (E) protein derived from severe acute respiratory syndrome-coronavirus 2 (SARS-CoV2) operably linked to a promoter compatible with poxvirus expression systems, wherein the linear S epitope RBD domain further comprises a signal peptide and a transmembrane peptide derived from the S protein, wherein, upon expression in a host cell, the linear S epitope RBD domain, M protein, and E protein are capable of together forming a virus like particle. 107. The rMVA of embodiment 106, wherein the S signal peptide comprises SEQ ID NO: 55. 108. The rMVA of embodiments 106 or 107, wherein the S transmembrane peptide comprises SEQ ID NO: 57. 109. The rMVA of embodiments 106-108, wherein the heterologous nucleic acid sequence encodes amino acids 327-524 of the S protein RBD domain. 110. The rMVA of embodiments 106-109, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 61, or a sequence at least 95% homologous thereto. 111. The rMVA of embodiment 110, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 61. 112. The rMVA of embodiments 106-110, wherein the S protein RBD is encoded by a nucleic acid comprising SEQ ID NO: 65, or a sequence at least 95% homologous thereto. 113. The rMVA of embodiment 112, wherein the S protein RBD is encoded by a nucleic acid comprising SEQ ID NO: 65. 114. The rMVA of embodiments 106-108, wherein the heterologous nucleic acid sequence encodes amino acids 327-524 of the S protein RBD domain. 115. The rMVA of embodiments 106-108, and 114, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 62, or a sequence at least 95% homologous thereto. 116. The rMVA of embodiment 115, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 62. 117. The rMVA of embodiments 114-117, wherein the heterologous nucleic acid sequence encoding the S protein RBD comprises SEQ ID NO: 66, or a sequence at least 95% homologous thereto. 118. The rMVA of embodiment 117, wherein the heterologous nucleic acid sequence encoding the S protein RBD comprises SEQ ID NO: 66. 119. The rMVA of embodiment 106, wherein the RBD domain comprises one or more substitutions selected from K417N, K417T, E484K, or N501Y. 120. The rMVA of embodiment 119, wherein the RBD domain comprises the substitutions K417T, E484K, and N501Y. 121. The rMVA of embodiment 106, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 67, or a sequence at least 95% homologous thereto. 122. The rMVA of embodiment 106, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 67. 123. The rMVA of embodiment 106, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 68, or a sequence at least 95% homologous thereto. 124. The rMVA of embodiment 123, wherein the S protein RBD comprises an amino acid sequence of SEQ ID NO: 68. 125. The rMVA of embodiments 106-124, wherein the E protein comprises an amino acid sequence of SEQ ID NO: 40, or a sequence at least 95% homologous thereto. 126. The rMVA of embodiment 125, wherein the E protein comprises the amino acid sequence of SEQ ID NO: 40. 127. The rMVA of embodiments 106-126, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 42, or a sequence at least 95% homologous thereto. 128. The rMVA of embodiment 127, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 42. 129. The rMVA of embodiments 106-128, wherein the M protein comprises an amino acid sequence of SEQ ID NO: 43, or a sequence at least 95% homologous thereto. 130. The rMVA of embodiment 129, wherein the M protein comprises the amino acid sequence of SEQ ID NO: 43. 131. The rMVA of embodiments 106-130, wherein the heterologous nucleic acid sequence encoding the M protein comprises SEQ ID NO: 45, or a sequence at least 95% homologous thereto. 132. The rMVA of embodiment 131, wherein the heterologous nucleic acid sequence encoding the E protein comprises SEQ ID NO: 45. 133. The rMVA of embodiment 106, wherein the heterologous nucleic acid sequence encodes an amino acid sequence comprising SEQ ID NOS: 61, 40, and 43, or sequences at least 95% homologous thereto. 134. The rMVA of embodiment 133, wherein the heterologous nucleic acid sequence encodes an amino acid sequence comprising SEQ ID NOS: 61, 40, and 43. 135. TherMVA of embodiment 106, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 65, 42, and 45, or sequences at least 95% homologous thereto. 136. The rMVA of embodiment 135, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 65, 42, and 45. 137. The rMVA of embodiment 106, wherein the heterologous nucleic acid sequence encodes an amino acid sequence comprising SEQ ID NOS: 62, 40, and 43, or sequences at least 95% homologous thereto. 138. The rMVA of embodiment 137, wherein the heterologous nucleic acid sequence encodes an amino acid sequence comprising SEQ ID NOS: 62, 40, and 43. 139. The rMVA of embodiment 106, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 66, 42, and 45, or sequences at least 95% homologous thereto. 140. The rMVA of embodiment 139, wherein the heterologous nucleic acid sequence comprises SEQ ID NOS: 66, 42, and 45. 141. The rMVA of embodiment 106, wherein the heterologous nucleic acid sequence encodes an amino acid sequence comprising SEQ ID NOS: 67, 40, and 43, or sequences at least 95% homologous thereto. 142. The rMVA of embodiment 141, wherein the heterologous nucleic acid sequence encodes an amino acid sequence comprising SEQ ID NOS: 67, 40, and 43. 143. The rMVA of embodiment 106, wherein the heterologous nucleic acid sequence encodes an amino acid sequence comprising SEQ ID NOS: 68, 40, and 43, or sequences at least 95% homologous thereto. 144. The rMVA of embodiment 144, wherein the heterologous nucleic acid sequence encodes an amino acid sequence comprising SEQ ID NOS: 68, 40, and 43. 145. The rMVA of embodiments 106-144, wherein the heterologous nucleic acid sequence encoding the S protein, E protein, and M protein is operably linked to one or more promoters compatible with poxvirus expression systems selected from a p11 promoter, pmH5 promoter, pH5 promoter, p7.5 promoter, pSyn, and pHyb. 146. The rMVA of embodiment 145, wherein the promoter is p7.5 promoter. 147. The rMVA of embodiment 145, wherein the promoter is a pmH5 promoter. 148. The rMVA of embodiment 145, wherein the promoter is a p11 promoter. 149. The rMVA of embodiment 147, wherein the promoter comprises SEQ ID NO: 154. 150. The rMVA of embodiment 148, wherein the promoter comprises SEQ ID NO: 155. 151. The rMBA embodiment 106, wherein the rMVA heterologous nucleic acid sequence is selected from a sequences comprising SEQ ID NO: 69, 70, 71, or 72, or a nucleic acid sequence at least 95% homologous thereto. 152. A recombinant modified vaccinia Ankara (rMVA) viral vector comprising one or more heterologous nucleic acid sequences encoding i) a linear epitope of the Spike(S) protein receptor binding domain (RBD) fusion peptide derived from the RBD domain of SARS-CoV2, wherein the fusion peptide comprises an a) envelope glycoprotein signal peptide of Marburgvirus, b) the linear epitope of the RBD domain, and c) an envelope glycoprotein transmembrane domain, and ii) a Marburgvirus matrix protein, operably linked to a promoter compatible with poxvirus expression systems, wherein, upon expression in a host cell, the RBD fusion peptide and matrix protein are capable of together forming a virus like particle. 153. The rMVA of embodiment 152, wherein glycoprotein signal peptide comprises the amino acid sequence of SEQ ID NO: 88, or a sequence at least 95% homologous thereto. 154. The rMVA of embodiments 152 or 153, wherein the glycoprotein transmembrane domain comprises SEQ ID NO: 90, or a sequence at least 95% homologous thereto. 155. The rMVA of embodiments 152-154, wherein the matrix protein is the VP40 protein. 156. The rMVA of embodiment 155, wherein the VP40 protein comprises the amino acid sequence of SEQ ID NO: 92, or a sequence at least 95% homologous thereto. 157. The rMVA of embodiment 156, wherein the VP40 protein is encoded by a nucleic acid comprising SEQ ID NO: 93, or a sequence at least 95% homologous thereto. 158. The rMVA of embodiments 152-157, wherein the heterologous nucleic acid sequence encodes amino acids 327-524 of the S protein RBD domain. 159. The rMVA of embodiment 158, wherein the RBD fusion peptide is encoded by a nucleic acid comprising SEQ ID NO: 97. 160. The rMVA of embodiments 152-157, wherein the heterologous nucleic acid sequence encodes amino acids 331-524 of the S protein RBD domain. 161. The rMVA of embodiment 160, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NO: 96, or a sequence at least 95% homologous thereto. 162. The rMVA of embodiment 161, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NO: 96. 163. The rMVA of embodiments 160-162, wherein the heterologous nucleic acid sequence encoding the RBD fusion peptide comprises SEQ ID NO: 98, or a sequence at least 95% homologous thereto. 164. The rMVA of embodiment 163, wherein the heterologous nucleic acid sequence encoding the RBD fusion peptide comprises SEQ ID NO: 98. 165. The rMVA of embodiments 152-157, wherein the RBD domain comprises one or more substitutions selected from K417N, K417T, E484K, or N501Y. 166. The rMVA of embodiment 165, wherein the RBD domain comprises the substitutions K417T, E484K, and N501Y. 167. The rMVA of embodiments 152-157, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NO: 99, or a sequence at least 95% homologous thereto. 168. The rMVA of embodiment 167, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NO: 99. 169. The rMVA of embodiments 152-157, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NO: 100, or a sequence at least 95% homologous thereto. 170. The rMVA of embodiment 169, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NO: 99. 171. The rMVA of embodiments 152-173, wherein the heterologous nucleic acid sequence encoding the S protein, E protein, and M protein is operably linked to one or more promoters compatible with poxvirus expression systems selected from a p11 promoter, pmH5 promoter, pH5 promoter, p7.5 promoter, pSyn, and pHyb. 172. The rMVA of embodiment 171, wherein the promoter is p7.5 promoter. 173. The rMVA of embodiment 171, wherein the promoter is a pmH5 promoter. 174. The rMVA of embodiment 171, wherein the promoter is a p11 promoter. 175. The rMVA of embodiment 173, wherein the promoter comprises SEQ ID NO: 154. 176. The rMVA of embodiment 174, wherein the promoter comprises SEQ ID NO: 155. 177. The rMVA of embodiments 152-176, wherein the rMVA heterologous nucleic acid sequence is selected from a sequence comprising SEQ ID NO: 131, 132, 133, 134, 135, 136, 137, or 138, or a nucleic acid sequence at least 95% homologous thereto. 178. A recombinant modified vaccinia Ankara (rMVA) viral vector comprising one or more heterologous nucleic acid sequences encoding i) a linear epitope of the Spike(S) protein receptor binding domain (RBD) fusion peptide derived from the RBD domain of SARS-CoV2, wherein the fusion peptide comprises an a) a signal peptide of the S protein and the linear epitope of the RBD domain, and c) an envelope glycoprotein transmembrane domain, ii) the M protein of SARS-CoV2, and iii) a E protein of SARS-CoV2, operably linked to a promoter compatible with poxvirus expression systems, wherein, upon expression in a host cell, the RBD fusion peptide, E, and M proteins are capable of together forming a virus like particle. 179. TherMVA of embodiment 178, wherein signal peptide comprises the amino acid sequence of SEQ ID NO: 55, or a sequence at least 95% homologous thereto. 180. The rMVA of embodiments 178-179, wherein the heterologous nucleic acid sequence encodes amino acids 327-524 of the S protein RBD domain. 181. The rMVA of embodiment 180, wherein the RBD fusion peptide comprises an amino acid sequence comprising SEQ ID NOS: 55 and 20, or a sequence at least 95% homologous thereto. 182. The rMVA of embodiments 178-179, wherein the heterologous nucleic acid sequence encodes amino acids 331-524 of the S protein RBD domain. 183. The rMVA of embodiment 182, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 21, or a sequence at least 95% homologous thereto. 184. The rMVA of embodiment 161, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 21. 185. The rMVA of embodiments 178-179, wherein the heterologous nucleic acid sequence encodes amino acids 327-598 of the S protein RBD domain. 186. The rMVA of embodiment 185, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 161, or a sequence at least 95% homologous thereto. 187. The rMVA of embodiment 186, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 161. 188. The rMVA of embodiments 178-179, wherein the heterologous nucleic acid sequence encodes amino acids 331-598 of the S protein RBD domain. 189. The rMVA of embodiment 185, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 162, or a sequence at least 95% homologous thereto. 190. The rMVA of embodiment 189, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 162. 191. The rMVA of embodiments 178-190, wherein the RBD domain comprises one or more substitutions selected from K417N, K417T, E484K, or N501Y. 192. The rMVA of embodiment 191, wherein the RBD domain comprises the substitutions K417T, E484K, and N501Y. 193. The rMVA of embodiment 192, wherein the heterologous nucleic acid sequence encodes amino acids 327-524 of the S protein RBD domain. 194. The rMVA of embodiment 193, wherein the RBD fusion peptide comprises an amino acid sequence comprising SEQ ID NOS: 55 and 32, or a sequence at least 95% homologous thereto. 195. The rMVA of embodiment 191, wherein the heterologous nucleic acid sequence encodes amino acids 331-524 of the S protein RBD domain. 196. The rMVA of embodiment 195, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 33, or a sequence at least 95% homologous thereto. 197. The rMVA of embodiment 196, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 33. 198. The rMVA of embodiment 191, wherein the heterologous nucleic acid sequence encodes amino acids 327-598 of the S protein RBD domain. 199. The rMVA of embodiment 198, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 163, or a sequence at least 95% homologous thereto. 200. The rMVA of embodiment 199, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 163. 201. The rMVA of embodiment 191, wherein the heterologous nucleic acid sequence encodes amino acids 331-598 of the S protein RBD domain. 202. The rMVA of embodiment 201, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 164, or a sequence at least 95% homologous thereto. 203. The rMVA of embodiment 202, wherein the RBD fusion peptide comprises an amino acid sequence of SEQ ID NOS: 55 and 164. 204. The rMVA of embodiments 179-203, wherein the heterologous nucleic acid sequence encoding the S protein, E protein, and M protein is operably linked to one or more promoters compatible with poxvirus expression systems selected from a p11 promoter, pmH5 promoter, pH5 promoter, p7.5 promoter, pSyn, and pHyb. 205. The rMVA of embodiment 204, wherein the promoter is p7.5 promoter. 206. The rMVA of embodiment 204, wherein the promoter is a pmH5 promoter. 207. The rMVA of embodiment 204, wherein the promoter is a p11 promoter. 208. The rMVA of embodiment 206, wherein the promoter comprises SEQ ID NO: 154. 209. The rMVA of embodiment 207, wherein the promoter comprises SEQ ID NO: 155. 210. The rMVA of embodiments 179-209, wherein the rMVA heterologous nucleic acid sequence comprises SEQ ID NO: 158, or a nucleic acid sequence at least 95% homologous thereto. 211. A method of reducing or preventing a SARS-CoV2 infection in a human comprising administering an effective amount of an rMVA viral vector of any of embodiments 1-181. 212. The method of embodiment 211, wherein the rMVA is administered as a prophylactic primary vaccination. 213. The method of embodiment 211, wherein the rMVA is administered as a boost vaccination. 214. The method of embodiment 213, wherein the human has previously been administered a SARS-CoV2 vaccine. 215. The method of embodiment 214, wherein the previous vaccine is selected from an mRNA-based vaccine, an adenovirus vaccine, a non-replicating vaccine, a DNA vaccine, a live attenuated vaccine, a plant-based adjuvant vaccine, a multipope peptide-based vaccine, an inactivated virus, a peptide vaccine, 216. The method of embodiment 214, wherein the previous vaccine is selected from mRNA-1273 (MODERNA COVID-19 VACCINE; Moderna, Inc.), AZD-1222 (COVIDSHIELD; AstraZeneca and University of Oxford), BNT162 (COMIRNATY; Pfizer and BioNTech), Sputnik V (Gamaleya Research Institute, Acellena Contract Drug Research and Development), Corona Vac (Sinovac), NVX-CoV 2372 (NovoVax), SCB-2019 (Sanofi and GSK), ZyCoV-D (Zydus Cadila), BBIBP-CorV (Beijing Institute of Biological Products; China National Pharmaceutical Group (Sinopharm)), EpiVacCorona (Federal Budgetary Research Institution State Research Center of Virology and Biotechnology), Convidicea (CanSino Biologics), Covid-19 Vaccine (Wuhan Institute of Biological Products; China National Pharmaceutical Group (Sinopharm), JNJ-78436735 (Johnson & Johnson), ZF2001) Anhui Zhifei Longcom Biopharmaceutical, Institute of Microbiology of the Chinese Academy of Sciences), CVnCoV (CureVac; GSK), INO-4800 (Inovio Pharmaceuticals), VIR-7831 (Medicago; GSK; Dynavax), Covid-19 adenovirus bases vaccine (ImmunityBio; NantKwest), UB-612 (COVAXX), or CoVaxin (Bharat Biotech). 217. The method of embodiment 213, wherein the human has previously been infected with SARS-CoV2. 218. The method of embodiment 211, wherein the rMVA is administered as both a prime and a boost vaccine. 219. The method of embodiments 213-216, wherein the rMVA is administered as a boost vaccine 2 or more times. 219. The method of embodiment 216, wherein the rMVA boost is administered 4 or more weeks after the prime vaccination.

(343) The claimed invention is further described by way of the following non-limiting examples. Further aspects and embodiments of the present invention will be apparent to those of ordinary skill in the art, in view of the above disclosure and following experimental exemplification, included by way of illustration and not limitation, and with reference to the attached figures.

EXAMPLES

Example 1: Construction of S Protein-E-M rMVA Viral Vector GEO-CM01

(344) A recombinant MVA vaccine candidate (GEO-CM01) was constructed using the S, M, and E proteins from the COVID-19 Wuhan seafood market pneumonia virus (GenBank Accession number MT039888.1). SEQ ID NO: 156 was inserted into parental attenuated strain Modified Vaccinia Ankara, MVA 1974/NIH Clone 1 (ATCC #PTA-5095), which was developed by Dr. Bernard Moss of the National Institute of Allergy and Infectious Diseases (NIAID), Laboratory of Viral Diseases (LVD), using the pAD-1/S-ME shuttle vector (FIG. 24) for insertion between two vaccinia genes, A5R and A6L. The pAD-1/S-ME shuttle vector was derived from the pAD-1/pUC57 shuttle vector (FIG. 26). The inserted sequence was codon optimized for MVA. Silent mutations were introduced to interrupt homo-polymer sequences (>4G/C and >4A/T), which reduces RNA polymerase errors that possibly lead to frameshifts. The sequences were edited for vaccinia-specific terminators to remove motifs that could lead to premature termination. The modified H5 early/late promoter was used to drive transcription of the S and M inserts, while the p11 promoter was used to drive transcription of the E insert. The rMVA were made by homologous recombination and serial plaque purification in chicken embryo fibroblasts. Briefly, the pAD-1/S-ME was transfected into primary chicken embryonic fibroblasts (CEF) cells that were infected with parental MVA. The recombinant virus was obtained from supernatants and lysates, then subjected to multiple rounds of plaque purification using reporter gene screening.

(345) To verify insertion of SEQ ID NO: 156 into the parental strain, PCR amplification of the nucleic acid sequence expressing the S protein was performed. The antigen insert was amplified using 50 ng of DNA from the shuttle plasmid pAD-1/S-ME used to generate GEO-CM01 (positive control), GEO-CM01, MVA parental (negative control) in 25 ul reactions with 10 mM of primers: forward primer p55 (5-AGATCGGAGATGACTGCGATG-3) (SEQ ID NO: 151) and reverse primer p54 (5-CGATGGTAGGTCAGATTGTCC-3) (SEQ ID NO: 152). Reactions were visualized by loading 10 ul of the PCR reaction on a 1% agarose gel stained with ethidium bromide. As shown in FIG. 17 and FIG. 18, the PCR of GEO-CM01 rMVA generated the appropriate signal (5384 base pairs).

(346) To verify expression of SME VLPs, CEF cells were infected with GEO-CM01 and 48 hours later analyzed by immunocytochemistry. Briefly, cells were fixed with 1:1 Methanol: Acetone, stained with primary mouse anti-SARS-CoV-2 spike antibody (GeneTex #GTX632604) and secondary anti-mouse HRP, and developed with AEC peroxidase substrate, which mediates a colorimetric readout of plaques. Positive staining plaques were identified (See FIG. 16).

(347) To further confirm antigen expression in GEO-CM01, Western blot analysis of GEO-CM01 antigen expression was performed. DF1 cells were infected at a low m.o.i. (0.5) with GEO-CM01 or MVA parental. Two days following infection, cell lysate and supernatant were harvested and equal volumes were subjected to SDS-PAGE, transferred to PVDF membrane and probed with an anti-SARS-CoV-2 Spike/RBD (rabbit) antibody (Sino Biologicals, #40592-T62) and secondary anti-rabbit IgG (FIG. 19). Membranes were visualized on an Odyssey infrared scanner. As shown in FIG. 19, DF1 cell lysate and supernatant of GEO-CM01 infection show expression of the spike protein.

(348) Electron microscopic (EM) images were taken of virus-like particle formation in DF1 cells that had been infected with GEO-CM01 (FIG. 20).

Example 2Animal Protection Challenges Using GEO-CM01

(349) The initial preclinical efficacy of GEO-CM01 was determined using a hamster model. The studies were carried out in strict accordance with the recommendations described in the Guide for the Care and Use of Laboratory Animals of the National Research Council. All efforts were made to minimize animal suffering and all procedures involving potential pain were performed with the appropriate anesthetic or analgesic. The number of hamsters used was scientifically justified based on statistical analyses of virological and immunological outcomes.

(350) Seven-week-old golden Syrian female hamsters (Envigo) were anesthetized with 5% isoflurane prior to immunization and blood collections and with ketamine/xylazine prior to the SARS-CoV-2 challenge. Hamsters (N=10 per group) were vaccinated once or twice at a 29-day interval with the MVA-SME vaccine (GEO-CM01) at a dose of 10.sup.8 TCID.sub.50 per animal via the intramuscular route (100 ul delivered as 50 ul per hind leg), while the control group received saline. Vena cava blood collections were performed four days prior to the first immunization and on 27 days post immunization (days 27 and 56). On day 59, vaccinated and control animals were exposed intranasally to the targeted dose of 105 PFU of passage 5 of isolate SARS-CoV-2 USA-WA1/2020. Animals were monitored daily for weight loss and signs of disease. Five animals in each group were euthanized by overdose of injectable anesthetics (ketamine/xylazine) 3 days post challenge for viral load determination. Remaining animals were euthanized 14 days post infection by overdose of ketamine/xylazine.

(351) Sera collected from animals were tested for neutralizing capabilities against SARS-CoV-2. Briefly, serum samples were heat-inactivated (30 minutes at 56 C.). 10-fold diluted sera were further diluted in a 2-fold serial fashion, and 60 ul of each serum dilution was mixed with 60 ul of SARS-CoV-2-mNG (200 PFU). The serum/virus mixtures were incubated for 1 hr at 37 C. 100 ul of the serum/virus mixtures were then transferred to Vero E6 cell monolayers in black flat-bottom 96-well plates and incubated for 2 days at 37 C. Virus fluorescence was measured with a Cytation Hybrid Multi-Mode reader at 488 nm (Biotek Instruments). Results of the ability of GEO-CM01 to induce neutralizing are shown in FIG. 21 and FIG. 22. Results demonstrate the dilution at which there was a 50% reduction in SARS-CoV-2 plaque formation (FIG. 21). Half of the animals that received a prime/boost dose of GEO-CM01 generated antibodies that neutralized SARS-CoV-2, indicating the capability of GEO-CM01 to elicit neutralizing antibodies to SARS-CoV-2 in a golden hamster model.

(352) Serum from GEO-CM01 immunized animals was analyzed by ELISA for levels of antibody specific to recombinant Spike-Membrane (S-M) fusion, Spike(S) and the receptor binding domain (RBD) proteins (FIG. 22). Following single-dose immunization (Day 27), detectable levels of antibodies to S-M, S and RBD are observed. A further increase in the levels of binding antibody to these proteins is observed following prime-boost vaccination, indicating that GEO-CM01 induces robust antibodies to Spike, including RBD, and Membrane proteins in a golden hamster model.

(353) Animals were vaccinated in a single-dose or prime-boost regimen, challenged with SARS-CoV-2, then monitored for morbidity. Body weight and health scores were recorded daily following challenge (FIG. 23). Single-dose immunization modestly protects animals from clinical disease and weight loss, whereas prime-boost immunization offers complete protection from clinical disease and significantly reduces weight loss following SARS-CoV-2 challenge, indicating that vaccination with GEO-CM01 significantly reduces morbidity, protecting animals from disease following SARS-CoV-2 challenge in a golden hamster model.

Example 3Construction of Stabilized S Protein-E-M rMVA Viral Vector GEO-CM02

(354) A recombinant MVA vaccine candidate (GEO-CM02) was constructed using a stabilized S protein and the M, and E proteins from the COVID-19 Wuhan seafood market pneumonia virus (GenBank Accession number MT039888.1). SEQ ID NO: 157 was inserted into parental attenuated strain Modified Vaccinia Ankara, MVA 1974/NIH Clone 1 (ATCC #PTA-5095), which was developed by Dr. Bernard Moss of the National Institute of Allergy and Infectious Diseases (NIAID), Laboratory of Viral Diseases (LVD), using the pAD-1/sS-ME shuttle vector (FIG. 25) for insertion between two vaccinia genes, A5R and A6L. The pAD-1/sS-ME shuttle vector was derived from the pAD-1/pUC57 shuttle vector (FIG. 26). The inserted sequence was codon optimized for MVA. Silent mutations were introduced to interrupt homo-polymer sequences (>4G/C and >4A/T), which reduces RNA polymerase errors that possibly lead to frameshifts. The sequences were edited for vaccinia-specific terminators to remove motifs that could lead to premature termination. The modified H5 early/late promoter was used to drive transcription of the S and M inserts, while the p11 promoter was used to drive transcription of the E insert. The rMVA were made by homologous recombination and serial plaque purification in chicken embryo fibroblasts. Briefly, the pAD-1/sS-ME was transfected into primary chicken embryonic fibroblasts (CEF) cells that were infected with parental MVA. The recombinant virus was obtained from supernatants and lysates, then subjected to multiple rounds of plaque purification using reporter gene screening.

(355) To verify insertion of SEQ ID NO: 157 into the parental strain, PCR amplification of the nucleic acid sequence expressing the stabilized S protein was performed. The antigen insert was amplified using 50 ng of DNA from the shuttle plasmid pAD-1/sS-ME used to generate GEO-CM02 (positive control), GEO-CM02, MVA parental (negative control) in 25 ul reactions with 10 mM of primers: forward primer p55 (5-AGATCGGAGATGACTGCGATG-3) (SEQ ID NO: 151) and reverse primer p54 (5-CGATGGTAGGTCAGATTGTCC-3) (SEQ ID NO: 152). Reactions were visualized by loading 10 ul of the PCR reaction on a 1% agarose gel stained with ethidium bromide. As shown in FIGS. 18 and 31, the PCR of GEO-CM02 rMVA generated the appropriate signal (5384 base pairs).

(356) To further confirm antigen expression in GEO-CM02, Western blot analysis of GEO-CM02 antigen expression was performed. DF1 cells were infected at a low m.o.i. (0.5) with GEO-CM02 or MVA parental. Two days following infection, cell lysate and supernatant were harvested and equal volumes were subjected to SDS-PAGE, transferred to PVDF membrane and probed with anti-SARS-CoV-2 Spike/RBD (rabbit) antibody (Sino Biologicals, #40592-T62) and secondary anti-rabbit IgG (FIG. 20).

Example 4Animal Protection Challenges Using GEO-CM02

(357) The initial preclinical efficacy of GEO-CM02 is being determined using a hamster model.

(358) Hamsters were initially immunized intramuscularly using 108 PFU of GEO-CM02 on day 0 and day 29 (prime/boost group) or on day 29 only (prime group). The hamsters will be administered SARS-CoV-2 intranasal on Day 59. A group of hamsters will be sacrificed at day 3 post challenge (day 62) and a group will be sacrificed at day 14 post challenge (day 73).

(359) The SARS-CoV2 antibodies will be analyzed by ELISA, and neutralization capacity of the antibodies will be determined. The lungs will be harvested for histopathology and examination of viral loads.

Example 5Construction of SP-RBD-E/M rMVA Viral Vector

(360) A recombinant MVA vaccine candidate (GEO-CM03) was constructed using the RBD sequence of the S protein (aa 327-527), the M, and E proteins from the COVID-19 Wuhan seafood market pneumonia virus (GenBank Accession number MT039888.1). The RBD sequence was flanked on its N-terminus by the signal peptide of the S protein, and on its Carboxy-terminus by the transmembrane region of the S protein, thus allowing the formation of a VLP displaying the RBD on the VLP surface upon expression. SEQ ID NO: 158 was inserted into parental attenuated strain Modified Vaccinia Ankara, MVA 1974/NIH Clone 1 (ATCC #PTA-5095), which was developed by Dr. Bernard Moss of the National Institute of Allergy and Infectious Diseases (NIAID), Laboratory of Viral Diseases (LVD), using the pAD-1/SP-RBD-TM/E/M shuttle vector for insertion between two vaccinia genes, A5R and A6L. The pAD-1/SP-RBD/E/M shuttle vector was derived from the pAD-1/pUC57 shuttle vector (FIG. 26). The inserted sequence was codon optimized for MVA. Silent mutations were introduced to interrupt homo-polymer sequences (>4G/C and >4A/T), which reduces RNA polymerase errors that possibly lead to frameshifts. The sequences were edited for vaccinia-specific terminators to remove motifs that could lead to premature termination. The modified H5 early/late promoter was used to drive transcription of the SP-RBD fusion and M inserts, while the p11 promoter was used to drive transcription of the E insert. The rMVA were made by homologous recombination and serial plaque purification in chicken embryo fibroblasts. Briefly, the pAD-1/SP-RBD-E/M was transfected into primary chicken embryonic fibroblasts (CEF) cells that were infected with parental MVA. The recombinant virus was obtained from supernatants and lysates, then subjected to multiple rounds of plaque purification using reporter gene screening.

(361) To verify insertion of SEQ ID NO: 158 into the parental strain, PCR amplification of the nucleic acid sequence expressing the RBD insert was performed. The antigen insert was amplified using 50 ng of DNA from the shuttle plasmid used to generate GEO-CM03 (positive control), GEO-CM03, MVA parental (negative control) in 25 ul reactions with 10 mM of primers: forward primer p55 (5-AGATCGGAGATGACTGCGATG-3) (SEQ ID NO: 151) and reverse primer p54 (5-CGATGGTAGGTCAGATTGTCC-3) (SEQ ID NO: 152). Reactions were visualized by loading 10 ul of the PCR reaction on a 1% agarose gel stained with ethidium bromide. As shown in FIGS. 18 and 31, the PCR of GEO-CM03 rMVA generated the appropriate signal (2422 base pairs).

(362) To further confirm antigen expression in GEO-CM03, Western blot analysis of GEO-CM03 antigen expression was performed. DF1 cells were infected at a low m.o.i. (0.5) with GEO-CM03 or MVA parental. Two days following infection, cell lysate and supernatant were harvested and equal volumes were subjected to SDS-PAGE, transferred to PVDF membrane and probed with anti-SARS-CoV-2 Spike/RBD (rabbit) antibody (Sino Biologicals, #40592-T62) and secondary anti-rabbit IgG (FIG. 20).

Example 6Animal Protection Challenges Using GEO-CM03

(363) The initial preclinical efficacy of GEO-CM03 is being determined using a hamster model. Hamsters were initially immunized intramuscularly using 108 PFU of GEO-CM02 on day 0 and day 29 (prime/boost group) or on day 29 only (prime group). The hamsters will be administered SARS-CoV-2 intranasal on Day 59. A group of hamsters will be sacrificed at day 3 post challenge (day 62) and a group will be sacrificed at day 14 post challenge (day 73).

(364) The SARS-CoV2 antibodies will be analyzed by ELISA, and neutralization capacity of the antibodies will be determined. The lungs will be harvested for histopathology and examination of viral loads.

Example 7Construction of MarvGP-RBD and MARV VP40 rMVA Viral Vector

(365) A recombinant MVA vaccine candidate (GEO-CM03b) was constructed using sequences from the COVID-19 Wuhan seafood market pneumonia virus (accession number MT039888.1) and Marburg virus (MARV) Marburg marburgvirus isolate MARV/H.sapiens-tc/COD/2000/24 DRC, ACCESSION JX458834). SEQ ID NO: 134 was inserted into parental attenuated strain Modified Vaccinia Ankara, MVA 1974/NIH Clone 1 (ATCC #PTA-5095), which was developed by Dr. Bernard Moss of the National Institute of Allergy and Infectious Diseases (NIAID), Laboratory of Viral Diseases (LVD).

(366) The COVID-19 spike gene receptor binding domain was fused between the signal sequence of Marburg virus glycoprotein at the amino terminus and the transmembrane domain and cytoplasmic tail of Marburg virus glycoprotein at the carboxy terminus (SignalMARV-RBDCOVID-TMMARV). SignalMARV-RBDCOVID-TMMARV were subcloned into the pLW76 shuttle vector for insertion between two essential vaccinia genes, A5R and A6L. The MARV matrix protein (SEQ ID NO: 92), VP40, was subcloned into the pAD2/67 shuttle vector for insertion between two essential vaccinia genes, A50R and B1R. The inserted sequences were codon optimized for MVA (SEQ ID NO: 94). Silent mutations were introduced to interrupt homo-polymer sequences (>4G/C and >4A/T), which reduce RNA polymerase errors that possibly lead to frameshifts. The sequences were edited for vaccinia-specific terminators to remove motifs that could lead to premature termination. The modified H5 early/late promoter was used to drive transcription of gene inserts. The recombinants were made by homologous recombination and serial plaque purification. Briefly, the recombinant plasmid was transfected into primary chicken embryonic fibroblasts that have been infected with parental MVA. The recombinant virus was obtained from supernatants and lysates, then subjected to multiple rounds of plaque purification using reporter gene screening.

(367) To verify insertion of SEQ ID NO: 134 into the parental strain, PCR amplification of the nucleic acid sequence expressing the RBD insert was performed. The antigen insert was amplified using 50 ng of DNA from the shuttle plasmid MTRDB used to generate GEO-CM03b (positive control), GEO-CM03b, MVA parental (negative control) in 25 ul reactions with 10 mM of primers: forward primer p55 (5-AGATCGGAGATGACTGCGATG-3) (SEQ ID NO: 151) and reverse primer p54 (5-CGATGGTAGGTCAGATTGTCC-3) (SEQ ID NO: 152) or forward primer p53 (5-CAGAAGTTAATAAGCGTATAGCCATC-3) (SEQ ID NO: 153) and reverse primer p54. Reactions were visualized by loading 10 ul of the PCR reaction on a 1% agarose gel stained with ethidium bromide. As shown in FIG. 28, the PCR of GEO-CM03b rMVA generated the appropriate signal (p54/p55-1288 base pairs; p54/p53-1558 base pairs-see middle two arrows).