Modification of RNA-related enzymes for enhanced production

12577600 ยท 2026-03-17

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides, among other things, methods and compositions for large-scale production of capped mRNA using SUMO-Guanylyl Transferase fusion protein.

Claims

1. A method of producing a capped RNA or RNA analog oligonucleotide, comprising transferring and methylating a guanylyl molecule to the 5 end of the RNA or RNA analog oligonucleotide using a guanylyl transferase, wherein the guanylyl transferase comprises i) a fusion protein comprising a small ubiquitin-like molecule (SUMO) protein covalently linked to guanylyl transferase large subunit, wherein the SUMO protein comprises SEQ ID NO: 1 and the guanylyl transferase large subunit comprises SEQ ID NO: 6, and ii) a guanylyl transferase small subunit comprising SEQ ID NO: 7, thereby producing a capped RNA or RNA analog oligonucleotide.

2. The method of claim 1, wherein the fusion protein comprises, from the N-terminal to the C-terminal direction, SEQ ID NO: 1 fused to SEQ ID NO: 6.

3. The method of claim 1, wherein the guanylyl transferase has comparable phosphatase activity, guanylyl transferase activity and methylation activity relative to a wild-type guanylyl transferase protein.

4. The method of claim 1, wherein the RNA or RNA analog oligonucleotide is mRNA synthesized by in vitro transcription.

Description

BRIEF DESCRIPTION OF THE DRAWING

(1) The drawings are for illustration purposes and are in no way limiting.

(2) FIGS. 1A and 1B are diagrams of exemplary mRNA capped structures present in various embodiments of the invention.

(3) FIG. 2 demonstrates exemplary yield of soluble SUMO-GT protein produced by fermentation compared to that of GT protein produced via the shake flask method.

DEFINITIONS

(4) In order for the present invention to be more readily understood, certain terms are first defined. Additional definitions for the following terms and other terms are set forth throughout the specification.

(5) Approximately: As used herein, the term approximately or about, as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term approximately or about refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).

(6) Batch culture: As used herein, the term batch culture refers to a method of culturing cells in which all the components that will ultimately be used in culturing the cells, including the medium (see definition of medium below) as well as the cells themselves, are provided at the beginning of the culturing process. Thus, a batch culture typically refers to a culture allowed to progress from inoculation to conclusion without refeeding the cultured cells with fresh medium. A batch culture is typically stopped at some point and the cells and/or components in the medium are harvested and optionally purified.

(7) Biologically active: As used herein, the phrase biologically active refers to a characteristic of any substance that has activity in a biological system (e.g., cell culture, organism, etc.). For instance, a substance that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active. Biological activity can also be determined by in vitro assays (for example, in vitro enzymatic assays such as sulfate release assays). In particular embodiments, where a protein or polypeptide is biologically active, a portion of that protein or polypeptide that shares at least one biological activity of the protein or polypeptide is typically referred to as a biologically active portion. In some embodiments, a protein is produced and/or purified from a cell culture system, which displays biologically activity when administered to a subject. In some embodiments, a protein requires further processing in order to become biologically active. In some embodiments, a protein requires posttranslational modification such as, but is not limited to, glycosylation (e.g., sialyation), farnysylation, cleavage, folding, formylglycine conversion and combinations thereof, in order to become biologically active. In some embodiments, a protein produced as a proform (i.e. immature form), may require additional modification to become biologically active.

(8) Bioreactor: As used herein, the term bioreactor refers to a vessel used for the growth of a host cell culture. A bioreactor can be of any size so long as it is useful for the culturing of mammalian cells. Typically, a bioreactor will be at least 1 liter and may be 10, 100, 250, 500, 1000, 2500, 5000, 8000, 10,000, 12,0000 liters or more, or any volume in between. Internal conditions of a bioreactor, including, but not limited to pH, osmolarity, CO2 saturation, O2 saturation, temperature and combinations thereof, are typically controlled during the culturing period. A bioreactor can be composed of any material that suitable for holding cells in media under the culture conditions of the present invention, including glass, plastic or metal. In some embodiments, a bioreactor may be used for performing animal cell culture. In some embodiments, a bioreactor may be used for performing mammalian cell culture. In some embodiments, a bioreactor may be used with cells and/or cell lines derived from such organisms as, but not limited to, mammalian cell, insect cells, bacterial cells, yeast cells and human cells. In some embodiments, a bioreactor is used for large-scale cell culture production and is typically at least 100 liters and may be 200, 500, 1000, 2500, 5000, 8000, 10,000, 12,0000 liters or more, or any volume in between. One of ordinary skill in the art will be aware of and will be able to choose suitable bioreactors for use in practicing the present invention.

(9) Cell density: As used herein, the term cell density refers to that number of cells present in a given volume of medium.

(10) Cell culture or culture: As used herein, these terms refer to a cell population that is gown in a medium under conditions suitable to survival and/or growth of the cell population. As will be clear to those of ordinary skill in the art, these terms as used herein may refer to the combination comprising the cell population and the medium in which the population is grown.

(11) Cultivation: As used herein, the term cultivation or grammatical equivalents refers to a process of maintaining cells under conditions favoring growth or survival. The terms cultivation and cell culture or any synonyms are used inter-changeably in this application.

(12) Culture vessel: As used herein, the term culture vessel refers to any container that can provide an aseptic environment for culturing cells. Exemplary culture vessels include, but are not limited to, glass, plastic, or metal containers.

(13) Expression: As used herein, expression of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5 cap formation, and/or 3 end formation); (3) translation of an RNA into a polypeptide or protein; and/or (4) post-translational modification of a polypeptide or protein.

(14) Fed-batch culture: As used herein, the term fed-batch culture refers to a method of culturing cells in which additional components are provided to the culture at some time subsequent to the beginning of the culture process. The provided components typically comprise nutritional supplements for the cells which have been depleted during the culturing process. A fed-batch culture is typically stopped at some point and the cells and/or components in the medium are harvested and optionally purified.

(15) Homology: As used herein, the term homology refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules. In some embodiments, polymeric molecules are considered to be homologous to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical. In some embodiments, polymeric molecules are considered to be homologous to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar.

(16) Identity: As used herein, the term identity refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two nucleic acid sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes). In certain embodiments, the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or substantially 100% of the length of the reference sequence. The nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two nucleotide sequences can be determined using the algorithm of Meyers and Miller (CABIOS, 1989, 4:11-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. The percent identity between two nucleotide sequences can, alternatively, be determined using the GAP program in the GCG software package using an NWSgapdna.CMP matrix. Various other sequence alignment programs are available and can be used to determine sequence identity such as, for example, Clustal.

(17) Integrated Viable Cell Density: As used herein, the term integrated viable cell density refers to the average density of viable cells over the course of the culture multiplied by the amount of time the culture has run. Assuming the amount of polypeptide and/or protein produced is proportional to the number of viable cells present over the course of the culture, integrated viable cell density is a useful tool for estimating the amount of polypeptide and/or protein produced over the course of the culture.

(18) Isolated: As used herein, the term isolated refers to a substance and/or entity that has been (1) separated from at least some of the components with which it was associated when initially produced (whether in nature and/or in an experimental setting), and/or (2) produced, prepared, and/or manufactured by the hand of man. Isolated substances and/or entities may be separated from about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% of the other components with which they were initially associated. In some embodiments, isolated agents are about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. As used herein, a substance is pure if it is substantially free of other components. As used herein, calculation of percent purity of isolated substances and/or entities should not include excipients (e.g., buffer, solvent, water, etc.)

(19) Medium: As used herein, the term medium refer to a solution containing nutrients which nourish growing cells. Typically, these solutions provide essential and non-essential amino acids, vitamins, energy sources, lipids, and trace elements required by the cell for minimal growth and/or survival. The solution may also contain components that enhance growth and/or survival above the minimal rate, including hormones and growth factors. In some embodiments, medium is formulated to a pH and salt concentration optimal for cell survival and proliferation. In some embodiments, medium may be a chemically defined mediuma serum-free media that contains no proteins, hydrolysates or components of unknown composition. In some embodiment, chemically defined medium is free of animal-derived components and all components within the medium have a known chemical structure. In some embodiments, medium may be a serum based mediuma medium that has been supplemented with animal derived components such as, but not limited to, fetal calf serum, horse serum, goat serum, donkey serum and/or combinations thereof.

(20) Nucleic acid: As used herein, the term nucleic acid, in its broadest sense, refers to a compound and/or substance that is or can be incorporated into an oligonucleotide chain. In some embodiments, a nucleic acid is a compound and/or substance that is or can be incorporated into an oligonucleotide chain via a phosphodiester linkage. In some embodiments, nucleic acid refers to individual nucleic acid residues (e.g., nucleotides and/or nucleosides). In some embodiments, nucleic acid refers to an oligonucleotide chain comprising individual nucleic acid residues. As used herein, the terms oligonucleotide and polynucleotide can be used interchangeably. In some embodiments, nucleic acid encompasses RNA as well as single and/or double-stranded DNA and/or cDNA. Furthermore, the terms nucleic acid, DNA, RNA, and/or similar terms include nucleic acid analogs, i.e., analogs having other than a phosphodiester backbone. For example, the so-called peptide nucleic acids, which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention. The term nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and/or encode the same amino acid sequence. Nucleotide sequences that encode proteins and/or RNA may include introns. Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, backbone modifications, etc. A nucleic acid sequence is presented in the 5 to 3 direction unless otherwise indicated. The term nucleic acid segment is used herein to refer to a nucleic acid sequence that is a portion of a longer nucleic acid sequence. In many embodiments, a nucleic acid segment comprises at least 3, 4, 5, 6, 7, 8, 9, 10, or more residues. In some embodiments, a nucleic acid is or comprises natural nucleosides (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine); nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl-uridine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, O(6)-methylguanine, and 2-thiocytidine); chemically modified bases; biologically modified bases (e.g., methylated bases); intercalated bases; modified sugars (e.g., 2-fluororibose, ribose, 2-deoxyribose, arabinose, and hexose); and/or modified phosphate groups (e.g., phosphorothioates and 5-N-phosphoramidite linkages). In some embodiments, the present invention is specifically directed to unmodified nucleic acids, meaning nucleic acids (e.g., polynucleotides and residues, including nucleotides and/or nucleosides) that have not been chemically modified in order to facilitate or achieve delivery.

(21) Perfusion process: As used herein, the term perfusion process refers to a method of culturing cells in which additional components are provided continuously or semi-continuously to the culture subsequent to the beginning of the culture process. The provided components typically comprise nutritional supplements for the cells which have been depleted during the culturing process. A portion of the cells and/or components in the medium are typically harvested on a continuous or semi-continuous basis and are optionally purified. Typically, a cell culture process involving a perfusion process is referred to as perfusion culture. Typically, nutritional supplements are provided in a fresh medium during a perfusion process. In some embodiments, a fresh medium may be identical or similar to the base medium used in the cell culture process. In some embodiments, a fresh medium may be different than the base medium but containing desired nutritional supplements. In some embodiments, a fresh medium is a chemically-defined medium.

(22) Seeding: As used herein, the term seeding refers to the process of providing a cell culture to a bioreactor or another vessel for large scale cell culture production. In some embodiments a seed culture is used, in which the cells have been propagated in a smaller cell culture vessel, i.e. Tissue-culture flask, Tissue-culture plate, Tissue-culture roller bottle, etc., prior to seeding. Alternatively, in some embodiments, the cells may have been frozen and thawed immediately prior to providing them to the bioreactor or vessel. The term refers to any number of cells, including a single cell.

(23) Subject: As used herein, the term subject means any mammal, including humans. In certain embodiments of the present invention the subject is an adult, an adolescent or an infant. Also contemplated by the present invention are the administration of the pharmaceutical compositions and/or performance of the methods of treatment in-utero.

(24) Vector: As used herein, vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it is associated. In some embodiment, vectors are capable of extra-chromosomal replication and/or expression of nucleic acids to which they are linked in a host cell such as a eukaryotic and/or prokaryotic cell. Vectors capable of directing the expression of operatively linked genes are referred to herein as expression vectors.

(25) Viable cell density: As used herein, the term viable cell density refers to the number of living cells per unit volume.

DETAILED DESCRIPTION

(26) The present invention provides, among other things, methods and compositions for large-scale production of capped mRNA using SUMO- Guanylyl Transferase fusion protein.

(27) Various aspects of the invention are described in further detail in the following subsections. The use of subsections is not meant to limit the invention. Each subsection may apply to any aspect of the invention. In this application, the use of or means and/or unless stated otherwise.

(28) SUMO-Guanylyl Transferase Fusion Protein

(29) Small Ubiquitin-like Modifier (SUMO)

(30) As used herein, a SUMO tag is any protein or a portion of a protein that can substitute for at least partial activity of a SUMO protein.

(31) SUMO proteins are small proteins that are covalently attached to and detached from other proteins in order to modify the functions of those proteins. The modification of a protein with a SUMO protein is a post-translational modification involved in various cellular processes such as nuclear-cytosolic transport, transcriptional regulation, apoptosis, protein stability, response to stress and progression through the cell cycle. There are at least 4 SUMO paralogs in vertebrates, designated SUMO-1, SUMO-2, SUMO-3, and SUMO-4. SUMO-2 and SUMO-3 are structurally and functionally very similar and are distinct from SUMO-1. The amino acid sequence (SEQ ID NO: 1) spans amino acids 3-92 of a typical wild-type or naturally occurring SUMO-3 protein is shown in Table 1. In addition, a codon optimized DNA sequence encoding the SUMO-3 protein is also provided in Table 1, as SEQ ID NO: 5.

(32) TABLE-US-00001 TABLE1 SmallUbiquitin-likeModifier SUMO-3Protein EEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAY sequence CERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG (SEQIDNO:1) SUMO-3DNA GAAGAGAAACCGAAAGAGGGCGTTAAGACCGAGAATGACCAC sequence ATTAACCTGAAGGTCGCTGGTCAAGATGGCAGCGTGGTGCAGT TTAAGATCAAGCGTCACACGCCGTTGAGCAAGCTGATGAAGGC TTACTGCGAGCGTCAGGGTCTGAGCATGCGTCAGATCCGCTTTC GTTTCGATGGCCAGCCGATCAATGAGACTGACACCCCAGCGCA ACTGG(SEQIDNO:5)

(33) Thus, in some embodiments, a SUMO protein is a human SUMO-3 protein (SEQ ID NO: 1). In some embodiments, the SUMO protein may be another SUMO paralog, such as SUMO-1, SUMO-2 or SUMO-4. In some embodiments, a suitable replacement protein may be a homologue or an analogue of human SUMO-3 protein. For example, a homologue or an analogue of SUMO-3 protein may be a modified SUMO-3 protein containing one or more amino acid substitutions, deletions, and/or insertions as compared to a wild-type or naturally-occurring SUMO-3 protein (e.g. SEQ ID NO: 1), while retaining substantial SUMO-3 protein activity. Thus, in some embodiments, an enzyme suitable for the present invention is substantially homologous to a wild-type or naturally-occurring SUMO-3 protein (SEQ ID NO: 1). In some embodiments, an enzyme suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 1. In some embodiments, an enzyme suitable for the present invention is substantially identical to a wild-type or naturally-occurring SUMO-3 protein (SEQ ID NO: 1). In some embodiments, a protein suitable for the present invention contains a fragment or a portion of a SUMO protein. In some embodiments, the SUMO protein comprises human SUMO-1, human SUMO-2, human SUMO-3, any one of Arabidopsis Zhalania SUMO-1 through SUMO-8, tomato SUMO, any one of Xenopus laevis SUMO-1 through SUMO-3, Drosophila melanogasler Smt3, Caenorhabdilis elegans SMO-1, Schizosaccharomyces pombe Pmt3, malarial parasite Plasmodium falciparum SUMO, mold Aspergillus nidulans SUMO, an equivalent thereof, a homologue thereof, or a combination thereof.

(34) In some embodiments, the SUMO protein is encoded by a nucleic acid derived from an organism selected from the group consisting of human, mouse, insect, plant, yeast, and other eukaryotic organisms. In some embodiments, the SUMO protein is encoded by a nucleic acid derived from an organism selected from the group consisting of Homo sapiens, Arabidopsis Zhalania, tomato, Xenopus laevis, Drosophila melanogasler, Caenorhabdilis elegans, Schizosaccharomyces pombe, Plasmo diumfalciparum, or Aspergillus nidulans. In some embodiments, a nucleic acid suitable for the present invention has an sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 5. In some embodiments, a nucleic acid suitable for the present invention is substantially identical to a nucleic acid encoding a wild-type or naturally-occurring SUMO-3 protein (SEQ ID NO: 5).

(35) Guanylyl Transferase (GT)

(36) As used herein, a GT protein is any protein or portion of a protein that can substitute for at least partial activity of naturally-occurring Guanylyl Transferase (GT) protein. As used herein, the terms a GT protein and a GT enzyme and grammatical equivalents are used interchangeably.

(37) GT is an enzyme derived from the Vaccinia Virus system that facilitates the transfer and methylation of a guanylyl molecule to the 5 end of a messenger RNA molecule. This process, known as mRNA capping, is highly regulated and important for the creation of stable and mature mRNA able to undergo translation during protein synthesis. The GT enzyme comprises a heterodimer that includes a large subunit (D1, about 97 kDa) and a small subunit (D12, about 33 kDa). GT provides three enzymatic functions: phosphatase activity (cleavage of the nascent 5 triphosphate of mRNA to a diphosphate), guanylyl transferase activity (incorporation of a GTP molecule to the 5 end of the mRNA moiety) and methylation activity (incorporation of a methyl group at the N7 position of the guanylyl base). The amino acid sequence of the large subunit (SEQ ID NO: 6) and small subunit (SEQ ID NO: 7) of a typical wild-type or naturally occurring GT protein are shown in Table 2. In addition, codon optimized DNA sequences encoding the large and small subunits of GT are also provided in Table 2, as SEQ ID NO: 2 and SEQ ID NO: 3, respectively.

(38) TABLE-US-00002 TABLE2 GuanylylTransferase Largesubunit MDANVVSSSTIATYIDALAKNASELEQRSTAYEINNELELVFIKPPL (Proteinsequence) ITLTNVVNISTIQESFIRFTVTNKEGVKIRTKIPLSKVHGLDVKNVQL VDAIDNIVWEKKSLVTENRLHKECLLRLSTEERHIFLDYKKYGSSI RLELVNLIQAKTKNFTIDFKLKYFLGSGAQSKSSLLHAINHPKSRPN TSLEIEFTPRDNETVPYDELIKELTTLSRHIFMASPENVILSPPINAPI KTFMLPKQDIVGLDLENLYAVTKTDGIPITIRVTSNGLYCYFTHLG YIIRYPVKRIIDSEVVVFGEAVKDKNWTVYLIKLIEPVNAINDRLEE SKYVESKLVDICDRIVFKSKKYEGPFTTTSEVVDMLSTYLPKQPEG VILFYSKGPKSNIDFKIKKENTIDQTANVVFRYMSSEPIIFGESSIFVE YKKFSNDKGFPKEYGSGKIVLYNGVNYLNNIYCLEYINTHNEVGI KSVVVPIKFIAEFLVNGEILKPRIDKTMKYINSEDYYGNQHNIIVEH LRDQSIKIGDIFNEDKLSDVGHQYANNDKFRLNPEVSYFTNKRTRG PLGILSNYVKTLLISMYCSKTFLDDSNKRKVLAIDFGNGADLEKYF YGEIALLVATDPDADAIARGNERYNKLNSGIKTKYYKFDYIQETIR SDTFVSSVREVFYFGKFNIIDWQFAIHYSFHPRHYATVMNNLSELT ASGGKVLITTMDGDKLSKLTDKKTFIIHKNLPSSENYMSVEKIADD RIVVYNPSTMSTPMTEYIIKKNDIVRVFNEYGFVLVDNVDFATIIER SKKFINGASTMEDRPSTRNFFELNRGAIKCEGLDVEDLLSYYVVY VFSKR(SEQIDNO:6) Smallsubunit MDEIVKNIREGTHVLLPFYETLPELNLSLGKSPLPSLEYGANYFLQI (Proteinsequence) SRVNDLNRMPTDMLKLFTHDIMLPESDLDKVYEILKINSVKYYGR STKADAVVADLSARNKLFKRERDAIKSNNHLTENNLYISDYKMLT FDVFRPLFDFVNEKYCIIKLPTLFGRGVIDTMRIYCSLFKNVRLLKC VSDSWLKDSAIMVASDVCKKNLDLFMSHVKSVTKSSSWKDVNSV QFSILNNPVDTEFINKFLEFSNRVYEALYYVHSLLYSSMTSDSKSIE NKHQRRLVKLLL(SEQIDNO:7) Largesubunit AGATGGAAGATGAAGATACCATCGACGTCTTTCAGCAACAGAC (DNAsequence) CGGTGGTATGGATGCTAACGTCGTTAGCAGCAGCACCATTGCG ACTTACATTGATGCACTGGCCAAAAACGCATCTGAGCTTGAGC AGCGCAGCACCGCCTACGAGATCAATAACGAATTGGAGCTGGT TTTCATTAAACCGCCGCTGATCACGCTGACGAACGTCGTGAAC ATTAGCACGATTCAAGAGAGCTTTATTCGTTTCACCGTTACCAA TAAAGAAGGCGTGAAGATCCGTACCAAGATTCCGCTGAGCAAA GTGCATGGTCTGGACGTGAAAAATGTGCAGCTGGTTGATGCGA TCGATAACATCGTGTGGGAGAAGAAATCTTTGGTCACGGAAAA TCGTCTGCACAAGGAATGTCTGCTGCGTCTGTCAACCGAAGAA CGCCACATCTTCCTGGACTACAAGAAGTATGGTTCCAGCATCCG TCTGGAACTGGTGAACCTGATTCAGGCAAAGACCAAGAACTTC ACCATTGACTTCAAACTGAAGTATTTCCTGGGCTCTGGTGCACA GAGCAAATCCAGCTTGTTGCACGCGATTAACCATCCGAAGAGC CGTCCGAATACGAGCCTGGAGATCGAATTCACGCCGCGTGATA ACGAAACCGTTCCGTACGATGAGCTGATTAAAGAACTGACGAC GTTGAGCCGCCACATCTTTATGGCCAGCCCGGAAAACGTGATC CTTAGCCCGCCTATCAATGCGCCGATTAAAACCTTTATGTTACC GAAACAAGACATTGTGGGTCTGGACCTGGAAAACCTGTACGCG GTCACCAAAACGGACGGCATTCCGATCACGATTCGTGTTACCA GCAATGGTCTGTACTGCTATTTCACTCATTTGGGCTATATCATT CGTTATCCGGTGAAACGCATCATTGATTCTGAGGTTGTCGTTTT CGGCGAAGCAGTCAAGGACAAGAATTGGACTGTGTACCTGATC AAATTGATTGAACCGGTTAACGCCATCAATGACCGCCTGGAAG AGTCGAAATATGTTGAAAGCAAACTGGTGGATATTTGTGATCG TATCGTGTTCAAGAGCAAGAAATATGAAGGCCCGTTCACCACG ACCAGCGAAGTTGTTGACATGCTGAGCACCTATCTGCCGAAAC AACCTGAGGGTGTGATTCTGTTTTACTCCAAGGGTCCGAAGAG CAACATTGATTTCAAAATCAAGAAAGAGAATACCATTGATCAG ACCGCCAACGTTGTGTTCCGCTATATGTCCAGCGAGCCTATCAT TTTCGGTGAGTCGAGCATCTTTGTTGAATACAAAAAGTTTAGCA ACGATAAGGGTTTTCCGAAAGAATACGGTTCCGGTAAGATTGT GTTGTACAACGGCGTCAATTATCTGAACAACATCTACTGTCTGG AGTACATCAATACCCATAACGAAGTTGGCATTAAGTCTGTTGTC GTCCCGATCAAATTCATCGCGGAGTTCCTGGTTAACGGTGAGAT TCTGAAGCCGCGTATTGATAAAACTATGAAATACATTAACTCC GAAGATTACTACGGTAATCAGCATAACATCATCGTCGAGCACT TGCGTGATCAAAGCATTAAGATCGGTGACATCTTTAACGAAGA TAAGCTGAGCGATGTAGGCCACCAGTATGCGAACAATGACAAA TTTCGCCTGAATCCGGAAGTCAGCTACTTTACGAATAAGCGCAC CCGTGGTCCACTGGGTATCCTGAGCAATTATGTTAAAACCCTGT TGATTTCCATGTACTGCTCCAAAACGTTCCTGGACGACAGCAAC AAGCGCAAAGTTCTGGCGATCGACTTCGGTAATGGTGCCGATC TGGAGAAGTACTTTTATGGTGAGATCGCATTGCTGGTTGCTACC GACCCGGATGCAGATGCGATCGCCCGTGGCAACGAGCGTTACA ATAAGCTGAATAGCGGTATCAAGACCAAATACTACAAATTCGA CTATATTCAAGAGACGATCCGCTCGGACACCTTTGTATCCAGCG TGCGTGAGGTGTTTTACTTCGGTAAATTCAACATCATTGACTGG CAATTCGCCATTCACTATAGCTTTCACCCACGCCACTATGCGAC GGTCATGAACAACCTGTCTGAGCTGACCGCGAGCGGCGGTAAA GTTCTGATCACCACGATGGACGGTGACAAGCTGTCTAAACTGA CCGACAAAAAGACCTTCATTATTCACAAAAATCTCCCGTCGAG CGAGAATTACATGTCCGTCGAAAAGATTGCGGACGACCGTATT GTTGTCTACAACCCGAGCACTATGTCGACCCCAATGACCGAGT ATATCATCAAAAAGAATGACATTGTGCGTGTCTTTAATGAATAC GGTTTTGTGCTGGTCGACAACGTCGATTTTGCGACCATCATCGA GAGAAGCAAGAAATTCATTAATGGCGCTTCTACGATGGAAGAT CGCCCGAGCACGCGTAACTTCTTTGAGCTGAATCGTGGCGCGA TTAAGTGCGAGGGCCTGGACGTCGAGGATCTGCTGTCGTATTA CGTGGTTTATGTGTTTAGCAAACGTTAATGA(SEQIDNO:2) Smallsubunit ATGGACGAAATTGTCAAGAATATCCGTGAAGGTACCCACGTTT (DNAsequence) TACTGCCATTCTACGAGACGCTGCCGGAACTGAACCTGAGCCT GGGTAAAAGCCCTCTGCCGAGCCTGGAGTATGGTGCGAACTAT TTTCTGCAGATTTCCCGTGTAAACGATTTGAACCGCATGCCGAC GGACATGCTGAAACTGTTCACCCACGACATCATGCTGCCGGAA TCTGATCTGGATAAAGTTTACGAGATCTTGAAAATCAATTCAGT GAAGTACTATGGCCGTAGCACCAAGGCCGATGCGGTGGTCGCA GACCTGAGCGCGCGTAACAAACTGTTTAAACGTGAACGTGACG CAATTAAGAGCAATAACCATCTGACCGAGAACAATTTGTACAT CAGCGACTACAAGATGTTGACTTTTGACGTGTTTCGTCCGCTGT TCGACTTTGTTAATGAGAAATACTGCATTATCAAGCTGCCGACG TTGTTTGGTCGCGGCGTCATTGATACGATGCGCATTTACTGCTC TCTCTTCAAGAATGTGCGCCTGCTGAAGTGTGTCTCCGACAGCT GGCTGAAAGATAGCGCTATTATGGTTGCGAGCGACGTGTGTAA AAAGAACCTGGATCTGTTCATGAGCCACGTGAAGAGCGTTACC AAAAGCAGCAGCTGGAAAGACGTTAACAGCGTCCAGTTCTCCA TTCTGAATAACCCGGTCGATACCGAGTTTATCAACAAGTTCCTT GAATTCAGCAATCGCGTTTATGAGGCCCTGTATTACGTTCATAG CCTGCTGTATAGCTCCATGACCTCTGATAGCAAATCGATCGAGA ATAAACACCAACGTCGTCTGGTGAAACTGCTGCTGTAATGA (SEQIDNO:3)

(39) Thus, in some embodiments, a GT enzyme is a heterodimer comprising large and small subunits (SEQ ID NO: 6 and SEQ ID NO: 7, respectively). In some embodiments, the GT enzyme of the invention may be a homologue or analogue of one or the other of the GT large and small subunits. For example, a homologue or analogue of GT protein may be a modified GT protein containing one or more amino acid substitutions, deletions, and/or insertions as compared to SEQ ID NO: 6 and/or SEQ ID NO: 7, while retaining substantial GT protein activity. Thus, in some embodiments, an enzyme suitable for the present invention is substantially homologous to the GT protein large and small subunits (SEQ ID NO: 6 and SEQ ID NO: 7). In some embodiments, an enzyme suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 6. In some embodiments, an enzyme suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 7. In some embodiments, an enzyme suitable for the present invention is substantially identical to the large and small subunits of GT (SEQ ID NO: 6 and SEQ ID NO: 7). In some embodiments, an enzyme suitable for the present invention contains a fragment or a portion of a GT protein.

(40) In some embodiments, the GT protein is encoded by a nucleic acid derived from an virus selected from the group consisting of Vaccinia virus, Rabbitpox virus, Cowpox virus, Taterapox virus, Monkeypox virus, Variola major virus, Camelpox virus, Ectromelia virus, Variola minor virus, Orthopox virus, Raccoonpox virus, Skunkpox virus, Volepox virus, Yoka pox virus, Swinepox virus, Yaba monkey tumor virus, Deerpox virus, Myxoma virus, Tanapox virus, Goatpox virus, Rabbit fibroma virus, Lumpy skin disease virus, Sheeppox virus, Eptesipox virus, Squirrelpox virus, Molluscum contagiosum virus, Cotia virus, Orf virus, Bovine popular stomatitis virus, Pseudocowpox virus, Canarypox virus, Pidgeonpox virus, Penguinpox virus, and Fowlpox virus. In some embodiments, nucleic acids suitable for the present invention have a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 2. In some embodiments, nucleic acids suitable for the present invention have a sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 3. In some embodiments, nucleic acids suitable for the present invention are substantially identical to a nucleic acid encoding a GT protein (SEQ ID NO: 2 and SEQ ID NO: 3).

(41) SUMO-GT Fusion

(42) As used herein, a SUMO-GT fusion protein is any protein or portion of a protein that comprises a SUMO protein covalently linked to a Guanylyl Transferase (GT) protein, wherein the fusion protein can substitute for at least partial activity of naturally-occurring Guanylyl Transferase (GT) protein. As used herein, the terms a SUMO-GT fusion protein and a SUMO-GT fusion enzyme and grammatical equivalents are used interchangeably. An exemplary amino acid sequence of the fusion of SUMO and the GT large subunit (SEQ ID NO: 8) are shown in Table 3. In addition, an exemplary DNA sequence encoding the fusion of SUMO and the GT large subunit is also provided in Table 3, as SEQ ID NO: 4.

(43) TABLE-US-00003 TABLE3 SUMO-GTFusion SUMO-GTlarge ATGGGCCATCATCATCACCATCACGGCAGCCTGCAAGAAGAGA subunitDNA AACCGAAAGAGGGCGTTAAGACCGAGAATGACCACATTAACCT constructwithHis GAAGGTCGCTGGTCAAGATGGCAGCGTGGTGCAGTTTAAGATC tagandlinker AAGCGTCACACGCCGTTGAGCAAGCTGATGAAGGCTTACTGCG AGCGTCAGGGTCTGAGCATGCGTCAGATCCGCTTTCGTTTCGAT GGCCAGCCGATCAATGAGACTGACACCCCAGCGCAACTGGAGA TGGAAGATGAAGATACCATCGACGTCTTTCAGCAACAGACCGG TGGTATGGATGCTAACGTCGTTAGCAGCAGCACCATTGCGACTT ACATTGATGCACTGGCCAAAAACGCATCTGAGCTTGAGCAGCG CAGCACCGCCTACGAGATCAATAACGAATTGGAGCTGGTTTTC ATTAAACCGCCGCTGATCACGCTGACGAACGTCGTGAACATTA GCACGATTCAAGAGAGCTTTATTCGTTTCACCGTTACCAATAAA GAAGGCGTGAAGATCCGTACCAAGATTCCGCTGAGCAAAGTGC ATGGTCTGGACGTGAAAAATGTGCAGCTGGTTGATGCGATCGA TAACATCGTGTGGGAGAAGAAATCTTTGGTCACGGAAAATCGT CTGCACAAGGAATGTCTGCTGCGTCTGTCAACCGAAGAACGCC ACATCTTCCTGGACTACAAGAAGTATGGTTCCAGCATCCGTCTG GAACTGGTGAACCTGATTCAGGCAAAGACCAAGAACTTCACCA TTGACTTCAAACTGAAGTATTTCCTGGGCTCTGGTGCACAGAGC AAATCCAGCTTGTTGCACGCGATTAACCATCCGAAGAGCCGTC CGAATACGAGCCTGGAGATCGAATTCACGCCGCGTGATAACGA AACCGTTCCGTACGATGAGCTGATTAAAGAACTGACGACGTTG AGCCGCCACATCTTTATGGCCAGCCCGGAAAACGTGATCCTTA GCCCGCCTATCAATGCGCCGATTAAAACCTTTATGTTACCGAAA CAAGACATTGTGGGTCTGGACCTGGAAAACCTGTACGCGGTCA CCAAAACGGACGGCATTCCGATCACGATTCGTGTTACCAGCAA TGGTCTGTACTGCTATTTCACTCATTTGGGCTATATCATTCGTTA TCCGGTGAAACGCATCATTGATTCTGAGGTTGTCGTTTTCGGCG AAGCAGTCAAGGACAAGAATTGGACTGTGTACCTGATCAAATT GATTGAACCGGTTAACGCCATCAATGACCGCCTGGAAGAGTCG AAATATGTTGAAAGCAAACTGGTGGATATTTGTGATCGTATCGT GTTCAAGAGCAAGAAATATGAAGGCCCGTTCACCACGACCAGC GAAGTTGTTGACATGCTGAGCACCTATCTGCCGAAACAACCTG AGGGTGTGATTCTGTTTTACTCCAAGGGTCCGAAGAGCAACATT GATTTCAAAATCAAGAAAGAGAATACCATTGATCAGACCGCCA ACGTTGTGTTCCGCTATATGTCCAGCGAGCCTATCATTTTCGGT GAGTCGAGCATCTTTGTTGAATACAAAAAGTTTAGCAACGATA AGGGTTTTCCGAAAGAATACGGTTCCGGTAAGATTGTGTTGTAC AACGGCGTCAATTATCTGAACAACATCTACTGTCTGGAGTACAT CAATACCCATAACGAAGTTGGCATTAAGTCTGTTGTCGTCCCGA TCAAATTCATCGCGGAGTTCCTGGTTAACGGTGAGATTCTGAAG CCGCGTATTGATAAAACTATGAAATACATTAACTCCGAAGATT ACTACGGTAATCAGCATAACATCATCGTCGAGCACTTGCGTGA TCAAAGCATTAAGATCGGTGACATCTTTAACGAAGATAAGCTG AGCGATGTAGGCCACCAGTATGCGAACAATGACAAATTTCGCC TGAATCCGGAAGTCAGCTACTTTACGAATAAGCGCACCCGTGG TCCACTGGGTATCCTGAGCAATTATGTTAAAACCCTGTTGATTT CCATGTACTGCTCCAAAACGTTCCTGGACGACAGCAACAAGCG CAAAGTTCTGGCGATCGACTTCGGTAATGGTGCCGATCTGGAG AAGTACTTTTATGGTGAGATCGCATTGCTGGTTGCTACCGACCC GGATGCAGATGCGATCGCCCGTGGCAACGAGCGTTACAATAAG CTGAATAGCGGTATCAAGACCAAATACTACAAATTCGACTATA TTCAAGAGACGATCCGCTCGGACACCTTTGTATCCAGCGTGCGT GAGGTGTTTTACTTCGGTAAATTCAACATCATTGACTGGCAATT CGCCATTCACTATAGCTTTCACCCACGCCACTATGCGACGGTCA TGAACAACCTGTCTGAGCTGACCGCGAGCGGCGGTAAAGTTCT GATCACCACGATGGACGGTGACAAGCTGTCTAAACTGACCGAC AAAAAGACCTTCATTATTCACAAAAATCTCCCGTCGAGCGAGA ATTACATGTCCGTCGAAAAGATTGCGGACGACCGTATTGTTGTC TACAACCCGAGCACTATGTCGACCCCAATGACCGAGTATATCA TCAAAAAGAATGACATTGTGCGTGTCTTTAATGAATACGGTTTT GTGCTGGTCGACAACGTCGATTTTGCGACCATCATCGAGAGAA GCAAGAAATTCATTAATGGCGCTTCTACGATGGAAGATCGCCC GAGCACGCGTAACTTCTTTGAGCTGAATCGTGGCGCGATTAAG TGCGAGGGCCTGGACGTCGAGGATCTGCTGTCGTATTACGTGG TTTATGTGTTTAGCAAACGTTAATGA(SEQIDNO:4) SUMO-GTlarge MGHHHHHHGSLQEEKPKEGVKTENDHINLKVAGQDGSVVQFKIK subunitprotein RHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMED withHistagand EDTIDVFQQQTGGMDANVVSSSTIATYIDALAKNASELEQRSTAY linker EINNELELVFIKPPLITLTNVVNISTIQESFIRFTVTNKEGVKIRTKIPL SKVHGLDVKNVQLVDAIDNIVWEKKSLVTENRLHKECLLRLSTEE RHIFLDYKKYGSSIRLELVNLIQAKTKNFTIDFKLKYFLGSGAQSKS SLLHAINHPKSRPNTSLEIEFTPRDNETVPYDELIKELTTLSRHIFMA SPENVILSPPINAPIKTFMLPKQDIVGLDLENLYAVTKTDGIPITIRV TSNGLYCYFTHLGYIIRYPVKRIIDSEVVVFGEAVKDKNWTVYLIK LIEPVNAINDRLEESKYVESKLVDICDRIVFKSKKYEGPFTTTSEVV DMLSTYLPKQPEGVILFYSKGPKSNIDFKIKKENTIDQTANVVFRY MSSEPIIFGESSIFVEYKKFSNDKGFPKEYGSGKIVLYNGVNYLNNI YCLEYINTHNEVGIKSVVVPIKFIAEFLVNGEILKPRIDKTMKYINSE DYYGNQHNIIVEHLRDQSIKIGDIFNEDKLSDVGHQYANNDKFRL NPEVSYFTNKRTRGPLGILSNYVKTLLISMYCSKTFLDDSNKRKVL AIDFGNGADLEKYFYGEIALLVATDPDADAIARGNERYNKLNSGI KTKYYKFDYIQETIRSDTFVSSVREVFYFGKFNIIDWQFAIHYSFHP RHYATVMNNLSELTASGGKVLITTMDGDKLSKLTDKKTFIIHKNL PSSENYMSVEKIADDRIVVYNPSTMSTPMTEYIIKKNDIVRVFNEY GFVLVDNVDFATIIERSKKFINGASTMEDRPSTRNFFELNRGAIKCE GLDVEDLLSYYVVYVFSKR(SEQIDNO:8)

(44) In some embodiments, the SUMO-GT fusion protein comprises SEQ ID NO: 8. In some embodiments, the SUMO-GT fusion protein is a heterodimer comprising SEQ ID NO: 8 and SEQ ID NO: 7. In some embodiments, the GT enzyme of the invention may be a homologue or analogue of one or the other of the GT large and small subunits. For example, a homologue or analogue of the SUMO-GT fusion protein may be a modified SUMO-GT fusion protein containing one or more amino acid substitutions, deletions, and/or insertions as compared to SEQ ID NO: 8 and/or SEQ ID NO: 7, while retaining substantial GT protein activity. Thus, in some embodiments, a SUMO-GT fusion protein suitable for the present invention is substantially homologous to the heterodimer comprising the GT small subunit (SEQ ID NO: 7) and the fusion of SUMO and the GT large subunit (SEQ ID NO: 8). In some embodiments, an enzyme suitable for the present invention has an amino acid sequence at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to SEQ ID NO: 8 and SEQ ID NO: 7. In some embodiments, an enzyme suitable for the present invention is substantially identical to the heterodimer comprising the GT small subunit (SEQ ID NO: 7) and the fusion of SUMO and the GT large subunit (SEQ ID NO: 8). In some embodiments, an enzyme suitable for the present invention contains a fragment or a portion of a GT protein covalently bound to a SUMO protein.

(45) Production of SUMO-GT Fusion Protein

(46) Host Cells

(47) As used herein, the term host cells refers to cells that can be used to produce a SUMO-GT fusion protein. In particular, host cells are suitable for producing a SUMO-GT fusion protein at a large scale. In some embodiments, host cells are able to produce SUMO-GT fusion protein in an amount of or greater than about 5 picogram/cell/day (e.g., greater than about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 picogram/cell/day). In some embodiments, host cells are able to produce SUMO-GT fusion protein in an amount ranging from about 5-100 picogram/cell/day (e.g., about 5-90 picogram/cell/day, about 5-80 picogram/cell/day, about 5-70 picogram/cell/day, about 5-60 picogram/cell/day, about 5-50 picogram/cell/day, about 5-40 picogram/cell/day, about 5-30 picogram/cell/day, about 10-90 picogram/cell/day, about 10-80 picogram/cell/day, about 10-70 picogram/cell/day, about 10-60 picogram/cell/day, about 10-50 picogram/cell/day, about 10-40 picogram/cell/day, about 10-30 picogram/cell/day, about 20-90 picogram/cell/day, about 20-80 picogram/cell/day, about 20-70 picogram/cell/day, about 20-60 picogram/cell/day, about 20-50 picogram/cell/day, about 20-40 picogram/cell/day, about 20-30 picogram/cell/day).

(48) Suitable host cells can be derived from a variety of organisms, including, but not limited to, bacteria, yeast, insects, plants, birds (e.g., avian systems), amphibians, and mammals. In some embodiments, host cells are non-mammalian cells. Non-limiting examples of non-mammalian host cells suitable for the present invention include cells and cell lines derived from Escherichia coli, Salmonella typhimurium, Bacillus subtilis, Bacillus licheniformis, Bacteroides fragilis, Clostridia perfringens, Clostridia difficile for bacteria; Pichia pastoris, Pichia methanolica, Pichia angusta, Schizosaccharomyces pombe, Saccharomyces cerevisiae, and Yarrowia lipolytica for yeast; Sodoptera frugiperda, Trichoplusis ni, Drosophila melangoster and Manduca sexta for insects; and and Xenopus Laevis from amphibian.

(49) In some embodiments, host cells are mammalian cells. Any mammalian cell susceptible to cell culture, and to expression of polypeptides, may be utilized in accordance with the present invention as a host cell. Non-limiting examples of mammalian cells that may be used in accordance with the present invention include human embryonic kidney 293 cells (HEK293), HeLa cells; BALB/c mouse myeloma line (NSO/l, ECACC No: 85110503); human retinoblasts (PER.C6 (CruCell, Leiden, The Netherlands)); monkey kidney CVI line transformed by SV40 (COS-7, ATCC CRL 1651); human fibrosarcomacell line (e.g., HT-1080); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol., 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells +/DHFR (CHO, Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77:4216 (1980)); mouse sertoli cells (TM4, Mather, Biol. Reprod., 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad. Sci., 383:44-68 (1982)); MRC 5 cells; FS4 cells; a human hepatoma line (Hep G2), human cell line CAP and AGE1. HN, and Glycotope's panel.

(50) Additionally, any number of available hybridoma cell lines may be utilized in accordance with the present invention. One skilled in the art will appreciate that hybridoma cell lines might have different nutrition requirements and/or might require different culture conditions for optimal growth and polypeptide or protein expression, and will be able to modify conditions as needed.

(51) Expression Vectors

(52) Various nucleic acid constructs can be used to express SUMO-GT fusion protein described herein in host cells. A suitable vector construct typically includes, in addition to SUMO-GT fusion protein-encoding sequences (also referred to as SUMO-GT fusion transgene), regulatory sequences, gene control sequences, promoters, non-coding sequences and/or other appropriate sequences for expression of the protein and, optionally, for replication of the construct. Typically, the coding region is operably linked with one or more of these nucleic acid components.

(53) Regulatory sequences typically refer to nucleotide sequences located upstream (5 non-coding sequences), within, or downstream (3 non-coding sequences) of a coding sequence, and which influence the transcription, RNA processing or stability, or translation of the associated coding sequence. Regulatory sequences may include promoters, enhancers, 5 untranslated sequences, translation leader sequences, introns, and 3 untranslated sequences such as polyadenylation recognition sequences. Sometimes, regulatory sequences are also referred to as gene control sequences.

(54) Promoter typically refers to a nucleotide sequence capable of controlling the expression of a coding sequence or functional RNA. In general, a coding sequence is located 3 to a promoter sequence. The promoter sequence consists of proximal and more distal upstream elements, the latter elements often referred to as enhancers. Accordingly, an enhancer is a nucleotide sequence that can stimulate promoter activity and may be an innate element of the promoter or a heterologous element inserted to enhance the level or tissue-specificity of a promoter. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from different promoters found in nature, or even comprise synthetic nucleotide segments. It is understood by those skilled in the art that different promoters may direct the expression of a gene in different tissues or cell types, or at different stages of development, or in response to different environmental conditions.

(55) The 3 non-coding sequences typically refer to nucleotide sequences located downstream of a coding sequence and include polyadenylation recognition sequences and other sequences encoding regulatory signals capable of affecting mRNA processing or gene expression. The polyadenylation signal is usually characterized by affecting the addition of polyadenylic acid tracts to the 3 end of the mRNA precursor.

(56) The translation leader sequence or 5 non-coding sequences typically refers to a nucleotide sequence located between the promoter sequence of a gene and the coding sequence. The translation leader sequence is present in the fully processed mRNA upstream of the translation start sequence. The translation leader sequence may affect processing of the primary transcript to mRNA, mRNA stability or translation efficiency.

(57) Typically, the term operatively linked refers to the association of two or more nucleic acid fragments on a single nucleic acid fragment so that the function of one is affected by the other. For example, a promoter is operatively linked with a coding sequence when it is capable of affecting the expression of that coding sequence (i.e., that the coding sequence is under the transcriptional control of the promoter). Coding sequences can be operatively linked to regulatory sequences in sense or antisense orientation.

(58) The coding region of a transgene may include one or more silent mutations to optimize codon usage for a particular cell type. For example, the codons of an SUMO-GT fusion transgene may be optimized for expression in a bacterial cell. In some embodiments, the codons of an SUMO-GT fusion transgene may be optimized for expression in an E. coli cell. In some embodiments, the codons of an SUMO-GT fusion transgene may be optimized for expression in a mammalian cell. In some embodiments, the codons of an SUMO-GT fusion transgene may be optimized for expression in a human cell.

(59) Optionally, a construct may contain additional components such as one or more of the following: a splice site, an enhancer sequence, a selectable marker gene under the control of an appropriate promoter, an amplifiable marker gene under the control of an appropriate promoter, and a matrix attachment region (MAR) or other element known in the art that enhances expression of the region where it is inserted.

(60) Once transfected or transduced into host cells, a suitable vector can express extrachromosomally (episomally) or integrate into the host cell's genome.

(61) In some embodiments, a DNA construct that integrates into the cell's genome, it need include only the transgene nucleic acid sequences. In that case, the express of the transgene is typically controlled by the regulatory sequences at the integration site. Optionally, it can include additional various regulatory sequences described herein.

(62) Culture Medium and Conditions

(63) The term medium and culture medium as used herein refers to a general class of solution containing nutrients suitable for maintaining and/or growing cells in vitro. Typically, medium solutions provide, without limitation, essential and nonessential amino acids, vitamins, energy sources, lipids, and trace elements required by the cell for at least minimal growth and/or survival. In other embodiments, the medium may contain an amino acid(s) derived from any source or method known in the art, including, but not limited to, an amino acid(s) derived either from single amino acid addition(s) or from a peptone or protein hydrolysate addition(s) (including animal or plant source(s)). Vitamins such as, but not limited to, Biotin, Pantothenate, Choline Chloride, Folic Acid, Myo-Inositol, Niacinamide, Pyridoxine, Riboflavin, Vitamin B12, Thiamine, Putrescine and/or combinations thereof. Salts such as, but not limited to, CaCl.sub.2, KCl, MgCl.sub.2, NaCl, Sodium Phosphate Monobasic, Sodium Phosphate Dibasic, Sodium Selenite, CuSO.sub.4, ZnCl.sub.2 and/or combinations thereof. Fatty acids such as, but not limited to, Arachidonic Acid, Linoleic Acid, Oleic Acid, Lauric Acid, Myristic Acid, as well as Methyl-beta-Cyclodextrin and/or combinations thereof). In some embodiments, medium comprises additional components such as glucose, glutamine, Na-pyruvate, insulin or ethanolamine, a protective agent such as Pluronic F68. In some embodiments, the medium may also contain components that enhance growth and/or survival above the minimal rate, including hormones and growth factors. Medium may also comprise one or more buffering agents. The buffering agents may be designed and/or selected to maintain the culture at a particular pH (e.g., a physiological pH, (e.g., pH 6.8 to pH 7.4)). A variety of buffers suitable for culturing cells are known in the art and may be used in the methods. Suitable buffers (e.g., bicarbonate buffers, HEPES buffer, Good's buffers, etc.) are those that have the capacity and efficiency for maintaining physiological pH despite changes in carbon dioxide concentration associated with cellular respiration. The solution is preferably formulated to a pH and salt concentration optimal for cell survival and proliferation.

(64) In some embodiments, medium may be a chemically defined medium. As used herein, the term chemically-defined nutrient medium refers to a medium of which substantially all of the chemical components are known. In some embodiments, a chemically defined nutrient medium is free of animal-derived components. In some cases, a chemically-defined medium comprises one or more proteins (e.g., protein growth factors or cytokines.) In some cases, a chemically-defined nutrient medium comprises one or more protein hydrolysates. In other cases, a chemically-defined nutrient medium is a protein-free media, i.e., a serum-free media that contains no proteins, hydrolysates or components of unknown composition.

(65) Typically, a chemically defined medium can be prepared by combining various individual components such as, for example, essential and nonessential amino acids, vitamins, energy sources, lipids, salts, buffering agents, and trace elements, at predetermined weight or molar percentages or ratios. Exemplary serum-free, in particular, chemically-defined media are described in US Pub. No. 2006/0148074, the disclosure of which is hereby incorporated by reference.

(66) In some embodiments, a chemically defined medium suitable for the present invention is a commercially available medium such as, but not limited to, Terrific Broth, Cinnabar, 2YT or LB. In some embodiments, a chemically defined medium suitable for the present invention is a mixture of one or more commercially available chemically defined mediums. In various embodiments, a suitable medium is a mixture of two, three, four, five, six, seven, eight, nine, ten, or more commercially available chemically defined media. In some embodiments, each individual commercially available chemically defined medium (e.g., such as those described herein) constitutes, by weight, 1%, 2.5%, 5%, 7.5%, 10%, 12.5%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or more, of the mixture. Ratios between each individual component medium may be determined by relative weight percentage present in the mixture. In some embodiments, protein expression is increased with the addition of IPTG to repress the promoter.

(67) In some embodiments, a chemically defined medium may be supplemented by one or more animal derived components. Such animal derived components include, but are not limited to, fetal calf serum, horse serum, goat serum, donkey serum, human serum, and serum derived proteins such as albumins (e.g., bovine serum albumin or human serum albumin).

(68) The present invention provides a method of producing SUMO-GT fusion protein at a large scale. Typical large-scale procedures for producing a fusion polypeptide of interest include batch cultures and fed-batch cultures. Batch culture processes traditionally comprise inoculating a large-scale production culture with a seed culture of a particular cell density, growing the cells under conditions (e.g., suitable culture medium, pH, and temperature) conducive to cell growth, viability, and/or productivity, harvesting the culture when the cells reach a specified cell density, and purifying the expressed polypeptide. Fed-batch culture procedures include an additional step or steps of supplementing the batch culture with nutrients and other components that are consumed during the growth of the cells. In some embodiments, a large-scale production method according to the present invention uses a fed-batch culture system.

(69) Purification of Expressed SUMO-GT Fusion Protein

(70) Various methods may be used to purify or isolate SUMO-GT fusion protein produced according to various methods described herein. In some embodiments, the expressed SUMO-GT fusion protein is secreted into the medium and thus cells and other solids may be removed, as by centrifugation or filtering for example, as a first step in the purification process. Alternatively or additionally, the expressed SUMO-GT fusion protein is bound to the surface of the host cell. In this embodiment, the host cells (for example, bacterials cells) expressing the polypeptide or protein are lysed for purification. Lysis of host cells (e.g., bacterials cells) can be achieved by any number of means well known to those of ordinary skill in the art, including physical disruption by glass beads and exposure to high pH conditions.

(71) The SUMO-GT fusion protein may be isolated and purified by standard methods including, but not limited to, chromatography (e.g., ion exchange, affinity, size exclusion, and hydroxyapatite chromatography), gel filtration, centrifugation, or differential solubility, ethanol precipitation or by any other available technique for the purification of proteins (See, e.g., Scopes, Protein Purification Principles and Practice 2nd Edition, Springer-Verlag, New York, 1987; Higgins, S. J. and Hames, B. D. (eds.), Protein Expression: A Practical Approach, Oxford Univ Press, 1999; and Deutscher, M. P., Simon, M. I., Abelson, J. N. (eds.), Guide to Protein Purification: Methods in Enzymology (Methods in Enzymology Series, Vol 182), Academic Press, 1997, all incorporated herein by reference). For immunoaffinity chromatography in particular, the protein may be isolated by binding it to an affinity column comprising antibodies that were raised against that protein and were affixed to a stationary support. Protease inhibitors such as phenyl methyl sulfonyl fluoride (PMSF), leupeptin, pepstatin or aprotinin may be added at any or all stages in order to reduce or eliminate degradation of the polypeptide or protein during the purification process. Protease inhibitors are particularly desired when cells must be lysed in order to isolate and purify the expressed polypeptide or protein.

(72) Solubility

(73) Various methods may be used to determine the solubility of a protein in an expression system. In an exemplary method, bacteria are spun down and resuspended in a mild lysis buffer containing 1% IGEPAL and protease inhibitors. Lysis is supported by repeated freezing and thawing the bacteria. Soluble and insoluble fraction are separated by centrifigation. To determine the total amount of recombinant protein the same volume of bacterial culture is spun down and lysed in the same amount of lysis buffer containing 1% IGEPAL and 0.1% SDS. Soluble and total protein are analyzed by SDS-PAGE, with western blotting if necessary. In some embodiments, the expression system is E. coli. In some embodiments, solubility of GT is improved when it has been produced as a fusion protein. In some embodiments, the fusion protein is a SUMO-GT fusion protein. In some embodiments, the SUMO-GT fusion protein has increased solubility compared to the non-fusion GT protein. In some embodiments, the increased solubility of the SUMO-GT fusion protein compared to the non-fusion GT protein is observed during shake flask production of the SUMO-GT fusion protein. In some embodiments, the increased solubility of the SUMO-GT fusion protein compared to the non-fusion GT protein is observed during fermentation production of the SUMO-GT fusion protein.

Use of SUMO-GT Fusion in mRNA Capping

(74) Production of Capped mRNAs

(75) According to the present invention, a SUMO-GT fusion protein described herein may be used to produce capped mRNAs by in vitro transcription. Various in vitro transcription assays are available in the art and can be used to practice the present invention. For example, in vitro transcription was originally developed by Krieg and Melton (METHODS ENZYMOL., 1987, 155:397-415) for the synthesis of RNA using an RNA phage polymerase. Typically these reactions include at least a phage RNA polymerase (T7, T3 or SP6), a DNA template containing a phage polymerase promoter, nucleotides (ATP, CTP, GTP and UTP), and a buffer containing a magnesium salt. RNA synthesis yields may be optimized by increasing nucleotide concentrations, adjusting magnesium concentrations and by including inorganic pyrophosphatase (U.S. Pat. No. 5,256,555; Gurevich, et al., ANAL. BIOCHEM. 195:207-213 (1991); Sampson, J. R. and Uhlenbeck, O. C., PROC. NATL. ACAD. SCI. USA. 85, 1033-1037 (1988); Wyatt, J. R., et al., BIOTECHNIQUES, 11:764-769 (1991)). The RNA synthesized in these reactions is usually characterized by a 5 terminal nucleotide that has a triphosphate at the 5 position of the ribose. Typically, depending on the RNA polymerase and promoter combination used, this nucleotide is a guanosine, although it can be an adenosine (see e.g., Coleman, T. M., et al., NUCLEIC ACIDS RES., 32: e14 (2004)). In these reactions, all four nucleotides are typically included at equimolar concentrations and none of them is limiting.

(76) Some embodiment of the invention are batch reactions-that is, all components are combined and then incubated at about 37 C. to promote the polymerization of the RNA until the reaction terminates. Typically, a batch reaction is used for convenience and to obtain as much RNA as needed from such reactions for their experiments. In some embodiments, a fed-batch system (see, e.g., JEFFREY A. KERN, BATCH AND FED-BATCH STRATEGIES FOR LARGE-SCALE PRODUCTION OF RNA BY IN VITRO TRANSACTION (University of Colorado) (1997)) is used to increase the efficiency of the in vitro transcription reaction. All components are combined, but then additional amounts of some of the reagents are added over time, such as the nucleotides and magnesium, to try to maintain constant reaction conditions. In addition, in some embodiments, the pH of the reaction may be held at 7.4 by monitoring it over time and adding KOH as needed.

(77) To synthesize a capped RNA by in vitro transcription, a cap analog (e.g., N-7 methyl GpppG; i.c., m.sup.7GpppG) is included in the transcription reaction. In some embodiments, the cap analog will be incorporated at the 5 terminus by the enzyme guanylyl transferase. In some embodiments, the guanylyl transferase is a fusion protein. In some embodiments, the guanylyl transferase fusion protein formed when a guanylyl transferase is covalently linked to a SUMO protein. In some embodiments, the cap analog will be incorporated only at the 5 terminus because it does not have a 5 triphosphate. In some embodiments using a T7, T3 and SP6 RNA polymerase, the +1 nucleotide of their respective promoters is usually a G residue and if both GTP and m7GpppG are present in equal concentrations in the transcription reaction, then they each have an equal chance of being incorporated at the +1 position. In some embodiments, m.sup.7GpppG is present in these reactions at several-fold higher concentrations than the GTP to increase the chances that a transcript will have a 5 cap. In some embodiments, a mMESSAGE mMACHINE kit (Cat. #1344, Ambion, Inc.) is used according to manufacturer's instructions, where it is recommended that the cap to GTP ratio be 4:1 (6 mM:1.5 mM). In some embodiments, as the ratio of the cap analog to GTP increases in the reaction, the ratio of capped to uncapped RNA increases proportionally. Considerations of capping efficiency must be balanced with considerations of yield. Increasing the ratio of cap analog to GTP in the transcription reaction produces lower yields of total RNA because the concentration of GTP becomes limiting when holding the total concentration of cap and GTP constant. Thus, the final RNA yield is dependent on GTP concentration, which is necessary for the elongation of the transcript. The other nucleotides (ATP, CTP, UTP) are present in excess.

(78) In particular embodiments, mRNA are synthesized by in vitro transcription from a plasmid DNA template encoding a gene of choice. In some embodiments, in vitro transcription includes addition of a 5 cap structure, Cap1 (FIG. 1B), which has a 2-O-methyl residue at the 2 OH group of the ribose ring of base 1, by enzymatic conjugation of GTP via a guanylyl transferase. In some embodiments, in vitro transcription includes addition of a 5 cap structure, Cap0 (FIG. 1A), which lacks the 2-O-methyl residue, by enzymatic conjugation of GTP via a guanylyl transferase. In some embodiments, in vitro transcription includes addition of a 5 cap of any of the cap structures disclosed herein by enzymatic conjugation of GTP via a guanylyl transferase.

(79) Capping Efficiency

(80) The present invention significantly increases capping efficiency. In some embodiments, the use of a SUMO-GT fusion protein in an in vitro capping assay results in at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% capped mRNA. In some embodiments, the use of a SUMO-GT fusion protein in an in vitro capping assay results in substantially 100% capped mRNA. In some embodiments, the use of a SUMO-GT fusion protein in an in vitro capping assay results in increase of mRNA capping efficiency by at least about 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 1-fold, 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, or 5-fold as compared to a control assay using a non-fusion GT protein but under otherwise identical conditions.

(81) In addition, the present invention permits large-scale production of capped mRNA with high efficiency. In some embodiments, capped mRNA is produced at a scale of or greater than 1 gram, 5 grams, 10 grams, 15 grams, 20 grams, 25 grams, 30 grams, 35 grams, 40 grams, 45 grams, 50 grams, 75 grams, 100 grams, 150 grams, 200 grams, 250 grams, 300 grams, 350 grams, 400 grams, 450 grams, 500 grams, 550 grams, 600 grams, 650 grams, 700 grams, 750 grams, 800 grams, 850 grams, 900 grams, 950 grams, 1 kg, 2.5 kg, 5 kg, 7.5 kg, 10 kg, 25 kg, 50 kg, 75 kg, or 100 kg per batch.

(82) Methods of estimating capping efficiency are known in the art. For example, the T7 RNA polymerase can be incubated with a cap dinucleotide, all four ribonucleotide triphosphates, [-.sup.32P]GTP, and a short DNA template in which G is the first ribonucleotide specified after the promoter (see Grudzien, E. et al. Novel cap analogs for in vitro synthesis of mRNA with high translation efficiency, RNA, 10:1479-1487 (2004)). Any nucleotide on the 5 side of a G residue acquires a .sup.32P-labeled 3-phosphate group after RNase T2 digestion by nearest-neighbor transfer. Anion exchange chromatography is then used to resolve labeled nucleoside 3-monophosphates, resulting from internal positions in the RNA, from 5-terminal products. 5-terminal products are of two types. Uncapped RNAs yield labeled guanosine 5-triphosphate 3-monophosphate (p3Gp*; in which * indicates the labeled phosphate group). Capped RNAs yield various 5-terminal structures, depending on the nature of the cap analog used (m.sup.7Gp3Gp* and Gp3m.sup.7Gp* when the cap analog is m.sup.7Gp3G).

(83) Improved methods of directly quantitating mRNA capping efficiency in a sample (e.g., a representative aliquot sample from an in vitro synthesis reaction) are provided in WO 2014/152673, which is incorporated herein by reference. Some embodiments comprise the use of a cap specific binding substance under conditions that permit the formation of a complex between the cap specific binding substance and the capped mRNA. The formation of a complex between the cap specific binding substance and the capped mRNA allows quantitative determination of the amount of the complex (i.e., capped mRNAs) relative to a positive control of capped products or negative control of uncapped products. In other words, binding indicates the amount of capped mRNA targets in the sample and the capping efficiency in a reaction from which the sample is derived. Thus, in some embodiments, the step of quantitatively determining the amount of the complex comprises performing an ELISA-type assay wherein the cap specific binding substance is an antibody or other protein that specifically binds an mRNA cap. Complex formation can be quantified by addition of a detection agent specific for the cap specific binding substance (e.g., a goat anti-mouse antibody that binds a mouse anti-m.sup.7G antibody) and which produces a signal directly proportional to the amount of capped mRNA. Embodiments of the invention may be used to quantify the capping efficiency of a wide variety of RNA species, including in vitro transcribed mRNA, isolated eukaryotic mRNA, and viral RNA.

(84) Additional improved methods of directly quantitating mRNA capping efficiency in a sample (e.g., a representative aliquot sample from an in vitro synthesis reaction) are provided in WO 2014/152659, which is incorporated herein by reference. Some embodiments of the invention comprise chromatographic methods of quantitating mRNA capping efficiency. These methods are based in part on the insights that the versatility of enzymatic manipulation can be used to increase the resolution of chromatographic separation of polynucleotides. Thus, by amplifying the power of chromatographic separation through enzymatic manipulation, embodiments of the invention increase the efficiency, quality and throughput of quantitation. For example, not only can the chromatographic methods described herein quantitate capping efficiency, they can also provide information on the modification of the cap (e.g., methylation status at particular cap positions). Thus, embodiments of the invention can simultaneously quantitate capping efficiency and the efficiency of cap modification (e.g., methlylation efficiency). This quantification provides important characterization of an mRNA drug product that has significant impact on the protein production.

(85) The invention will be more fully understood by reference to the following examples. They should not, however, be construed as limiting the scope of the invention. All literature citations are incorporated by reference.

EXAMPLES

Example 1: SUMO-GT Construct Design

(86) A new construct incorporating a small ubiquitin-like modifier (SUMO) tag covalently linked and co-expressed with the large subunit faction of a guanylyl transferase (GT) heterodimer was synthesized.

(87) TABLE-US-00004 Smallubiquitin-likemodifier(SUMO)DNA: (SEQIDNO:5) GAAGAGAAACCGAAAGAGGGCGTTAAGACCGAGAATGACCACATTAACCTGAAGG TCGCTGGTCAAGATGGCAGCGTGGTGCAGTTTAAGATCAAGCGTCACACGCCGTTGA GCAAGCTGATGAAGGCTTACTGCGAGCGTCAGGGTCTGAGCATGCGTCAGATCCGC TTTCGTTTCGATGGCCAGCCGATCAATGAGACTGACACCCCAGCGCAACTGG Guanylyltransferase(GT)largesubunitDNA: (SEQIDNO:2) AGATGGAAGATGAAGATACCATCGACGTCTTTCAGCAACAGACCGGTGGTATGGAT GCTAACGTCGTTAGCAGCAGCACCATTGCGACTTACATTGATGCACTGGCCAAAAAC GCATCTGAGCTTGAGCAGCGCAGCACCGCCTACGAGATCAATAACGAATTGGAGCT GGTTTTCATTAAACCGCCGCTGATCACGCTGACGAACGTCGTGAACATTAGCACGAT TCAAGAGAGCTTTATTCGTTTCACCGTTACCAATAAAGAAGGCGTGAAGATCCGTAC CAAGATTCCGCTGAGCAAAGTGCATGGTCTGGACGTGAAAAATGTGCAGCTGGTTG ATGCGATCGATAACATCGTGTGGGAGAAGAAATCTTTGGTCACGGAAAATCGTCTG CACAAGGAATGTCTGCTGCGTCTGTCAACCGAAGAACGCCACATCTTCCTGGACTAC AAGAAGTATGGTTCCAGCATCCGTCTGGAACTGGTGAACCTGATTCAGGCAAAGAC CAAGAACTTCACCATTGACTTCAAACTGAAGTATTTCCTGGGCTCTGGTGCACAGAG CAAATCCAGCTTGTTGCACGCGATTAACCATCCGAAGAGCCGTCCGAATACGAGCCT GGAGATCGAATTCACGCCGCGTGATAACGAAACCGTTCCGTACGATGAGCTGATTA AAGAACTGACGACGTTGAGCCGCCACATCTTTATGGCCAGCCCGGAAAACGTGATC CTTAGCCCGCCTATCAATGCGCCGATTAAAACCTTTATGTTACCGAAACAAGACATT GTGGGTCTGGACCTGGAAAACCTGTACGCGGTCACCAAAACGGACGGCATTCCGAT CACGATTCGTGTTACCAGCAATGGTCTGTACTGCTATTTCACTCATTTGGGCTATATC ATTCGTTATCCGGTGAAACGCATCATTGATTCTGAGGTTGTCGTTTTCGGCGAAGCA GTCAAGGACAAGAATTGGACTGTGTACCTGATCAAATTGATTGAACCGGTTAACGCC ATCAATGACCGCCTGGAAGAGTCGAAATATGTTGAAAGCAAACTGGTGGATATTTG TGATCGTATCGTGTTCAAGAGCAAGAAATATGAAGGCCCGTTCACCACGACCAGCG AAGTTGTTGACATGCTGAGCACCTATCTGCCGAAACAACCTGAGGGTGTGATTCTGT TTTACTCCAAGGGTCCGAAGAGCAACATTGATTTCAAAATCAAGAAAGAGAATACC ATTGATCAGACCGCCAACGTTGTGTTCCGCTATATGTCCAGCGAGCCTATCATTTTCG GTGAGTCGAGCATCTTTGTTGAATACAAAAAGTTTAGCAACGATAAGGGTTTTCCGA AAGAATACGGTTCCGGTAAGATTGTGTTGTACAACGGCGTCAATTATCTGAACAACA TCTACTGTCTGGAGTACATCAATACCCATAACGAAGTTGGCATTAAGTCTGTTGTCG TCCCGATCAAATTCATCGCGGAGTTCCTGGTTAACGGTGAGATTCTGAAGCCGCGTA TTGATAAAACTATGAAATACATTAACTCCGAAGATTACTACGGTAATCAGCATAACA TCATCGTCGAGCACTTGCGTGATCAAAGCATTAAGATCGGTGACATCTTTAACGAAG ATAAGCTGAGCGATGTAGGCCACCAGTATGCGAACAATGACAAATTTCGCCTGAAT CCGGAAGTCAGCTACTTTACGAATAAGCGCACCCGTGGTCCACTGGGTATCCTGAGC AATTATGTTAAAACCCTGTTGATTTCCATGTACTGCTCCAAAACGTTCCTGGACGAC AGCAACAAGCGCAAAGTTCTGGCGATCGACTTCGGTAATGGTGCCGATCTGGAGAA GTACTTTTATGGTGAGATCGCATTGCTGGTTGCTACCGACCCGGATGCAGATGCGAT CGCCCGTGGCAACGAGCGTTACAATAAGCTGAATAGCGGTATCAAGACCAAATACT ACAAATTCGACTATATTCAAGAGACGATCCGCTCGGACACCTTTGTATCCAGCGTGC GTGAGGTGTTTTACTTCGGTAAATTCAACATCATTGACTGGCAATTCGCCATTCACTA TAGCTTTCACCCACGCCACTATGCGACGGTCATGAACAACCTGTCTGAGCTGACCGC GAGCGGCGGTAAAGTTCTGATCACCACGATGGACGGTGACAAGCTGTCTAAACTGA CCGACAAAAAGACCTTCATTATTCACAAAAATCTCCCGTCGAGCGAGAATTACATGT CCGTCGAAAAGATTGCGGACGACCGTATTGTTGTCTACAACCCGAGCACTATGTCGA CCCCAATGACCGAGTATATCATCAAAAAGAATGACATTGTGCGTGTCTTTAATGAAT ACGGTTTTGTGCTGGTCGACAACGTCGATTTTGCGACCATCATCGAGAGAAGCAAGA AATTCATTAATGGCGCTTCTACGATGGAAGATCGCCCGAGCACGCGTAACTTCTTTG AGCTGAATCGTGGCGCGATTAAGTGCGAGGGCCTGGACGTCGAGGATCTGCTGTCG TATTACGTGGTTTATGTGTTTAGCAAACGTTAATGA Guanylyltransferase(GT)smallsubunitDNA: (SEQIDNO:3) ATGGACGAAATTGTCAAGAATATCCGTGAAGGTACCCACGTTTTACTGCCATTCTAC GAGACGCTGCCGGAACTGAACCTGAGCCTGGGTAAAAGCCCTCTGCCGAGCCTGGA GTATGGTGCGAACTATTTTCTGCAGATTTCCCGTGTAAACGATTTGAACCGCATGCC GACGGACATGCTGAAACTGTTCACCCACGACATCATGCTGCCGGAATCTGATCTGGA TAAAGTTTACGAGATCTTGAAAATCAATTCAGTGAAGTACTATGGCCGTAGCACCAA GGCCGATGCGGTGGTCGCAGACCTGAGCGCGCGTAACAAACTGTTTAAACGTGAAC GTGACGCAATTAAGAGCAATAACCATCTGACCGAGAACAATTTGTACATCAGCGAC TACAAGATGTTGACTTTTGACGTGTTTCGTCCGCTGTTCGACTTTGTTAATGAGAAAT ACTGCATTATCAAGCTGCCGACGTTGTTTGGTCGCGGCGTCATTGATACGATGCGCA TTTACTGCTCTCTCTTCAAGAATGTGCGCCTGCTGAAGTGTGTCTCCGACAGCTGGCT GAAAGATAGCGCTATTATGGTTGCGAGCGACGTGTGTAAAAAGAACCTGGATCTGT TCATGAGCCACGTGAAGAGCGTTACCAAAAGCAGCAGCTGGAAAGACGTTAACAGC GTCCAGTTCTCCATTCTGAATAACCCGGTCGATACCGAGTTTATCAACAAGTTCCTTG AATTCAGCAATCGCGTTTATGAGGCCCTGTATTACGTTCATAGCCTGCTGTATAGCTC CATGACCTCTGATAGCAAATCGATCGAGAATAAACACCAACGTCGTCTGGTGAAAC TGCTGCTGTAATGA SUMO-GTlargesubunitDNAconstructwithHistagandlinker: (SEQIDNO:4) ATGGGCCATCATCATCACCATCACGGCAGCCTGCAAGAAGAGAAACCGAAAGAGGG CGTTAAGACCGAGAATGACCACATTAACCTGAAGGTCGCTGGTCAAGATGGCAGCG TGGTGCAGTTTAAGATCAAGCGTCACACGCCGTTGAGCAAGCTGATGAAGGCTTACT GCGAGCGTCAGGGTCTGAGCATGCGTCAGATCCGCTTTCGTTTCGATGGCCAGCCGA TCAATGAGACTGACACCCCAGCGCAACTGGAGATGGAAGATGAAGATACCATCGAC GTCTTTCAGCAACAGACCGGTGGTATGGATGCTAACGTCGTTAGCAGCAGCACCATT GCGACTTACATTGATGCACTGGCCAAAAACGCATCTGAGCTTGAGCAGCGCAGCAC CGCCTACGAGATCAATAACGAATTGGAGCTGGTTTTCATTAAACCGCCGCTGATCAC GCTGACGAACGTCGTGAACATTAGCACGATTCAAGAGAGCTTTATTCGTTTCACCGT TACCAATAAAGAAGGCGTGAAGATCCGTACCAAGATTCCGCTGAGCAAAGTGCATG GTCTGGACGTGAAAAATGTGCAGCTGGTTGATGCGATCGATAACATCGTGTGGGAG AAGAAATCTTTGGTCACGGAAAATCGTCTGCACAAGGAATGTCTGCTGCGTCTGTCA ACCGAAGAACGCCACATCTTCCTGGACTACAAGAAGTATGGTTCCAGCATCCGTCTG GAACTGGTGAACCTGATTCAGGCAAAGACCAAGAACTTCACCATTGACTTCAAACT GAAGTATTTCCTGGGCTCTGGTGCACAGAGCAAATCCAGCTTGTTGCACGCGATTAA CCATCCGAAGAGCCGTCCGAATACGAGCCTGGAGATCGAATTCACGCCGCGTGATA ACGAAACCGTTCCGTACGATGAGCTGATTAAAGAACTGACGACGTTGAGCCGCCAC ATCTTTATGGCCAGCCCGGAAAACGTGATCCTTAGCCCGCCTATCAATGCGCCGATT AAAACCTTTATGTTACCGAAACAAGACATTGTGGGTCTGGACCTGGAAAACCTGTAC GCGGTCACCAAAACGGACGGCATTCCGATCACGATTCGTGTTACCAGCAATGGTCTG TACTGCTATTTCACTCATTTGGGCTATATCATTCGTTATCCGGTGAAACGCATCATTG ATTCTGAGGTTGTCGTTTTCGGCGAAGCAGTCAAGGACAAGAATTGGACTGTGTACC TGATCAAATTGATTGAACCGGTTAACGCCATCAATGACCGCCTGGAAGAGTCGAAA TATGTTGAAAGCAAACTGGTGGATATTTGTGATCGTATCGTGTTCAAGAGCAAGAAA TATGAAGGCCCGTTCACCACGACCAGCGAAGTTGTTGACATGCTGAGCACCTATCTG CCGAAACAACCTGAGGGTGTGATTCTGTTTTACTCCAAGGGTCCGAAGAGCAACATT GATTTCAAAATCAAGAAAGAGAATACCATTGATCAGACCGCCAACGTTGTGTTCCGC TATATGTCCAGCGAGCCTATCATTTTCGGTGAGTCGAGCATCTTTGTTGAATACAAA AAGTTTAGCAACGATAAGGGTTTTCCGAAAGAATACGGTTCCGGTAAGATTGTGTTG TACAACGGCGTCAATTATCTGAACAACATCTACTGTCTGGAGTACATCAATACCCAT AACGAAGTTGGCATTAAGTCTGTTGTCGTCCCGATCAAATTCATCGCGGAGTTCCTG GTTAACGGTGAGATTCTGAAGCCGCGTATTGATAAAACTATGAAATACATTAACTCC GAAGATTACTACGGTAATCAGCATAACATCATCGTCGAGCACTTGCGTGATCAAAGC ATTAAGATCGGTGACATCTTTAACGAAGATAAGCTGAGCGATGTAGGCCACCAGTA TGCGAACAATGACAAATTTCGCCTGAATCCGGAAGTCAGCTACTTTACGAATAAGCG CACCCGTGGTCCACTGGGTATCCTGAGCAATTATGTTAAAACCCTGTTGATTTCCAT GTACTGCTCCAAAACGTTCCTGGACGACAGCAACAAGCGCAAAGTTCTGGCGATCG ACTTCGGTAATGGTGCCGATCTGGAGAAGTACTTTTATGGTGAGATCGCATTGCTGG TTGCTACCGACCCGGATGCAGATGCGATCGCCCGTGGCAACGAGCGTTACAATAAG CTGAATAGCGGTATCAAGACCAAATACTACAAATTCGACTATATTCAAGAGACGAT CCGCTCGGACACCTTTGTATCCAGCGTGCGTGAGGTGTTTTACTTCGGTAAATTCAA CATCATTGACTGGCAATTCGCCATTCACTATAGCTTTCACCCACGCCACTATGCGAC GGTCATGAACAACCTGTCTGAGCTGACCGCGAGCGGCGGTAAAGTTCTGATCACCA CGATGGACGGTGACAAGCTGTCTAAACTGACCGACAAAAAGACCTTCATTATTCAC AAAAATCTCCCGTCGAGCGAGAATTACATGTCCGTCGAAAAGATTGCGGACGACCG TATTGTTGTCTACAACCCGAGCACTATGTCGACCCCAATGACCGAGTATATCATCAA AAAGAATGACATTGTGCGTGTCTTTAATGAATACGGTTTTGTGCTGGTCGACAACGT CGATTTTGCGACCATCATCGAGAGAAGCAAGAAATTCATTAATGGCGCTTCTACGAT GGAAGATCGCCCGAGCACGCGTAACTTCTTTGAGCTGAATCGTGGCGCGATTAAGTG CGAGGGCCTGGACGTCGAGGATCTGCTGTCGTATTACGTGGTTTATGTGTTTAGCAA ACGTTAATGA Smallubiquitin-likemodifier(SUMO)protein: (SEQIDNO:1) EEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRF DGQPINETDTPAQLEMEDEDTIDVFQQQTGG Guanylyltransferase(GT)largesubunitprotein: (SEQIDNO:6) MDANVVSSSTIATYIDALAKNASELEQRSTAYEINNELELVFIKPPLITLTNVVNISTIQES FIRFTVTNKEGVKIRTKIPLSKVHGLDVKNVQLVDAIDNIVWEKKSLVTENRLHKECLLR LSTEERHIFLDYKKYGSSIRLELVNLIQAKTKNFTIDFKLKYFLGSGAQSKSSLLHAINHP KSRPNTSLEIEFTPRDNETVPYDELIKELTTLSRHIFMASPENVILSPPINAPIKTFMLPKQD IVGLDLENLYAVTKTDGIPITIRVTSNGLYCYFTHLGYIIRYPVKRIIDSEVVVFGEAVKDK NWTVYLIKLIEPVNAINDRLEESKYVESKLVDICDRIVFKSKKYEGPFTTTSEVVDMLST YLPKQPEGVILFYSKGPKSNIDFKIKKENTIDQTANVVFRYMSSEPIIFGESSIFVEYKKFS NDKGFPKEYGSGKIVLYNGVNYLNNIYCLEYINTHNEVGIKSVVVPIKFIAEFLVNGEILK PRIDKTMKYINSEDYYGNQHNIIVEHLRDQSIKIGDIFNEDKLSDVGHQYANNDKFRLNP EVSYFTNKRTRGPLGILSNYVKTLLISMYCSKTFLDDSNKRKVLAIDFGNGADLEKYFY GEIALLVATDPDADAIARGNERYNKLNSGIKTKYYKFDYIQETIRSDTFVSSVREVFYFG KFNIIDWQFAIHYSFHPRHYATVMNNLSELTASGGKVLITTMDGDKLSKLTDKKTFIIHK NLPSSENYMSVEKIADDRIVVYNPSTMSTPMTEYIIKKNDIVRVFNEYGFVLVDNVDFAT IIERSKKFINGASTMEDRPSTRNFFELNRGAIKCEGLDVEDLLSYYVVYVFSKR Guanylyltransferase(GT)smallsubunitprotein: (SEQIDNO:7) MDEIVKNIREGTHVLLPFYETLPELNLSLGKSPLPSLEYGANYFLQISRVNDLNRMPTDM LKLFTHDIMLPESDLDKVYEILKINSVKYYGRSTKADAVVADLSARNKLFKRERDAIKS NNHLTENNLYISDYKMLTFDVFRPLFDFVNEKYCIIKLPTLFGRGVIDTMRIYCSLFKNV RLLKCVSDSWLKDSAIMVASDVCKKNLDLFMSHVKSVTKSSSWKDVNSVQFSILNNPV DTEFINKFLEFSNRVYEALYYVHSLLYSSMTSDSKSIENKHQRRLVKLLL SUMO-GTlargesubunitproteinwithHistagandlinker: (SEQIDNO:8) MGHHHHHHGSLQEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC ERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGMDANVVSSSTIATYI DALAKNASELEQRSTAYEINNELELVFIKPPLITLTNVVNISTIQESFIRFTVTNKEGVKIRT KIPLSKVHGLDVKNVQLVDAIDNIVWEKKSLVTENRLHKECLLRLSTEERHIFLDYKKY GSSIRLELVNLIQAKTKNFTIDFKLKYFLGSGAQSKSSLLHAINHPKSRPNTSLEIEFTPRD NETVPYDELIKELTTLSRHIFMASPENVILSPPINAPIKTFMLPKQDIVGLDLENLYAVTKT DGIPITIRVTSNGLYCYFTHLGYIIRYPVKRIIDSEVVVFGEAVKDKNWTVYLIKLIEPVNA INDRLEESKYVESKLVDICDRIVFKSKKYEGPFTTTSEVVDMLSTYLPKQPEGVILFYSKG PKSNIDFKIKKENTIDQTANVVFRYMSSEPIIFGESSIFVEYKKFSNDKGFPKEYGSGKIVL YNGVNYLNNIYCLEYINTHNEVGIKSVVVPIKFIAEFLVNGEILKPRIDKTMKYINSEDYY GNQHNIIVEHLRDQSIKIGDIFNEDKLSDVGHQYANNDKFRLNPEVSYFTNKRTRGPLGI LSNYVKTLLISMYCSKTFLDDSNKRKVLAIDFGNGADLEKYFYGEIALLVATDPDADAI ARGNERYNKLNSGIKTKYYKFDYIQETIRSDTFVSSVREVFYFGKFNIIDWQFAIHYSFHP RHYATVMNNLSELTASGGKVLITTMDGDKLSKLTDKKTFIIHKNLPSSENYMSVEKIAD DRIVVYNPSTMSTPMTEYIIKKNDIVRVFNEYGFVLVDNVDFATIIERSKKFINGASTMED RPSTRNFFELNRGAIKCEGLDVEDLLSYYVVYVFSKR

Example 2: Production of SUMO-GT Protein

(88) Shake Flask

(89) Production of SUMO-GT fusion protein can be performed according to standard methods and procedures. For example, to test and compare expression of the GT and SUMO-GT fusion proteins, a single colony of the E. coli Rosetta strain (Novagen) containing each of the SUMO-eGFP plasmids was inoculated into 5 ml of Luria-Bertani (LB) media containing 100 ug/ml Kanamycin and 30 g/ml chloramphenicol. This strain is derived from the lambda DE3 lysogen strain and carries a chromosomal copy of the IPTG-inducible T7 RNA polymerase along with tRNAs on a pACYC-based plasmid. The cells were grown at 37 C. overnight with shaking at 250 rpm. The next morning the overnight culture was transferred into 100 ml fresh medium to permit exponential growth. When the OD600 value reached 0.6-0.7, protein expression was induced by addition of 1 mM IPTG (isopropropyl--D-thiogalactopyranoside), followed by prolonged cultivation at either 37 C. for 3 hours or 20 C. overnight (about 15 hours).

(90) After the E. coli cells were harvested from LB medium (100 ml) by centrifugation (8,000g for 10 min at 4 C.), the cell pellets were suspended in 6 ml of lysis buffer (PBS containing 300 mM NaCl, 10 mM imidazole, Detergent 0.1% TRITON X-100 and 1 mM PMSF, pH 8.0). The cells were lysed by sonication (at 50% output for 530 second pulses). The sonication was conducted with the tube jacketed in wet ice and 1 min intervals between the pulse cycles to prevent heating. After the lysates were incubated with DNase and RNase (each at 40 g/ml) for 15 min to digest nucleic acids, they were centrifuged at 20,000 g for 30 min at 4 C., and the supernatant (soluble protein fractions) was collected. The pellets was washed once with 6 ml of the lysis buffer to further extract the soluble fraction; the wash (6 ml) was combined with previous extract (6 ml) to make final volume of 12 ml for the soluble protein sample.

(91) Insoluble protein samples were prepared from E. coli inclusion bodies. Briefly, after the extract containing soluble proteins were removed, the pellets containing inclusion bodies were suspended in the denaturing solubilization buffer (Novagen) that contained 50 mM CAPS (pH 11.0), 0.3% N-laurylsarcosine, and 1 mM DTT and incubated for 20 min at room temperature with shaking. The extract (insoluble protein fraction) was obtained by high-speed centrifugation (80,000g for 20 min at 4 C.).

(92) For detection of expressed proteins using SDS-PAGE, 5 l of the samples prepared above were mixed with 3 l of SDSPAGE sample buffer containing SDS and -mercaptoethanol and were heated at 95 C. for 5 min to facilitate denaturation and reduction of proteins. Proteins were visualized using 15% SDS-polyacrylamide gels with Tris-Glycine running buffer and Coomassie blue staining.

(93) Fermentation

(94) The substantial increase in the solubility of the final SUMO-GT complexed enzyme was also reproduced by fermentation. Fermentation was performed according to standard methods and procedures. For example, fermentation methods for production of SUMO-GT fusion protein comprised cell lysis, Immobilized Metal Affinity Chromatography (IMAC), Cation Exchange Chromatography, Anion Exchange Chromatography, and Tangential Flow Filtration (TFF) formulation. Quality testing of the SUMO-GT fusion protein that resulted from fermentation comprised Reducing SDS PAGE to determine purity and identity, Reverse-Phase HPLC to determine purity, A280 measurement of concentration and Limulus amebocyte lysate (LAL) assay to test for endotoxin.

(95) As shown in FIG. 2, the yield of soluble SUMO-GT protein produced by fermentation is comparable to that of GT protein produced via the shake flask method.

Equivalents

(96) Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. The scope of the present invention is not intended to be limited to the above Description, but rather is as set forth in the following claims: