COVALENT, CHEMOGENETIC ACTIVATORS FOR K2P POTASSIUM CHANNELS AND USES THEREOF
20260098008 · 2026-04-09
Inventors
- Adam R. Renslo (Oakland, CA)
- Daniel L. Minor (San Francisco, CA, US)
- Panker E. Deal (Oakland, CA, US)
- Clifford Bryant (Albuquerque, NM, US)
- Xochina Cora EiHilali-Pollard (Oakland, CA, US)
- Marco Gaetano Lorenzo Lolicato (Pavia, IT)
Cpc classification
C07K14/705
CHEMISTRY; METALLURGY
A61K31/553
HUMAN NECESSITIES
A61K48/005
HUMAN NECESSITIES
A61K31/336
HUMAN NECESSITIES
C07D333/24
CHEMISTRY; METALLURGY
A61K31/505
HUMAN NECESSITIES
A61K31/17
HUMAN NECESSITIES
C07C237/42
CHEMISTRY; METALLURGY
C07C275/50
CHEMISTRY; METALLURGY
C07D211/04
CHEMISTRY; METALLURGY
A61K31/4406
HUMAN NECESSITIES
C07D303/36
CHEMISTRY; METALLURGY
A61K31/341
HUMAN NECESSITIES
C07C275/40
CHEMISTRY; METALLURGY
A61K31/167
HUMAN NECESSITIES
A61K38/177
HUMAN NECESSITIES
C07D207/452
CHEMISTRY; METALLURGY
C07D307/54
CHEMISTRY; METALLURGY
A61K31/36
HUMAN NECESSITIES
C07D207/444
CHEMISTRY; METALLURGY
C07C233/66
CHEMISTRY; METALLURGY
C07C237/30
CHEMISTRY; METALLURGY
A61K31/196
HUMAN NECESSITIES
C07D207/456
CHEMISTRY; METALLURGY
C07D285/00
CHEMISTRY; METALLURGY
C07D317/60
CHEMISTRY; METALLURGY
A61K31/55
HUMAN NECESSITIES
International classification
C07C237/42
CHEMISTRY; METALLURGY
A61K31/167
HUMAN NECESSITIES
A61K31/17
HUMAN NECESSITIES
A61K31/196
HUMAN NECESSITIES
A61K31/336
HUMAN NECESSITIES
A61K31/341
HUMAN NECESSITIES
A61K31/36
HUMAN NECESSITIES
A61K31/4406
HUMAN NECESSITIES
A61K31/451
HUMAN NECESSITIES
A61K31/505
HUMAN NECESSITIES
A61K31/55
HUMAN NECESSITIES
A61K31/553
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
C07C233/66
CHEMISTRY; METALLURGY
C07C237/30
CHEMISTRY; METALLURGY
C07C275/40
CHEMISTRY; METALLURGY
C07C275/50
CHEMISTRY; METALLURGY
C07D207/444
CHEMISTRY; METALLURGY
C07D207/452
CHEMISTRY; METALLURGY
C07D207/456
CHEMISTRY; METALLURGY
C07D211/04
CHEMISTRY; METALLURGY
C07D285/00
CHEMISTRY; METALLURGY
C07D303/36
CHEMISTRY; METALLURGY
C07D307/54
CHEMISTRY; METALLURGY
C07D317/60
CHEMISTRY; METALLURGY
C07D333/24
CHEMISTRY; METALLURGY
Abstract
Disclosed herein are, inter alia, activators of K2P potassium channels and pharmaceutical compositions thereof, and methods comprising their use for the treatment of diseases or adverse conditions related to low TREK family protein activity.
Claims
1. A compound, or a pharmaceutically acceptable salt thereof, having the formula (I): ##STR00182## wherein: L.sup.1 is a bond, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene; R.sup.1 is hydrogen, halogen, CX.sup.1.sub.3, CHX.sup.1.sub.2, CH.sub.2X.sup.1, OCX.sup.1.sub.3, OCHX.sup.1.sub.2, OCH.sub.2X.sup.1, CN, N.sub.3, SO.sub.n1R.sup.1A, SO.sub.v1NR.sup.1BR.sup.1C, NHNR.sup.1BR.sup.1C, ONR.sup.1BR.sup.1C, NHC(O)NHNR.sup.1BR.sup.1C, NHC(O)NR.sup.1BR.sup.1C, N(O).sub.m1, NR.sup.1BR.sup.1C, C(O)R.sup.1D, C(O)OR.sup.1D, C(O)NR.sup.1BR.sup.1C, OR.sup.1A, NR.sup.1BSO.sub.2R.sup.1A, NR.sup.1BC(O)R.sup.1D, NR.sup.1BC(O)OR.sup.1D, NR.sup.1BOR.sup.1D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.2 is hydrogen, halogen, CX.sup.2.sub.3, CHX.sup.2.sub.2, CH.sub.2X.sup.2, OCX.sup.2.sub.3, OCHX.sup.2.sub.2, OCH.sub.2X.sup.2, CN, N.sub.3, SO.sub.n2R.sup.2A, SO.sub.v2NR.sup.2BR.sup.2C, NHR.sup.2BR.sup.2C, ONR.sup.2BR.sup.2C, NHC(O)NHNR.sup.2BR.sup.2C, NHC(O)NR.sup.2BR.sup.2C, N(O).sub.m2, NR.sup.2BR.sup.2C, C(O)R.sup.2D, C(O)OR.sup.2D, C(O)NR.sup.2BR.sup.2C, OR.sup.2A, NR.sup.2BSO.sub.2R.sup.2A, NR.sup.2BC(O)R.sup.2D, NR.sup.2BC(O)OR.sup.2D, NR.sup.2BOR.sup.2D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.3 is hydrogen, halogen, CX.sup.3.sub.3, CHX.sup.3.sub.2, CH.sub.2X.sup.3, OCX.sup.3.sub.3, OCHX.sup.3.sub.2, OCH.sub.2X.sup.3, CN, N.sub.3, SO.sub.n3R.sup.3A, SO.sub.v3NR.sup.3BR.sup.3C, NR.sup.3BR.sup.3C, ONR.sup.3BR.sup.3C, NHC(O)NHNR.sup.3BR.sup.3C, NHC(O)NR.sup.3BR.sup.3C, N(O).sub.m3, NR.sup.3BR.sup.3C, C(O)R.sup.3D, C(O)OR.sup.3D, C(O)NR.sup.3BR.sup.3C, OR.sup.3A, NR.sup.3BSO.sub.2R.sup.3A, NR.sup.3BC(O)R.sup.3D, NR.sup.3BC(O)OR.sup.3D NR.sup.3BOR.sup.3D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.4 is hydrogen, halogen, CX.sup.4.sub.3, CHX.sup.4.sub.2, CH.sub.2X.sup.4, OCX.sup.4.sub.3, OCHX.sup.4.sub.2, OCH.sub.2X.sup.4, CN, N.sub.3, SO.sub.n4R.sup.4A, SO.sub.v4NR.sup.4BR.sup.4C, NHNR.sup.4BR.sup.4C, ONR.sup.4BR.sup.4C, NHC(O)NHNR.sup.4BR.sup.4C, NHC(O)NR.sup.4BR.sup.4C, N(O).sub.m4, NR.sup.4BR.sup.4C, C(O)R.sup.4D, C(O)OR.sup.4D, C(O)NR.sup.4BR.sup.4C, OR.sup.4A, NR.sup.4BSO.sub.2R.sup.4A, NR.sup.4BC(O)R.sup.4D, NR.sup.4BC(O)OR.sup.4D, NR.sup.4BOR.sup.4D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.5 is hydrogen, halogen, CX.sup.5.sub.3, CHX.sup.5.sub.2, CH.sub.2X.sup.5, OCX.sup.5.sub.3, OCHX.sup.5.sub.2, OCH.sub.2X.sup.5, CN, N.sub.3, SO.sub.n5R.sup.5A, SO.sub.v5NR.sup.5BR.sup.5C, NHNR.sup.5BR.sup.5C, ONR.sup.5BR.sup.5C, NHC(O)NHNR.sup.5BR.sup.5C, NHC(O)NR.sup.5BR.sup.5C, N(O).sub.m5, NR.sup.5BR.sup.5C, C(O)R.sup.5D, C(O)OR.sup.5D, C(O)NR.sup.5BR.sup.5C, OR.sup.5A, NR.sup.5BSO.sub.2R.sup.5A, NR.sup.5BC(O)R.sup.5D, NR.sup.5BC(O)OR.sup.5D, NR.sup.5BOR.sup.5D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.6 is hydrogen, substituted or unsubstituted alkyl, or substituted or unsubstituted heteroalkyl; or R.sup.6 is optionally joined with L.sup.1 to form a substituted or unsubstituted heterocycloalkyl; R.sup.7 is independently halogen, CX.sup.7.sub.3, CHX.sup.7.sub.2, CH.sub.2X.sup.7, OCX.sup.7.sub.3, OCHX.sup.7.sub.2, OCH.sub.2X.sup.7, CN, N.sub.3, SO.sub.n7R.sup.7A, SO.sub.v7NR.sup.7BR.sup.7C, NR.sup.7BR.sup.7C, ONR.sup.7BR.sup.7C, NHC(O)NHNR.sup.7BR.sup.7C, NHC(O)NR.sup.7BR.sup.7C, N(O).sub.m7, NR.sup.7BR.sup.7C, C(O)R.sup.7D, C(O)OR.sup.7D, C(O)NR.sup.7BR.sup.7C, OR.sup.7A, NR.sup.7BSO.sub.2R.sup.7A, NR.sup.7BC(O)R.sup.7D, NR.sup.7BC(O)OR.sup.7D, NR.sup.7BOR.sup.7D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.1A, R.sup.1B, R.sup.1C, R.sup.1D, R.sup.2A, R.sup.2B, R.sup.2C, R.sup.2D, R.sup.3A, R.sup.3B, R.sup.3C, R.sup.3D, R.sup.4A, R.sup.4B, R.sup.4C, R.sup.4D, R.sup.5A, R.sup.5B, R.sup.5C, R.sup.5D, R.sup.7A, R.sup.7B, R.sup.7C, and R.sup.7D are independently hydrogen, halogen, CF.sub.3, Cl.sub.3, CBr.sub.3, CI.sub.3, COOH, CONH.sub.2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; each X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, and X.sup.7 is independently halogen; n is an integer from 0 to 3; n1, n2, n3, n4, n5, and n7 are independently an integer from 0 to 4; m1, m2, m3, m4, m5, m7, v1, v2, v3, v4, v5, and v7 are independently 1 or 2; and R.sup.8 is a cysteine binding moiety or a serine binding moiety.
2. The compound of claim 1, wherein the cysteine binding moiety is: ##STR00183## wherein: R.sup.15 is hydrogen, halogen, CX.sup.15.sub.3, CHX.sup.15.sub.2, CH.sub.2X.sup.15, CN, SO.sub.n15R.sup.15D, SO.sub.v15NR.sup.15AR.sup.15B, NHNR.sup.15AR.sup.15B, ONR.sup.15AR.sup.15B, NHC(O)NHNR.sup.15AR.sup.15B, NHC(O)NR.sup.15AR.sup.15B, N(O).sub.m15, NR.sup.15AR.sup.15B, C(O)R.sup.15C, C(O)OR.sup.15C, C(O)NR.sup.15AR.sup.15B, OR.sup.15D, NR.sup.15ASO.sub.2R.sup.15D, NR.sup.15AC(O)R.sup.15C, NR.sup.15AC(O)OR.sup.15C, NR.sup.15AOR.sup.15C, OCX.sup.15.sub.3, OCHX.sup.15.sub.2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.16 is hydrogen, halogen, CX.sup.16.sub.3, CHX.sup.16.sub.2, CH.sub.2X.sup.16, CN, SO.sub.n16R.sup.16D, SO.sub.v16NR.sup.16AR.sup.16B, NHNR.sup.16AR.sup.16B ONR.sup.16AR.sup.16B, NHC(O)NHNR.sup.16AR.sup.16B, NHC(O)NR.sup.16AR.sup.16B, N(O).sub.m16, NR.sup.16AR.sup.16B C(O)R.sup.16C, C(O)OR.sup.16C, C(O)NR.sup.16AR.sup.16B, OR.sup.16D, NR.sup.16ASO.sub.2R.sup.16D, NR.sup.16AC(O)R.sup.16C, NR.sup.16AC(O)OR.sup.16C, NR.sup.16AOR.sup.16C, OCX.sup.16.sub.3, OCHX.sup.16.sub.2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.17 is hydrogen, halogen, CX.sup.17.sub.3, CHX.sup.17.sub.2, CH.sub.2X.sup.17, CN, SO.sub.n17R.sup.17D, SO.sub.v17NR.sup.17AR.sup.17B, NHNR.sup.17AR.sup.17B, ONR.sup.17AR.sup.17B, NHC(O)NHNR.sup.17AR.sup.17B, NHC(O)NR.sup.17AR.sup.17B, N(O).sub.m17, NR.sup.17AR.sup.17B, C(O)R.sup.17C, C(O)OR.sup.17C, C(O)NR.sup.17AR.sup.17B, OR.sup.17D, NR.sup.17ASO.sub.2R.sup.17D, NR.sup.17AC(O)R.sup.17C, NR.sup.17AC(O)OR.sup.17C, NR.sup.17AOR.sup.17C, OCX.sup.17.sub.3, OCHX.sup.17.sub.2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.18 is hydrogen, CX.sup.18.sub.3, CHX.sup.18.sub.2, CH.sub.2X.sup.18, C(O)R.sup.18C, C(O)OR.sup.18C, C(O)NR.sup.18AR.sup.18B, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.15A, R.sup.15B, R.sup.15C, R.sup.15D, R.sup.16A, R.sup.16B, R.sup.16C, R.sup.16D, R.sup.17A, R.sup.17B, R.sup.17C, R.sup.17D, R.sup.18A, R.sup.18B, and R.sup.18C are independently hydrogen, CX.sub.3, CN, COOH, CONH.sub.2, CHX.sub.2, CH.sub.2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.15A and R.sup.15B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R.sup.16A and R.sup.16B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R.sup.17A and R.sup.17B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R.sup.18A and R.sup.18B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; X, X.sup.15, X.sup.16, X.sup.17, and X.sup.18 are independently F, Cl, Br, or I; n15, n16, and n17 are independently an integer from 0 to 4; and m15, m16, m17, v15, v16, and v17 are independently 1 or 2.
3. The compound of claim 2, wherein R.sup.15, R.sup.16, R.sup.17, and R.sup.18 are independently hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl, or substituted or unsubstituted 2 to 4 membered heteroalkyl.
4. The compound of claim 2, wherein R.sup.15, R.sup.16, R.sup.17, and R.sup.18 are independently hydrogen or unsubstituted C.sub.1-C.sub.2 alkyl and X.sup.17 is Cl.
5. The compound of claim 1, wherein the cysteine binding moiety is: ##STR00184##
6. The compound of claim 1, wherein the serine binding moiety is: ##STR00185## wherein: R.sup.15, R.sup.16, R.sup.16, and R.sup.18 are independently hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl, or substituted or unsubstituted 2 to 4 membered heteroalkyl; and X.sup.17 is halogen.
7. The compound of claim 6, wherein R.sup.15, R.sup.16, R.sup.17, and R.sup.18 are independently hydrogen or unsubstituted C.sub.1-C.sub.2 alkyl and X.sup.17 is Cl.
8. The compound of claim 6, wherein the serine binding moiety is: ##STR00186##
9. The compound of claim 1, wherein R.sup.1 is hydrogen or halogen.
10. The compound of claim 1, wherein R.sup.1 is Cl.
11. The compound of claim 1, wherein R.sup.2 is hydrogen or halogen.
12. The compound of claim 1, wherein R.sup.2 is hydrogen.
13. The compound of claim 1, wherein R.sup.2 is F or Cl.
14. The compound of claim 1, wherein R.sup.3 is halogen or C.sub.1-C.sub.4 substituted or unsubstituted alkynyl.
15. The compound of claim 1, wherein R.sup.3 is halogen.
16. The compound of claim 1, wherein R.sup.3 is Cl, Br, or I.
17. The compound of claim 1, wherein R.sup.3 is unsubstituted 1.sup.3,2.sup.3-ethyne.
18. The compound of claim 1, wherein R.sup.4 and R.sup.5 are hydrogen.
19. The compound of claim 1, wherein R.sup.6 is hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl; or R.sup.6 and L.sup.1 are joined together to form a substituted or unsubstituted 5 to 7 membered heterocycloalkyl.
20. The compound of claim 1, wherein R.sup.6 is hydrogen.
21. The compound of claim 1, wherein R.sup.6 is unsubstituted methyl.
22. The compound of claim 1, wherein R.sup.6 and L.sup.1 are joined together to form a substituted or unsubstituted 5 to 7 membered heterocycloalkyl.
23. The compound of claim 1, wherein R.sup.6 and L.sup.1 are joined together to form a substituted or unsubstituted 1.sup.2-azepan-2-one, substituted or unsubstituted 1,4.sup.2-oxazepan-5-one, or substituted or unsubstituted 1.sup.2-piperidin-2-one.
24. The compound of claim 1, wherein R.sup.7 is independently a substituted or unsubstituted C.sub.1-C.sub.4 alkyl, substituted or unsubstituted 2 to 4 membered heteroalkyl, substituted or unsubstituted C.sub.3-C.sub.8 cycloalkyl, substituted or unsubstituted 3 to 8 membered heterocycloalkyl, substituted or unsubstituted C.sub.6-C.sub.10 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl.
25. The compound of claim 1, wherein R.sup.7 is an unsubstituted C.sub.1-C.sub.4 alkyl, unsubstituted 2 to 4 membered heteroalkyl, unsubstituted C.sub.3-C.sub.8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C.sub.6-C.sub.10 aryl, or unsubstituted 5 to 10 membered heteroaryl.
26. A TREK family protein or homolog thereof comprising a cysteine residue at an amino position corresponding to position 131 of TREK-1.
27. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein, or a TRAKK protein.
28. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises any one of SEQ ID NOS: 1-12.
29. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 1.
30. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 2.
31. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 3.
32. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 4.
33. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 5.
34. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 6.
35. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 7.
36. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 8.
37. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 9.
38. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 10.
39. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 11.
40. The TREK family protein or homolog thereof of claim 26, wherein the TREK family protein comprises SEQ ID NO: 12.
41. A nucleic acid encoding the TREK family protein or homolog thereof of one of claims 26 to 40.
42. A viral particle comprising the nucleic acid of claim 41.
43. A method of treating a disease or adverse condition related to low TREK family protein activity in a subject in need thereof, the method comprising administering to the subject an effective amount of a nucleic acid encoding the TREK family protein of claim 26 and a therapeutically effective amount of a TREK family protein agonist, wherein said TREK family protein agonist comprises a cysteine binding moiety capable of covalently binding said TREK family protein at said cysteine residue.
44. The method of claim 43, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein, or a TRAAK protein.
45. The method of claim 43, wherein said nucleic acid is within a viral particle.
46. The method of claim 45, wherein the viral particle is an inactivated or genetically modified human papillomavirus, rhinovirus, hepatitis B virus, or herpesvirus.
47. The method of claim 43, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA), a small interference RNA (siRNA), a piwi-interacting RNA (piRNA), a microRNA (miRNA), an antisense oligonucleotide, a morpholinooligonucleotide, a CRISPR Cas guide RNA (gRNA), a small molecule compound, an antibody, or a nucleic acid.
48. The method of claim 47, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA).
49. The method of claim 47, wherein said TREK family protein agonist is a small interference RNA (siRNA).
50. The method of claim 47, wherein said TREK family protein agonist is a piwi-interacting RNA (piRNA).
51. The method of claim 47, wherein said TREK family protein agonist is a microRNA (miRNA).
52. The method of claim 47, wherein said TREK family protein agonist is an antisense oligonucleotide.
53. The method of claim 47, wherein said TREK family protein agonist is a GapmeR.
54. The method of claim 47, wherein said TREK family protein agonist is a morpholinooligonucleotide.
55. The method of claim 47, wherein said TREK family protein agonist is a CRISPR Cas guide RNA (gRNA).
56. The method of claim 55, wherein said CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA.
57. The method of claim 55, wherein said CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
58. The method of claim 47, wherein said TREK family protein agonist is aTREK family protein antibody.
59. The method of claim 47, wherein said TREK family protein agonist is a nucleic acid binding said cysteine residue.
60. The method of claim 47, wherein said TREK family protein agonist is the compound of any one of claims 1 to 25.
61. The method of claim 43, wherein the cysteine residue is at an amino position corresponding to position 131 of TREK-1.
62. The method of claim 43, wherein said disease or adverse condition is chronic pain, nerve injury, lack of sleep, high intraocular pressure, headache, depression, pulmonary hypertension, lung injury, or decompression sickness.
63. The method of claim 62, wherein the nerve injury is an injury of the dorsal ganglion nerve.
64. A method of treating a disease or adverse condition related to low TREK family protein activity in a subject in need thereof, the method comprising administering to said subject a gene editing system capable of mutating a TREK family protein to comprise a cysteine residue at an amino position corresponding to position 131 of TREK-1, and a TREK family protein agonist, wherein said TREK family protein agonist comprises a cysteine binding moiety that is capable of covalently binding said TREK family protein at said cysteine residue.
65. The method of claim 64, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein, or a TRAAK protein.
66. The method of claim 64, wherein said gene editing system is a CRISPR Cas guide RNA (gRNA), a transcription activator-like effector nuclease (TALEN), or a zinc-finger nuclease (ZFN).
67. The method of claim 66, wherein said CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA.
68. The method of claim 66, wherein said CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
69. The method of claim 64, wherein said TREK family protein agonist is a nucleic acid binding said cysteine residue.
70. The method of claim 64, wherein said TREK family protein agonist is the compound of any one of claims 1 to 25.
71. The method of claim 64, wherein the cysteine residue is at an amino position corresponding to position 131 of TREK-1.
72. A method of increasing TREK family protein activity in a tissue, said method comprising administering to said tissue a nucleic acid encoding the TREK family protein of one of claims 26 to 40 and a TREK family protein agonist, wherein said TREK family protein agonist comprises a cysteine binding moiety capable of covalently binding said TREK family protein at said cysteine residue.
73. The method of claim 72, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein, or a TRAAK protein.
74. The method of claim 72, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA), a small interference RNA (siRNA), a piwi-interacting RNA (piRNA), a microRNA (miRNA), an antisense oligonucleotide, a morpholinooligonucleotide, a CRISPR Cas guide RNA (gRNA), a small molecule compound, an antibody, or a nucleic acid.
75. The method of claim 74, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA).
76. The method of claim 74, wherein said TREK family protein agonist is a small interference RNA (siRNA).
77. The method of claim 74, wherein said TREK family protein agonist is a piwi-interacting RNA (piRNA).
78. The method of claim 74, wherein said TREK family protein agonist is a microRNA (miRNA).
79. The method of claim 74, wherein said TREK family protein agonist is an antisense oligonucleotide.
80. The method of claim 74, wherein said TREK family protein agonist is a GapmeR.
81. The method of claim 74, wherein said TREK family protein agonist is a morpholinooligonucleotide.
82. The method of claim 74, wherein said TREK family protein agonist is a CRISPR Cas guide RNA (gRNA).
83. The method of claim 82, wherein said CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA.
84. The method of claim 82, wherein said CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
85. The method of claim 74, wherein said TREK family protein agonist is aTREK family protein antibody.
86. The method of claim 72, wherein said TREK family protein agonist is a nucleic acid binding said cysteine residue.
87. The method of claim 72, wherein said TREK family protein agonist is the compound of any one of claims 1 to 25.
88. The method of claim 72, wherein the cysteine residue is at an amino position corresponding to position 131 of TREK-1.
89. The method of claim 72, wherein said tissue is a brain, heart, nerve, nerve ganglia, eye, smooth muscle, endocrine, pancreas, prostate, or sensory organ tissue.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
DETAILED DESCRIPTION
I. Definitions
[0042] The abbreviations used herein have their conventional meaning within the chemical and biological arts. The chemical structures and formulae set forth herein are constructed according to the standard rules of chemical valency known in the chemical arts.
[0043] Where substituent groups are specified by their conventional chemical formulae, written from left to right, they equally encompass the chemically identical substituents that would result from writing the structure from right to left, e.g., CH.sub.2O is equivalent to OCH.sub.2.
[0044] The term alkyl, by itself or as part of another substituent, means, unless otherwise stated, a straight (i.e., unbranched) or branched carbon chain (or carbon), or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include mono-, di-, and multivalent radicals. The alkyl may include a designated number of carbons (e.g., C.sub.1-C.sub.10 means one to ten carbons). In embodiments, the alkyl is fully saturated. In embodiments, the alkyl is monounsaturated. In embodiments, the alkyl is polyunsaturated. Alkyl is an uncyclized chain. Examples of saturated hydrocarbon radicals include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, methyl, homologs and isomers of, for example, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like. An unsaturated alkyl group is one having one or more double bonds or triple bonds. Examples of unsaturated alkyl groups include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, 3-(1,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers. An alkoxy is an alkyl attached to the remainder of the molecule via an oxygen linker (O). An alkyl moiety may be an alkenyl moiety. An alkyl moiety may be an alkynyl moiety. An alkenyl includes one or more double bonds. An alkynyl includes one or more triple bonds.
[0045] The term alkylene, by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkyl, as exemplified, but not limited by, CH.sub.2CH.sub.2CH.sub.2CH.sub.2. Typically, an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer carbon atoms being preferred herein. A lower alkyl or lower alkylene is a shorter chain alkyl or alkylene group, generally having eight or fewer carbon atoms. The term alkenylene, by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkene. The term alkynylene by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkyne. In embodiments, the alkylene is fully saturated. In embodiments, the alkylene is monounsaturated. In embodiments, the alkylene is polyunsaturated. An alkenylene includes one or more double bonds. An alkynylene includes one or more triple bonds.
[0046] The term heteroalkyl, by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or combinations thereof, including at least one carbon atom and at least one heteroatom (e.g., O, N, P, Si, and S), and wherein the nitrogen and sulfur atoms may optionally be oxidized, and the nitrogen heteroatom may optionally be quaternized. The heteroatom(s) (e.g., N, S, Si, or P) may be placed at any interior position of the heteroalkyl group or at the position at which the alkyl group is attached to the remainder of the molecule. Heteroalkyl is an uncyclized chain. Examples include, but are not limited to: CH.sub.2CH.sub.2OCH.sub.3, CH.sub.2CH.sub.2NHCH.sub.3, CH.sub.2CH.sub.2N(CH.sub.3)CH.sub.3, CH.sub.2SCH.sub.2CH.sub.3, SCH.sub.2CH.sub.2, S(O)CH.sub.3, CH.sub.2CH.sub.2S(O).sub.2CH.sub.3, CHCHOCH.sub.3, Si(CH.sub.3).sub.3, CH.sub.2CHNOCH.sub.3, CHCHN(CH.sub.3)CH.sub.3, OCH.sub.3, OCH.sub.2CH.sub.3, and CN. Up to two or three heteroatoms may be consecutive, such as, for example, CH.sub.2NHOCH.sub.3 and CH.sub.2OSi(CH.sub.3).sub.3. A heteroalkyl moiety may include one heteroatom (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include two optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include three optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include four optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include five optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include up to 8 optionally different heteroatoms (e.g., O, N, S, Si, or P). The term heteroalkenyl, by itself or in combination with another term, means, unless otherwise stated, a heteroalkyl including at least one double bond. A heteroalkenyl may optionally include more than one double bond and/or one or more triple bonds in additional to the one or more double bonds. The term heteroalkynyl, by itself or in combination with another term, means, unless otherwise stated, a heteroalkyl including at least one triple bond. A heteroalkynyl may optionally include more than one triple bond and/or one or more double bonds in additional to the one or more triple bonds. In embodiments, the heteroalkyl is fully saturated. In embodiments, the heteroalkyl is monounsaturated. In embodiments, the heteroalkyl is polyunsaturated.
[0047] Similarly, the term heteroalkylene, by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from heteroalkyl, as exemplified, but not limited by, CH.sub.2CH.sub.2SCH.sub.2CH.sub.2 and CH.sub.2SCH.sub.2CH.sub.2NHCH.sub.2. For heteroalkylene groups, heteroatoms can also occupy either or both of the chain termini (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like). Still further, for alkylene and heteroalkylene linking groups, no orientation of the linking group is implied by the direction in which the formula of the linking group is written. For example, the formula C(O).sub.2R represents both C(O).sub.2R and RC(O).sub.2. As described above, heteroalkyl groups, as used herein, include those groups that are attached to the remainder of the molecule through a heteroatom, such as C(O)R, C(O)NR, NRR, OR, SR, and/or SO.sub.2R. Where heteroalkyl is recited, followed by recitations of specific heteroalkyl groups, such as NRR or the like, it will be understood that the terms heteroalkyl and NRR are not redundant or mutually exclusive. Rather, the specific heteroalkyl groups are recited to add clarity. Thus, the term heteroalkyl should not be interpreted herein as excluding specific heteroalkyl groups, such as NRR or the like. The term heteroalkenylene, by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from a heteroalkene. The term heteroalkynylene by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from a heteroalkyne. In embodiments, the heteroalkylene is fully saturated. In embodiments, the heteroalkylene is monounsaturated. In embodiments, the heteroalkylene is polyunsaturated. A heteroalkenylene includes one or more double bonds. A heteroalkynylene includes one or more triple bonds.
[0048] The terms cycloalkyl and heterocycloalkyl, by themselves or in combination with other terms, mean, unless otherwise stated, cyclic versions of alkyl and heteroalkyl, respectively. Cycloalkyl and heterocycloalkyl are not aromatic. Additionally, for heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule. Examples of cycloalkyl include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3-cyclohexenyl, cycloheptyl, and the like. Examples of heterocycloalkyl include, but are not limited to, 1-(1,2,5,6-tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4-morpholinyl, 3-morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothien-2-yl, tetrahydrothien-3-yl, 1-piperazinyl, 2-piperazinyl, and the like. A cycloalkylene and a heterocycloalkylene, alone or as part of another substituent, means a divalent radical derived from a cycloalkyl and heterocycloalkyl, respectively. In embodiments, the cycloalkyl is fully saturated. In embodiments, the cycloalkyl is monounsaturated. In embodiments, the cycloalkyl is polyunsaturated. In embodiments, the heterocycloalkyl is fully saturated. In embodiments, the heterocycloalkyl is monounsaturated. In embodiments, the heterocycloalkyl is polyunsaturated.
[0049] In embodiments, the term cycloalkyl means a monocyclic, bicyclic, or a multicyclic cycloalkyl ring system. In embodiments, monocyclic ring systems are cyclic hydrocarbon groups containing from 3 to 8 carbon atoms, where such groups can be saturated or unsaturated, but not aromatic. In embodiments, cycloalkyl groups are fully saturated. A bicyclic or multicyclic cycloalkyl ring system refers to multiple rings fused together wherein at least one of the fused rings is a cycloalkyl ring and wherein the multiple rings are attached to the parent molecular moiety through any carbon atom contained within a cycloalkyl ring of the multiple rings.
[0050] In embodiments, a cycloalkyl is a cycloalkenyl. The term cycloalkenyl is used in accordance with its plain ordinary meaning. In embodiments, a cycloalkenyl is a monocyclic, bicyclic, or a multicyclic cycloalkenyl ring system. A bicyclic or multicyclic cycloalkenyl ring system refers to multiple rings fused together wherein at least one of the fused rings is a cycloalkenyl ring and wherein the multiple rings are attached to the parent molecular moiety through any carbon atom contained within a cycloalkenyl ring of the multiple rings.
[0051] In embodiments, the term heterocycloalkyl means a monocyclic, bicyclic, or a multicyclic heterocycloalkyl ring system. In embodiments, heterocycloalkyl groups are fully saturated. A bicyclic or multicyclic heterocycloalkyl ring system refers to multiple rings fused together wherein at least one of the fused rings is a heterocycloalkyl ring and wherein the multiple rings are attached to the parent molecular moiety through any atom contained within a heterocycloalkyl ring of the multiple rings.
[0052] The terms halo or halogen, by themselves or as part of another substituent, mean, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom. Additionally, terms such as haloalkyl are meant to include monohaloalkyl and polyhaloalkyl. For example, the term halo(C.sub.1-C.sub.4)alkyl includes, but is not limited to, fluoromethyl, difluoromethyl, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.
[0053] The term acyl means, unless otherwise stated, C(O)R where R is a substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0054] The term aryl means, unless otherwise stated, a polyunsaturated, aromatic, hydrocarbon substituent, which can be a single ring or multiple rings (preferably from 1 to 3 rings) that are fused together (i.e., a fused ring aryl) or linked covalently. A fused ring aryl refers to multiple rings fused together wherein at least one of the fused rings is an aryl ring and wherein the multiple rings are attached to the parent molecular moiety through any carbon atom contained within an aryl ring of the multiple rings. The term heteroaryl refers to aryl groups (or rings) that contain at least one heteroatom such as N, O, or S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized. Thus, the term heteroaryl includes fused ring heteroaryl groups (i.e., multiple rings fused together wherein at least one of the fused rings is a heteroaromatic ring and wherein the multiple rings are attached to the parent molecular moiety through any atom contained within a heteroaromatic ring of the multiple rings). A 5,6-fused ring heteroarylene refers to two rings fused together, wherein one ring has 5 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. Likewise, a 6,6-fused ring heteroarylene refers to two rings fused together, wherein one ring has 6 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. And a 6,5-fused ring heteroarylene refers to two rings fused together, wherein one ring has 6 members and the other ring has 5 members, and wherein at least one ring is a heteroaryl ring. A heteroaryl group can be attached to the remainder of the molecule through a carbon or heteroatom. Non-limiting examples of aryl and heteroaryl groups include phenyl, naphthyl, pyrrolyl, pyrazolyl, pyridazinyl, triazinyl, pyrimidinyl, imidazolyl, pyrazinyl, purinyl, oxazolyl, isoxazolyl, thiazolyl, furyl, thienyl, pyridyl, pyrimidyl, benzothiazolyl, benzoxazoyl benzimidazolyl, benzofuran, isobenzofuranyl, indolyl, isoindolyl, benzothiophenyl, isoquinolyl, quinoxalinyl, quinolyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3-pyrazolyl, 2-imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4-oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2-pyrimidyl, 4-pyrimidyl, 5-benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-isoquinolyl, 5-isoquinolyl, 2-quinoxalinyl, 5-quinoxalinyl, 3-quinolyl, and 6-quinolyl.
[0055] Substituents for each of the above noted aryl and heteroaryl ring systems are selected from the group of acceptable substituents described below. An arylene and a heteroarylene, alone or as part of another substituent, mean a divalent radical derived from an aryl and heteroaryl, respectively. A heteroaryl group substituent may be O bonded to a ring heteroatom nitrogen.
[0056] Spirocyclic rings are two or more rings wherein adjacent rings are attached through a single atom. The individual rings within spirocyclic rings may be identical or different. Individual rings in spirocyclic rings may be substituted or unsubstituted and may have different substituents from other individual rings within a set of spirocyclic rings. Possible substituents for individual rings within spirocyclic rings are the possible substituents for the same ring when not part of spirocyclic rings (e.g., substituents for cycloalkyl or heterocycloalkyl rings). Spirocylic rings may be substituted or unsubstituted cycloalkyl, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heterocycloalkylene and individual rings within a spirocyclic ring group may be any of the immediately previous list, including having all rings of one type (e.g., all rings being substituted heterocycloalkylene wherein each ring may be the same or different substituted heterocycloalkylene). When referring to a spirocyclic ring system, heterocyclic spirocyclic rings means a spirocyclic rings wherein at least one ring is a heterocyclic ring and wherein each ring may be a different ring. When referring to a spirocyclic ring system, substituted spirocyclic rings means that at least one ring is substituted and each substituent may optionally be different.
[0057] The symbol denotes the point of attachment of a chemical moiety to the remainder of a molecule or chemical formula.
[0058] The term oxo, as used herein, means an oxygen that is double bonded to a carbon atom.
[0059] The term alkylarylene as an arylene moiety covalently bonded to an alkylene moiety (also referred to herein as an alkylene linker). In embodiments, the alkylarylene group has the formula:
##STR00002##
[0060] An alkylarylene moiety may be substituted (e.g., with a substituent group) on the alkylene moiety or the arylene linker (e.g., at carbons 2, 3, 4, or 6) with halogen, oxo, N.sub.3, CF.sub.3, CCl.sub.3, CBr.sub.3, CI.sub.3, CN, CHO, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.2CH.sub.3, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, substituted or unsubstituted C.sub.1-C.sub.5 alkyl or substituted or unsubstituted 2 to 5 membered heteroalkyl). In embodiments, the alkylarylene is unsubstituted.
[0061] Each of the above terms (e.g., alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl) includes both substituted and unsubstituted forms of the indicated radical. Preferred substituents for each type of radical are provided below.
[0062] Substituents for the alkyl and heteroalkyl radicals (including those groups often referred to as alkylene, alkenyl, heteroalkylene, heteroalkenyl, alkynyl, cycloalkyl, heterocycloalkyl, cycloalkenyl, and heterocycloalkenyl) can be one or more of a variety of groups selected from, but not limited to, OR, O, NR, NOR, NRR, SR, halogen, SiRRR, OC(O)R, C(O)R, CO.sub.2R, CONRR, OC(O)NRR, NRC(O)R, NRC(O)NRR, NRC(O).sub.2R, NRC(NRRR)=NR, NRC(NRR)=NR, S(O)R, S(O).sub.2R, S(O).sub.2NRR, NRSO.sub.2R, NRNRR, ONRR, NRC(O)NRNRR, CN, NO.sub.2, NRSO.sub.2R, NRC(O)R, NRC(O)OR, NROR, in a number ranging from zero to (2m+1), where m is the total number of carbon atoms in such radical. R, R, R, R, and R each preferably independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl (e.g., aryl substituted with 1-3 halogens), substituted or unsubstituted heteroaryl, substituted or unsubstituted alkyl, alkoxy, or thioalkoxy groups, or arylalkyl groups. When a compound described herein includes more than one R group, for example, each of the R groups is independently selected as are each R, R, R, and R group when more than one of these groups is present. When R and R are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 4-, 5-, 6-, or 7-membered ring. For example, NRR includes, but is not limited to, 1-pyrrolidinyl and 4-morpholinyl. From the above discussion of substituents, one of skill in the art will understand that the term alkyl is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (e.g., CF.sub.3 and CH.sub.2CF.sub.3) and acyl (e.g., C(O)CH.sub.3, C(O)CF.sub.3, C(O)CH.sub.2OCH.sub.3, and the like).
[0063] Similar to the substituents described for the alkyl radical, substituents for the aryl and heteroaryl groups are varied and are selected from, for example: OR, NRR, SR, halogen, SiRRR, OC(O)R, C(O)R, CO.sub.2R, CONRR, OC(O)NRR, NRC(O)R, NRC(O)NRR, NRC(O).sub.2R, NRC(NRRR)=NR, NRC(NRR)=NR, S(O)R, S(O).sub.2R, S(O).sub.2NRR, NRSO.sub.2R, NRNRR, ONRR, NRC(O)NRNRR, CN, NO.sub.2, R, N.sub.3, CH(Ph).sub.2, fluoro(C.sub.1-C.sub.4)alkoxy, and fluoro(C.sub.1-C.sub.4)alkyl, NRSO.sub.2R, NRC(O)R, NRC(O)OR, NROR, in a number ranging from zero to the total number of open valences on the aromatic ring system; and where R, R, R, and R are preferably independently selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. When a compound described herein includes more than one R group, for example, each of the R groups is independently selected as are each R, R, R, and R groups when more than one of these groups is present.
[0064] Substituents for rings (e.g., cycloalkyl, heterocycloalkyl, aryl, heteroaryl, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene) may be depicted as substituents on the ring rather than on a specific atom of a ring (commonly referred to as a floating substituent). In such a case, the substituent may be attached to any of the ring atoms (obeying the rules of chemical valency) and in the case of fused rings or spirocyclic rings, a substituent depicted as associated with one member of the fused rings or spirocyclic rings (a floating substituent on a single ring), may be a substituent on any of the fused rings or spirocyclic rings (a floating substituent on multiple rings). When a substituent is attached to a ring, but not a specific atom (a floating substituent), and a subscript for the substituent is an integer greater than one, the multiple substituents may be on the same atom, same ring, different atoms, different fused rings, different spirocyclic rings, and each substituent may optionally be different. Where a point of attachment of a ring to the remainder of a molecule is not limited to a single atom (a floating substituent), the attachment point may be any atom of the ring and in the case of a fused ring or spirocyclic ring, any atom of any of the fused rings or spirocyclic rings while obeying the rules of chemical valency. Where a ring, fused rings, or spirocyclic rings contain one or more ring heteroatoms and the ring, fused rings, or spirocyclic rings are shown with one more floating substituents (including, but not limited to, points of attachment to the remainder of the molecule), the floating substituents may be bonded to the heteroatoms. Where the ring heteroatoms are shown bound to one or more hydrogens (e.g., a ring nitrogen with two bonds to ring atoms and a third bond to a hydrogen) in the structure or formula with the floating substituent, when the heteroatom is bonded to the floating substituent, the substituent will be understood to replace the hydrogen, while obeying the rules of chemical valency.
[0065] Two or more substituents may optionally be joined to form aryl, heteroaryl, cycloalkyl, or heterocycloalkyl groups. Such so-called ring-forming substituents are typically, though not necessarily, found attached to a cyclic base structure. In one embodiment, the ring-forming substituents are attached to adjacent members of the base structure. For example, two ring-forming substituents attached to adjacent members of a cyclic base structure create a fused ring structure. In another embodiment, the ring-forming substituents are attached to a single member of the base structure. For example, two ring-forming substituents attached to a single member of a cyclic base structure create a spirocyclic structure. In yet another embodiment, the ring-forming substituents are attached to non-adjacent members of the base structure.
[0066] Two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally form a ring of the formula -T-C(O)(CRR).sub.qU, wherein T and U are independently NR, O, CRR, or a single bond, and q is an integer of from 0 to 3. Alternatively, two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula -A-(CH.sub.2).sub.rB, wherein A and B are independently CRR, O, NR, S, S(O), S(O).sub.2, S(O).sub.2NR, or a single bond, and r is an integer of from 1 to 4. One of the single bonds of the new ring so formed may optionally be replaced with a double bond. Alternatively, two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula (CRR).sub.sX(CRR).sub.d, where s and d are independently integers of from 0 to 3, and X is O, NR, S, S(O), S(O).sub.2, or S(O).sub.2NR. The substituents R, R, R, and R are preferably independently selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
[0067] As used herein, the terms heteroatom or ring heteroatom are meant to include oxygen (O), nitrogen (N), sulfur (S), phosphorus (P), selenium (Se), and silicon (Si). In embodiments, the terms heteroatom or ring heteroatom are meant to include oxygen (O), nitrogen (N), sulfur (S), phosphorus (P), and silicon (Si).
[0068] A substituent group, as used herein, means a group selected from the following moieties: [0069] (A) oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, SF.sub.5, unsubstituted alkyl (e.g., C.sub.1-C.sub.8 alkyl, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8 cycloalkyl, C.sub.3-C.sub.6 cycloalkyl, or C.sub.5-C.sub.6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C.sub.6-C.sub.10 aryl, C.sub.10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), and [0070] (B) alkyl (e.g., C.sub.1-C.sub.8 alkyl, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.4 alkyl), heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), cycloalkyl (e.g., C.sub.3-C.sub.8 cycloalkyl, C.sub.3-C.sub.6 cycloalkyl, or C.sub.5-C.sub.6 cycloalkyl), heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), aryl (e.g., C.sub.6-C.sub.10 aryl, C.sub.10 aryl, or phenyl), heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), substituted with at least one substituent selected from: [0071] (i) oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, SF.sub.5, unsubstituted alkyl (e.g., C.sub.1-C.sub.5 alkyl, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8 cycloalkyl, C.sub.3-C.sub.6 cycloalkyl, or C.sub.5-C.sub.6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C.sub.6-C.sub.10 aryl, C.sub.10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), and [0072] (ii) alkyl (e.g., C.sub.1-C.sub.8 alkyl, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.4 alkyl), heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), cycloalkyl (e.g., C.sub.3-C.sub.8 cycloalkyl, C.sub.3-C.sub.6 cycloalkyl, or C.sub.5-C.sub.6 cycloalkyl), heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), aryl (e.g., C.sub.6-C.sub.10 aryl, C.sub.10 aryl, or phenyl), heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), substituted with at least one substituent selected from: [0073] (a) oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, SF.sub.5, unsubstituted alkyl (e.g., C.sub.1-C.sub.8 alkyl, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8 cycloalkyl, C.sub.3-C.sub.6 cycloalkyl, or C.sub.5-C.sub.6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C.sub.6-C.sub.10 aryl, C.sub.10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), and [0074] (b) alkyl (e.g., C.sub.1-C.sub.8 alkyl, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.4 alkyl), heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), cycloalkyl (e.g., C.sub.3-C.sub.8 cycloalkyl, C.sub.3-C.sub.6 cycloalkyl, or C.sub.5-C.sub.6 cycloalkyl), heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), aryl (e.g., C.sub.6-C.sub.10 aryl, C.sub.10 aryl, or phenyl), heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), substituted with at least one substituent selected from: oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, SF.sub.5, unsubstituted alkyl (e.g., C.sub.1-C.sub.8 alkyl, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.5 cycloalkyl, C.sub.3-C.sub.6 cycloalkyl, or C.sub.5-C.sub.6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C.sub.6-C.sub.10 aryl, C.sub.10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl).
[0075] A size-limited substituent or size-limited substituent group, as used herein, means a group selected from all of the substituents described above for a substituent group, wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted C.sub.1-C.sub.20 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C.sub.3-C.sub.5 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C.sub.6-C.sub.10 aryl, and each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 10 membered heteroaryl.
[0076] A lower substituent or lower substituent group, as used herein, means a group selected from all of the substituents described above for a substituent group, wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted C.sub.1-C.sub.5 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C.sub.3-C.sub.7 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted phenyl, and each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 6 membered heteroaryl.
[0077] In some embodiments, each substituted group described in the compounds herein is substituted with at least one substituent group. More specifically, in some embodiments, each substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene described in the compounds herein are substituted with at least one substituent group. In other embodiments, at least one or all of these groups are substituted with at least one size-limited substituent group. In other embodiments, at least one or all of these groups are substituted with at least one lower substituent group.
[0078] In other embodiments of the compounds herein, each substituted or unsubstituted alkyl may be a substituted or unsubstituted C.sub.1-C.sub.20 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C.sub.3-C.sub.8 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C.sub.6-C.sub.10 aryl, and/or each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 10 membered heteroaryl. In some embodiments of the compounds herein, each substituted or unsubstituted alkylene is a substituted or unsubstituted C.sub.1-C.sub.20 alkylene, each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 20 membered heteroalkylene, each substituted or unsubstituted cycloalkylene is a substituted or unsubstituted C.sub.3-C.sub.8 cycloalkylene, each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 8 membered heterocycloalkylene, each substituted or unsubstituted arylene is a substituted or unsubstituted C.sub.6-C.sub.10 arylene, and/or each substituted or unsubstituted heteroarylene is a substituted or unsubstituted 5 to 10 membered heteroarylene.
[0079] In some embodiments, each substituted or unsubstituted alkyl is a substituted or unsubstituted C.sub.1-C.sub.8 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C.sub.3-C.sub.7 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C.sub.6-C.sub.10 aryl, and/or each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 9 membered heteroaryl. In some embodiments, each substituted or unsubstituted alkylene is a substituted or unsubstituted C.sub.1-C.sub.8 alkylene, each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 8 membered heteroalkylene, each substituted or unsubstituted cycloalkylene is a substituted or unsubstituted C.sub.3-C.sub.7 cycloalkylene, each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 7 membered heterocycloalkylene, each substituted or unsubstituted arylene is a substituted or unsubstituted C.sub.6-C.sub.10 arylene, and/or each substituted or unsubstituted heteroarylene is a substituted or unsubstituted 5 to 9 membered heteroarylene. In some embodiments, the compound is a chemical species set forth in the Examples section, figures, or tables below.
[0080] In embodiments, a substituted or unsubstituted moiety (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is unsubstituted (e.g., is an unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, unsubstituted alkylene, unsubstituted heteroalkylene, unsubstituted cycloalkylene, unsubstituted heterocycloalkylene, unsubstituted arylene, and/or unsubstituted heteroarylene, respectively). In embodiments, a substituted or unsubstituted moiety (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is substituted (e.g., is a substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene, respectively).
[0081] In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, wherein if the substituted moiety is substituted with a plurality of substituent groups, each substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of substituent groups, each substituent group is different.
[0082] In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one size-limited substituent group, wherein if the substituted moiety is substituted with a plurality of size-limited substituent groups, each size-limited substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of size-limited substituent groups, each size-limited substituent group is different.
[0083] In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one lower substituent group, wherein if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group is different.
[0084] In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted moiety is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group is different.
[0085] In a recited claim or chemical formula description herein, each R substituent or L linker that is described as being substituted without reference as to the identity of any chemical moiety that composes the substituted group (also referred to herein as an open substitution on an R substituent or L linker or an openly substituted R substituent or L linker), the recited R substituent or L linker may, in embodiments, be substituted with one or more first substituent groups as defined below.
[0086] The first substituent group is denoted with a corresponding first decimal point numbering system such that, for example, R.sup.1 may be substituted with one or more first substituent groups denoted by R.sup.1.1, R.sup.2 may be substituted with one or more first substituent groups denoted by R.sup.2.1, R.sup.3 may be substituted with one or more first substituent groups denoted by R.sup.3.1, R.sup.4 may be substituted with one or more first substituent groups denoted by R.sup.4.1, R.sup.S may be substituted with one or more first substituent groups denoted by R.sup.5.1, and the like up to or exceeding an R.sup.100 that may be substituted with one or more first substituent groups denoted by R.sup.100.1. As a further example, R.sup.1A may be substituted with one or more first substituent groups denoted by R.sup.1A.1, R.sup.2A may be substituted with one or more first substituent groups denoted by R.sup.2A.1, R.sup.3A may be substituted with one or more first substituent groups denoted by R.sup.3A.1, R.sup.4A may be substituted with one or more first substituent groups denoted by R.sup.4A.1, R.sup.5A may be substituted with one or more first substituent groups denoted by R.sup.5A.1 and the like up to or exceeding an R.sup.100A may be substituted with one or more first substituent groups denoted by R.sup.100A.1. As a further example, L.sup.1 may be substituted with one or more first substituent groups denoted by R.sup.L1.1, L.sup.2 may be substituted with one or more first substituent groups denoted by R.sup.L2.1, L.sup.3 may be substituted with one or more first substituent groups denoted by R.sup.L3.1, L.sup.4 may be substituted with one or more first substituent groups denoted by R.sup.L4.1, L.sup.5 may be substituted with one or more first substituent groups denoted by R.sup.L5.1 and the like up to or exceeding an L.sup.100 which may be substituted with one or more first substituent groups denoted by R.sup.L100.1. Thus, each numbered R group or L group (alternatively referred to herein as R.sup.WW or L.sup.WW wherein WW represents the stated superscript number of the subject R group or L group) described herein may be substituted with one or more first substituent groups referred to herein generally as R.sup.WW.1 or R.sup.LWW.1, respectively. In turn, each first substituent group (e.g., R.sup.1.1, R.sup.2.1, R.sup.3.1, R.sup.4.1, R.sup.5.1 . . . R.sup.100.1; R.sup.1A.1, R.sup.2A.1, R.sup.3A.1, R.sup.4A.1, R.sup.5A.1 . . . R.sup.100A.1; R.sup.L1.1, R.sup.L2.1, R.sup.L3.1, R.sup.L4.1, R.sup.L5.1 . . . R.sup.L100.1) may be further substituted with one or more second substituent groups (e.g., R.sup.1.2, R.sup.2.2, R.sup.3.2, R.sup.4.2, R.sup.5.2 . . . R.sup.100.2; R.sup.1A.2, R.sup.2A.2, R.sup.3A.2, R.sup.4A.2, R.sup.5A.2 . . . R.sup.100A.2; R.sup.L1.2, R.sup.L2.2, R.sup.L3.2, R.sup.L4.2, R.sup.L5.2, . . . R.sup.L100.2, respectively). Thus, each first substituent group, which may alternatively be represented herein as R.sup.WW.1 as described above, may be further substituted with one or more second substituent groups, which may alternatively be represented herein as R.sup.WW.2.
[0087] Finally, each second substituent group (e.g., R.sup.1.2, R.sup.2.2, R.sup.3.2, R.sup.4.2, R.sup.5.2 . . . R.sup.100.2; R.sup.1A.2, R.sup.2A.2, R.sup.3A.2, R.sup.4A.2, R.sup.5A.2 . . . R.sup.100A.2; R.sup.L1.2, R.sup.L2.2, R.sup.L3.2, R.sup.L4.2, R.sup.L5.2 . . . R.sup.L100.2) may be further substituted with one or more third substituent groups (e.g., R.sup.1.3, R.sup.2.3, R.sup.3.3, R.sup.4.3, R.sup.5.3 . . . R.sup.100.3; R.sup.1A.3, R.sup.2A.3, R.sup.3A.3, R.sup.4A.3, R.sup.5A.3 . . . R.sup.100A.3; R.sup.L1.3, R.sup.L2.3, R.sup.L3.3, R.sup.L4.3, R.sup.L5.3 . . . R.sup.L100.3; respectively). Thus, each second substituent group, which may alternatively be represented herein as R.sup.WW.2 as described above, may be further substituted with one or more third substituent groups, which may alternatively be represented herein as R.sup.WW.3. Each of the first substituent groups may be optionally different. Each of the second substituent groups may be optionally different. Each of the third substituent groups may be optionally different.
[0088] Thus, as used herein, R.sup.WW represents a substituent recited in a claim or chemical formula description herein which is openly substituted. WW represents the stated superscript number of the subject R group (1, 2, 3, 1A, 2A, 3A, 1B, 2B, 3B, etc.). Likewise, L.sup.WW is a linker recited in a claim or chemical formula description herein which is openly substituted. Again, WW represents the stated superscript number of the subject L group (1, 2, 3, 1A, 2A, 3A, 1B, 2B, 3B, etc.). As stated above, in embodiments, each R.sup.WW may be unsubstituted or independently substituted with one or more first substituent groups, referred to herein as R.sup.WW.1; each first substituent group, R.sup.WW.1, may be unsubstituted or independently substituted with one or more second substituent groups, referred to herein as R.sup.WW.2; and each second substituent group may be unsubstituted or independently substituted with one or more third substituent groups, referred to herein as R.sup.WW.3. Similarly, each L.sup.WW linker may be unsubstituted or independently substituted with one or more first substituent groups, referred to herein as R.sup.LWW.1; each first substituent group, R.sup.LWW.1, may be unsubstituted or independently substituted with one or more second substituent groups, referred to herein as R.sup.LWW.2; and each second substituent group may be unsubstituted or independently substituted with one or more third substituent groups, referred to herein as R.sup.LWW.3. Each first substituent group is optionally different. Each second substituent group is optionally different. Each third substituent group is optionally different. For example, if R.sup.WW is phenyl, the said phenyl group is optionally substituted by one or more R.sup.WW.1 groups as defined herein below, e.g., when R.sup.WW.1 is R.sup.WW.2-substituted or unsubstituted alkyl, examples of groups so formed include but are not limited to itself optionally substituted by 1 or more R.sup.WW.2, which R.sup.WW.2 is optionally substituted by one or more R.sup.WW.3. By way of example when the R.sup.WW group is phenyl substituted by R.sup.WW.1, which is methyl, the methyl group may be further substituted to form groups including but not limited to:
##STR00003##
[0089] R.sup.WW.1 is independently oxo, halogen, CX.sup.WW.1.sub.3, CHX.sup.WW.1.sub.2, CH.sub.2X.sup.WW.1, OCX.sup.WW.1.sub.3, OCH.sub.2X.sup.WW.1, OCHX.sup.WW.1.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, R.sup.WW.2-substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), R.sup.WW.2-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R.sup.WW.2-substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), R.sup.WW.2-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R.sup.WW.2-substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or R.sup.WW.2-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R.sup.WW.1 is independently oxo, halogen, CX.sup.WW.1.sub.3, CHX.sup.WW.1.sub.2, CH.sub.2X.sup.WW.1, OCX.sup.WW.1.sub.3, OCH.sub.2X.sup.WW.1, OCHX.sup.WW.1.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X i is independently F, Cl, Br, or I.
[0090] R.sup.WW.2 is independently oxo, halogen, CX.sup.WW.2.sub.3, CHX.sup.WW.2.sub.2, CH.sub.2X.sup.WW.2, OCX.sup.WW.2.sub.3, OCH.sub.2X.sup.WW.2, OCHX.sup.WW.2.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, R.sup.WW.3-substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), R.sup.WW.3-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R.sup.WW.3-substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), R.sup.WW.3-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R.sup.WW.3-substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or R.sup.WW.3-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R.sup.WW.2 is independently oxo, halogen, CX.sup.WW.2.sub.3, CHX.sup.WW.2.sub.2CH.sub.2X.sup.WW.2, OCX.sup.WW.2.sub.3, OCH.sub.2X.sup.WW.2, OCHX.sup.WW.2.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X.sup.WW.2 is independently F, Cl, Br, or I.
[0091] R.sup.WW.3 is independently oxo, halogen, CX.sup.WW.3.sub.3, CHX.sup.WW.3.sub.2, CH.sub.2X.sup.WW.3, OCX.sup.WW.3.sub.3, OCH.sub.2X.sup.WW.3, OCHX.sup.WW.3.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X.sup.WW.3 is independently F, Cl, Br, or I.
[0092] Where two different R.sup.WW substituents are joined together to form an openly substituted ring (e.g., substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl or substituted heteroaryl), in embodiments the openly substituted ring may be independently substituted with one or more first substituent groups, referred to herein as R.sup.WW.1; each first substituent group, R.sup.WW.1, may be unsubstituted or independently substituted with one or more second substituent groups, referred to herein as R.sup.WW.2; and each second substituent group, R.sup.WW.2, may be unsubstituted or independently substituted with one or more third substituent groups, referred to herein as R.sup.WW.3; and each third substituent group, R.sup.WW.3, is unsubstituted.
[0093] Each first substituent group is optionally different. Each second substituent group is optionally different. Each third substituent group is optionally different. In the context of two different R.sup.WW substituents joined together to form an openly substituted ring, the WW symbol in the R.sup.WW.1, R.sup.WW.2 and R.sup.WW.3 refers to the designated number of one of the two different R.sup.WW substituents. For example, in embodiments where R.sup.100A and R.sup.100B are optionally joined together to form an openly substituted ring, R.sup.WW.1 is R.sup.100A.1, R.sup.WW.2 is R.sup.100A.2, and R.sup.WW.3 is R.sup.100A.3. Alternatively, in embodiments where R.sup.100A and R.sup.100B are optionally joined together to form an openly substituted ring, R.sup.WW.1 is R.sup.100B.1, R.sup.WW.2 is R.sup.100B.2, and R.sup.WW.3 is R.sup.100B.3. R.sup.WW.1, R.sup.WW.2 and R.sup.WW.3 in this paragraph are as defined in the preceding paragraphs.
[0094] R.sup.LWW.1 is independently oxo, halogen, CX.sup.LWW.1.sub.3, CHX.sup.LWW.1.sub.2, CH.sub.2X.sup.LWW.1, OCX.sup.LWW.1.sub.3, OCH.sub.2X.sup.LWW.1, OCHX.sup.LWW.1.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, R.sup.LWW.2-substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), R.sup.LWW.2-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R.sup.LWW.2-substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), R.sup.LWW.2-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R.sup.LWW.2-substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or R.sup.LWW.2-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R.sup.LWW.1 is independently oxo, halogen, CX.sup.LWW.1.sub.3, CHX.sup.LWW.1.sub.2, CH.sub.2X.sup.LWW.1, OCX.sup.LWW.1.sub.3, OCH.sub.2X.sup.LWW.1, OCHX.sup.LWW.1.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X.sup.LWW.1 is independently F, Cl, Br, or I.
[0095] R.sup.LWW.2 is independently oxo, halogen, CX.sup.LWW.2.sub.3, CHX.sup.LWW.2.sub.2, CH.sub.2X.sup.LWW.2, OCX.sup.LWW.2.sub.3, OCH.sub.2X.sup.LWW.2, OCHX.sup.LWW.2.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, R.sup.LWW.3-substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), R.sup.LWW.3-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R.sup.WW.3-substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), R.sup.LWW.3-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R.sup.LWW.3-substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or R.sup.LWW.3-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R.sup.LWW.2 is independently oxo, halogen, CX.sup.LWW.2.sub.3, CHX.sup.LWW.2.sub.2, CH.sub.2X.sup.LWW.2, OCX.sup.LWW.2.sub.3, OCH.sub.2X.sup.LWW.2, OCHX.sup.LWW.2.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X.sup.LWW.2 is independently F, Cl, Br, or I.
[0096] R.sup.LWW.3 is independently oxo, halogen, CX.sup.LWW.3.sub.3, CHX.sup.LWW.3.sub.2, CH.sub.2X.sup.LWW.3, OCX.sup.LWW.3.sub.3, OCH.sub.2X.sup.LWW.3, OCHX.sup.LWW.3.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X.sup.LWW.3 is independently F, Cl, Br, or I.
[0097] In the event that any R group recited in a claim or chemical formula description set forth herein (R.sup.WW substituent) is not specifically defined in this disclosure, then that R group (R.sup.WW group) is hereby defined as independently oxo, halogen, CX.sup.WW.sub.3, CHX.sup.WW.sub.2, CH.sub.2X.sup.WW, OCX.sup.WW.sub.3, OCH.sub.2X.sup.WW, OCHX.sup.WW.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHC(NH)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, N.sub.3, R.sup.WW.1-substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), R.sup.WW.1-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R.sup.WW.1-substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), R.sup.WW.1-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R.sup.WW.1-substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or R.sup.WW.1-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X.sup.WW is independently F, Cl, Br, or I. Again, WW represents the stated superscript number of the subject R group (e.g., 1, 2, 3, 1A, 2A, 3A, 1B, 2B, 3B, etc.). R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 are as defined above.
[0098] In the event that any L linker group recited in a claim or chemical formula description set forth herein (i.e., an L.sup.WW substituent) is not explicitly defined, then that L group (L.sup.WW group) is herein defined as independently a bond, O, NH, C(O), C(O)NH, NHC(O), NHC(O)NH, NHC(NH)NH, C(O)O, OC(O), S, SO.sub.2, SO.sub.2NH, R.sup.LWW.1-substituted or unsubstituted alkylene (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), R.sup.LWW.1-substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R.sup.LWW.1-substituted or unsubstituted cycloalkylene (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), R.sup.LWW.1-substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R.sup.LWW.1-substituted or unsubstituted arylene (e.g., C.sub.6-C.sub.12, C.sub.6-C.sub.10, or phenyl), or R.sup.LWW.1-substituted or unsubstituted heteroarylene (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). Again, WW represents the stated superscript number of the subject L group (1, 2, 3, 1A, 2A, 3A, 1B, 2B, 3B, etc.). R.sup.LWW.1, as well as R.sup.LWW.2 and R.sup.LWW.3 are as defined above.
[0099] Certain compounds of the present disclosure possess asymmetric carbon atoms (optical or chiral centers) or double bonds; the enantiomers, racemates, diastereomers, tautomers, geometric isomers, stereoisometric forms that may be defined, in terms of absolute stereochemistry, as (R)- or (S)- or, as (D)- or (L)- for amino acids, and individual isomers are encompassed within the scope of the present disclosure. The compounds of the present disclosure do not include those that are known in art to be too unstable to synthesize and/or isolate. The present disclosure is meant to include compounds in racemic and optically pure forms. Optically active (R)- and (S)-, or (D)- and (L)-isomers may be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques. When the compounds described herein contain olefinic bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E and Z geometric isomers.
[0100] As used herein, the term isomers refers to compounds having the same number and kind of atoms, and hence the same molecular weight, but differing in respect to the structural arrangement or configuration of the atoms.
[0101] The term tautomer, as used herein, refers to one of two or more structural isomers which exist in equilibrium and which are readily converted from one isomeric form to another.
[0102] It will be apparent to one skilled in the art that certain compounds of this disclosure may exist in tautomeric forms, all such tautomeric forms of the compounds being within the scope of the disclosure.
[0103] Unless otherwise stated, structures depicted herein are also meant to include all stereochemical forms of the structure; i.e., the R and S configurations for each asymmetric center. Therefore, single stereochemical isomers as well as enantiomeric and diastereomeric mixtures of the present compounds are within the scope of the disclosure.
[0104] Unless otherwise stated, structures depicted herein are also meant to include compounds which differ only in the presence of one or more isotopically enriched atoms. For example, compounds having the present structures except for the replacement of a hydrogen by a deuterium or tritium, or the replacement of a carbon by .sup.13C- or .sup.14C-enriched carbon are within the scope of this disclosure.
[0105] The compounds of the present disclosure may also contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds. For example, the compounds may be radiolabeled with radioactive isotopes, such as for example tritium (.sup.3H), iodine-125 (.sup.125I), or carbon-14 (.sup.14C). All isotopic variations of the compounds of the present disclosure, whether radioactive or not, are encompassed within the scope of the present disclosure.
[0106] It should be noted that throughout the application that alternatives are written in Markush groups, for example, each amino acid position that contains more than one possible amino acid. It is specifically contemplated that each member of the Markush group should be considered separately, thereby comprising another embodiment, and the Markush group is not to be read as a single unit.
[0107] Analog, analogue, or derivative is used in accordance with its plain ordinary meaning within Chemistry and Biology and refers to a chemical compound that is structurally similar to another compound (i.e., a so-called reference compound) but differs in composition, e.g., in the replacement of one atom by an atom of a different element, or in the presence of a particular functional group, or the replacement of one functional group by another functional group, or the absolute stereochemistry of one or more chiral centers of the reference compound. Accordingly, an analog is a compound that is similar or comparable in function and appearance but not in structure or origin to a reference compound.
[0108] The terms a or an, as used in herein means one or more. In addition, the phrase substituted with a[n], as used herein, means the specified group may be substituted with one or more of any or all of the named substituents. For example, where a group, such as an alkyl or heteroaryl group, is substituted with an unsubstituted C.sub.1-C.sub.20 alkyl, or unsubstituted 2 to 20 membered heteroalkyl, the group may contain one or more unsubstituted C.sub.1-C.sub.20 alkyls, and/or one or more unsubstituted 2 to 20 membered heteroalkyls.
[0109] Moreover, where a moiety is substituted with an R substituent, the group may be referred to as R-substituted. Where a moiety is R-substituted, the moiety is substituted with at least one R substituent and each R substituent is optionally different. Where a particular R group is present in the description of a chemical genus (such as Formula (I)), a Roman alphabetic symbol may be used to distinguish each appearance of that particular R group. For example, where multiple R.sup.13 substituents are present, each R.sup.13 substituent may be distinguished as R.sup.13A, R.sup.13B, R.sup.13C, R.sup.13D, etc., wherein each of R.sup.13A, R.sup.13B, R.sup.13C, R.sup.13D, etc. is defined within the scope of the definition of R.sup.13 and optionally differently. Where an R moiety, group, or substituent as disclosed herein is attached through the representation of a single bond and the R moiety, group, or substituent is oxo, a person having ordinary skill in the art will immediately recognize that the oxo is attached through a double bond in accordance with the normal rules of chemical valency.
[0110] Descriptions of compounds of the present disclosure are limited by principles of chemical bonding known to those skilled in the art. Accordingly, where a group may be substituted by one or more of a number of substituents, such substitutions are selected so as to comply with principles of chemical bonding and to give compounds which are not inherently unstable and/or would be known to one of ordinary skill in the art as likely to be unstable under ambient conditions, such as aqueous, neutral, and several known physiological conditions. For example, a heterocycloalkyl or heteroaryl is attached to the remainder of the molecule via a ring heteroatom in compliance with principles of chemical bonding known to those skilled in the art thereby avoiding inherently unstable compounds.
[0111] The term pharmaceutically acceptable salts is meant to include salts of the active compounds that are prepared with relatively nontoxic acids or bases, depending on the particular substituents found on the compounds described herein. When compounds of the present disclosure contain relatively acidic functionalities, base addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired base, either neat or in a suitable inert solvent. Examples of pharmaceutically acceptable base addition salts include sodium, potassium, calcium, ammonium, organic amino, or magnesium salt, or a similar salt. When compounds of the present disclosure contain relatively basic functionalities, acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent. Examples of pharmaceutically acceptable acid addition salts include those derived from inorganic acids like hydrochloric, hydrobromic, nitric, carbonic, monohydrogencarbonic, phosphoric, monohydrogenphosphoric, dihydrogenphosphoric, sulfuric, monohydrogensulfuric, hydriodic, or phosphorous acids and the like, as well as the salts derived from relatively nontoxic organic acids like acetic, propionic, isobutyric, maleic, malonic, benzoic, succinic, suberic, fumaric, lactic, mandelic, phthalic, benzenesulfonic, p-tolylsulfonic, citric, tartaric, oxalic, methanesulfonic, and the like. Also included are salts of amino acids such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like (see, for example, Berge et al., Pharmaceutical Salts, Journal of Pharmaceutical Science, 1977, 66, 1-19). Certain specific compounds of the present disclosure contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts.
[0112] Thus, the compounds of the present disclosure may exist as salts, such as with pharmaceutically acceptable acids. The present disclosure includes such salts. Non-limiting examples of such salts include hydrochlorides, hydrobromides, phosphates, sulfates, methanesulfonates, nitrates, maleates, acetates, citrates, fumarates, proprionates, tartrates (e.g., (+)-tartrates, ()-tartrates, or mixtures thereof including racemic mixtures), succinates, benzoates, and salts with amino acids such as glutamic acid, and quaternary ammonium salts (e.g., methyl iodide, ethyl iodide, and the like). These salts may be prepared by methods known to those skilled in the art.
[0113] The neutral forms of the compounds are preferably regenerated by contacting the salt with a base or acid and isolating the parent compound in the conventional manner. The parent form of the compound may differ from the various salt forms in certain physical properties, such as solubility in polar solvents.
[0114] In addition to salt forms, the present disclosure provides compounds, which are in a prodrug form. Prodrugs of the compounds described herein are those compounds that readily undergo chemical changes under physiological conditions to provide the compounds of the present disclosure. Prodrugs of the compounds described herein may be converted in vivo after administration. Additionally, prodrugs can be converted to the compounds of the present disclosure by chemical or biochemical methods in an ex vivo environment, such as, for example, when contacted with a suitable enzyme or chemical reagent.
[0115] Certain compounds of the present disclosure can exist in unsolvated forms as well as solvated forms, including hydrated forms. In general, the solvated forms are equivalent to unsolvated forms and are encompassed within the scope of the present disclosure. Certain compounds of the present disclosure may exist in multiple crystalline or amorphous forms. In general, all physical forms are equivalent for the uses contemplated by the present disclosure and are intended to be within the scope of the present disclosure.
[0116] A polypeptide, or a cell is recombinant when it is artificial or engineered, or derived from or contains an artificial or engineered protein or nucleic acid (e.g., non-natural or not wild type). For example, a polynucleotide that is inserted into a vector or any other heterologous location, e.g., in a genome of a recombinant organism, such that it is not associated with nucleotide sequences that normally flank the polynucleotide as it is found in nature is a recombinant polynucleotide. A protein expressed in vitro or in vivo from a recombinant polynucleotide is an example of a recombinant polypeptide. Likewise, a polynucleotide sequence that does not appear in nature, for example a variant of a naturally occurring gene, is recombinant.
[0117] A cell as used herein, refers to a cell carrying out metabolic or other function sufficient to preserve or replicate its genomic DNA. A cell can be identified by well-known methods in the art including, for example, presence of an intact membrane, staining by a particular dye, ability to produce progeny or, in the case of a gamete, ability to combine with a second gamete to produce a viable offspring. Cells may include prokaryotic and eukaroytic cells. Prokaryotic cells include but are not limited to bacteria. Eukaryotic cells include but are not limited to yeast cells and cells derived from plants and animals, for example mammalian, insect (e.g., spodoptera) and human cells. Cells may be useful when they are naturally nonadherent or have been treated not to adhere to surfaces, for example by trypsinization.
[0118] The terms treating or treatment refers to any indicia of success in the treatment or amelioration of an injury, disease, pathology or condition, including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the injury, pathology or condition more tolerable to the patient; slowing in the rate of degeneration or decline; making the final point of degeneration less debilitating; improving a patient's physical or mental well-being. The treatment or amelioration of symptoms can be based on objective or subjective parameters; including the results of a physical examination, neuropsychiatric exams, and/or a psychiatric evaluation. The term treating and conjugations thereof, include prevention of an injury, pathology, condition, or disease. In embodiments, treating is preventing. In embodiments, treating does not include preventing. In embodiments, the treating or treatment is no prophylactic treatment.
[0119] As defined herein, the term activation, activate, activating and the like in reference to a protein refers to conversion of a protein into a biologically active derivative from an initial inactive or deactivated state. The terms reference activation, or activating, sensitizing, or up-regulating signal transduction or enzymatic activity or the amount of a protein decreased in a disease.
[0120] The terms agonist, activator, upregulator, etc. refer to a substance capable of detectably increasing the expression or activity of a given gene or protein. The agonist can increase expression or activity by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% in comparison to a control in the absence of the agonist. In certain instances, expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or higher than the expression or activity in the absence of the agonist. In embodiments, the agonist is administered to a subject with a TREK family protein. In embodiments, the agonist increases expression or activity of a TREK family protein in the subject by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% in comparison to the absence of administering a TREK family protein and agonist in a control subject. In embodiments, the agonist increases expression or activity of TREK-1 in the subject by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% in comparison to the absence of administering TREK-1 and agonist in a control subject. In embodiments, the agonist increases expression or activity of TREK-2 by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% in comparison to the absence of administering TREK-2 and agonist in a control subject. In embodiments, the agonist increases expression or activity of TRAAK by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% in comparison to the absence of administering TRAAK and agonist in a control subject.
[0121] As defined herein, the term inhibition, inhibit, inhibiting and the like in reference to a cellular component-inhibitor interaction means negatively affecting (e.g., decreasing) the activity or function of the cellular component (e.g., decreasing the signaling pathway stimulated by a cellular component (e.g., protein, ion, lipid, virus, lipid droplet, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or macromolecule)), relative to the activity or function of the cellular component in the absence of the inhibitor. In embodiments inhibition means negatively affecting (e.g., decreasing) the concentration or levels of the cellular component relative to the concentration or level of the cellular component in the absence of the inhibitor. In some embodiments, inhibition refers to reduction of a disease or symptoms of disease. In some embodiments, inhibition refers to a reduction in the activity of a signal transduction pathway or signaling pathway (e.g., reduction of a pathway involving the cellular component). Thus, inhibition includes, at least in part, partially or totally blocking stimulation, decreasing, preventing, or delaying activation, or inactivating, desensitizing, or down-regulating the signaling pathway or enzymatic activity or the amount of a cellular component.
[0122] The terms inhibitor, repressor, antagonist, or downregulator interchangeably refer to a substance capable of detectably decreasing the expression or activity of a given gene or protein. The antagonist can decrease expression or activity by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% in comparison to a control in the absence of the antagonist. In certain instances, expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or lower than the expression or activity in the absence of the antagonist. As defined herein, the term inhibition, inhibit, inhibiting and the like in reference to a protein-inhibitor interaction means negatively affecting (e.g., decreasing) the activity or function of the protein relative to the activity or function of the protein in the absence of the inhibitor. In embodiments inhibition means negatively affecting (e.g., decreasing) the concentration or levels of the protein relative to the concentration or level of the protein in the absence of the inhibitor. In embodiments inhibition refers to reduction of a disease or symptoms of disease. In embodiments, inhibition refers to a reduction in the activity of a particular protein target. Thus, inhibition includes, at least in part, partially or totally blocking stimulation, decreasing, preventing, or delaying activation, or inactivating, desensitizing, or down-regulating signal transduction or enzymatic activity or the amount of a protein. In embodiments, inhibition refers to a reduction of activity of a target protein resulting from a direct interaction (e.g. an inhibitor binds to the target protein). In embodiments, inhibition refers to a reduction of activity of a target protein from an indirect interaction (e.g. an inhibitor binds to a protein that activates the target protein, thereby preventing target protein activation).
[0123] The term modulator refers to a composition that increases or decreases the level of a target molecule or the function of a target molecule or the physical state of the target of the molecule (e.g., a target may be a cellular component (e.g., protein, ion, lipid, virus, lipid droplet, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or macromolecule)) relative to the absence of the composition.
[0124] The term expression includes any step involved in the production of the polypeptide including, but not limited to, transcription, post-transcriptional modification, translation, post-translational modification, and secretion. Expression can be detected using conventional techniques for detecting protein (e.g., ELISA, Western blotting, flow cytometry, immunofluorescence, immunohistochemistry, etc.).
[0125] The term modulate is used in accordance with its plain ordinary meaning and refers to the act of changing or varying one or more properties. Modulation refers to the process of changing or varying one or more properties. For example, as applied to the effects of a modulator on a target protein, to modulate means to change by increasing or decreasing a property or function of the target molecule or the amount of the target molecule.
[0126] Disease or condition refer to a state of being or health status of a patient or subject capable of being treated with the compounds or methods provided herein. In some embodiments, the disease is a disease related to (e.g., caused by) a cellular component (e.g., protein, ion, lipid, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or macromolecule). In embodiments, the disease is pain.
[0127] As used herein, the term a disease or disorder related to low TREK family protein activity refers to a disease or disorder related to a TREK family protein activity below the level typically seen in a healthy subject or in subjects without the TREK family disease or disorder.
[0128] Pharmaceutically acceptable excipient and pharmaceutically acceptable carrier refer to a substance that aids the administration of an active agent to and absorption by a subject and can be included in the compositions of the present invention without causing a significant adverse toxicological effect on the patient. Non-limiting examples of pharmaceutically acceptable excipients include water, NaCl, normal saline solutions, lactated Ringer's, normal sucrose, normal glucose, binders, fillers, disintegrants, lubricants, coatings, sweeteners, flavors, salt solutions (such as Ringer's solution), alcohols, oils, gelatins, carbohydrates such as lactose, amylose or starch, fatty acid esters, hydroxymethycellulose, polyvinyl pyrrolidine, and colors, and the like. Such preparations can be sterilized and, if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention. One of skill in the art will recognize that other pharmaceutical excipients are useful in the present invention.
[0129] The term preparation is intended to include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it. Similarly, cachets and lozenges are included. Tablets, powders, capsules, pills, cachets, and lozenges can be used as solid dosage forms suitable for oral administration.
[0130] As used herein, the term about means a range of values including the specified value, which a person of ordinary skill in the art would consider reasonably similar to the specified value. In embodiments, about means within a standard deviation using measurements generally acceptable in the art. In embodiments, about means a range extending to +/10% of the specified value. In embodiments, about includes the specified value.
[0131] The compounds described herein can be used in combination with one another, with other active agents known to be useful in treating a disease associated with cells expressing a disease associated cellular component, or with adjunctive agents that may not be effective alone, but may contribute to the efficacy of the active agent.
[0132] In some embodiments, co-administration includes administering one active agent within 0.5, 1, 2, 4, 6, 8, 10, 12, 16, 20, or 24 hours of a second active agent. Co-administration includes administering two active agents simultaneously, approximately simultaneously (e.g., within about 1, 5, 10, 15, 20, or 30 minutes of each other), or sequentially in any order. In some embodiments, co-administration can be accomplished by co-formulation, i.e., preparing a single pharmaceutical composition including both active agents. In other embodiments, the active agents can be formulated separately. In another embodiment, the active and/or adjunctive agents may be linked or conjugated to one another. In embodiments, the TREK family protein and the TREK agonist are administered simultaneously. In embodiments, the TREK family protein and the TREK agonist are administered approximately simultaneously. In embodiments, the TREK family protein and the TREK agonist are administered sequentially.
[0133] In therapeutic use for the treatment of a disease, compound utilized in the pharmaceutical compositions of the present invention may be administered at the initial dosage of about 0.001 mg/kg to about 1000 mg/kg daily. A daily dose range of about 0.01 mg/kg to about 500 mg/kg, or about 0.1 mg/kg to about 200 mg/kg, or about 1 mg/kg to about 100 mg/kg, or about 10 mg/kg to about 50 mg/kg, can be used. The dosages, however, may be varied depending upon the requirements of the patient, the severity of the condition being treated, and the compound or drug being employed. For example, dosages can be empirically determined considering the type and stage of disease (e.g., pain) diagnosed in a particular patient. The dose administered to a patient, in the context of the present invention, should be sufficient to affect a beneficial therapeutic response in the patient over time. The size of the dose will also be determined by the existence, nature, and extent of any adverse side effects that accompany the administration of a compound in a particular patient. Determination of the proper dosage for a particular situation is within the skill of the practitioner. Generally, treatment is initiated with smaller dosages which are less than the optimum dose of the compound. Thereafter, the dosage is increased by small increments until the optimum effect under circumstances is reached. For convenience, the total daily dosage may be divided and administered in portions during the day, if desired.
[0134] The term associated or associated with in the context of a substance or substance activity or function associated with a disease (e.g., a protein associated disease, disease associated with a cellular component) means that the disease (e.g., pain) is caused by (in whole or in part), or a symptom of the disease is caused by (in whole or in part) the substance or substance activity or function or the disease or a symptom of the disease may be treated by modulating (e.g., inhibiting or activating) the substance (e.g., cellular component). As used herein, what is described as being associated with a disease, if a causative agent, could be a target for treatment of the disease.
[0135] The term electrophilic as used herein refers to a chemical group that is capable of accepting electron density. An electrophilic substituent, electrophilic chemical moiety, or electrophilic moiety refers to an electron-poor chemical group, substituent, or moiety (monovalent chemical group), which may react with an electron-donating group, such as a nucleophile, by accepting an electron pair or electron density to form a bond.
[0136] Nucleophilic as used herein refers to a chemical group that is capable of donating electron density.
[0137] The term isolated, when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is essentially free of other cellular components with which it is associated in the natural state. It can be, for example, in a homogeneous state and may be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein that is the predominant species present in a preparation is substantially purified.
[0138] The term amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid-like compounds that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, y-carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid-like compounds refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid. The terms non-naturally occurring amino acid and unnatural amino acid refer to amino acid analogs, synthetic amino acids, and amino acid-like compounds which are not found in nature.
[0139] Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
[0140] An amino acid or nucleotide base position is denoted by a number that sequentially identifies each amino acid (or nucleotide base) in the reference sequence based on its position relative to the N-terminus (or 5-end). Due to deletions, insertions, truncations, fusions, and the like that must be taken into account when determining an optimal alignment, in general the amino acid residue number in a test sequence determined by simply counting from the N-terminus will not necessarily be the same as the number of its corresponding position in the reference sequence. For example, in a case where a variant has a deletion relative to an aligned reference sequence, there will be no amino acid in the variant that corresponds to a position in the reference sequence at the site of deletion. Where there is an insertion in an aligned reference sequence, that insertion will not correspond to a numbered amino acid position in the reference sequence. In the case of truncations or fusions there can be stretches of amino acids in either the reference or aligned sequence that do not correspond to any amino acid in the corresponding sequence.
[0141] The terms numbered with reference to or corresponding to, when used in the context of the numbering of a given amino acid or polynucleotide sequence, refers to the numbering of the residues of a specified reference sequence when the given amino acid or polynucleotide sequence is compared to the reference sequence.
[0142] An amino acid residue in a protein corresponds to a given residue when it occupies the same essential structural position within the protein as the given residue. For example, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 131 of SEQ ID NO: 1. In embodiments, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 111 of SEQ ID NO: 2. In embodiments, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 85 of SEQ ID NO: 3. In embodiments, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 142 of SEQ ID NO: 4. In embodiments, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 156 of SEQ ID NO: 5. In embodiments, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 97 of SEQ ID NO: 6. In embodiments, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 161 of SEQ ID NO: 7. In embodiments, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 95 of SEQ ID NO: 8. In embodiments, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 93 of SEQ ID NO: 9. In embodiments, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 93 of SEQ ID NO: 10. In embodiments, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 92 of SEQ ID NO: 11. In embodiments, a TREK family protein (or homolog thereof) includes a cysteine corresponding to position 131 of TREK-1 when the selected cysteine residue occupies the same essential spatial or other structural relationship as amino acid position 92 of SEQ ID NO: 12.
[0143] In some embodiments, where a selected protein is aligned for maximum homology with the TREK-1 protein, the position in the aligned selected protein aligning with position 131 is said to correspond to position 131 of TREK-1. Instead of a primary sequence alignment, a three dimensional structural alignment can also be used, e.g., where the structure of the selected protein is aligned for maximum correspondence with the TREK-1 protein and the overall structures compared. In this case, an amino acid that occupies the same essential position as position 131 in the structural model is said to correspond to the position 131 of TREK-1.
[0144] As used herein, the term cysteine residue refers to a cysteine located on a protein or polypeptide. Cysteine contains a reactive sulph-hydryl group. In embodiments, the cysteine residue has the ability to react with another cysteine to form a disulfide bond. In embodiments, the disulfide bond confers stability to the protein. In embodiments, a TREK family protein is modified to include a cysteine residue not found a natural TREK family protein. In embodiments, the TREK family protein is a TREK-1 protein, a TREK-2 protein or a TRAAK protein. In embodiments, the TREK family protein is a TREK-1 protein. In embodiments, the TREK family protein is a TREK-2 protein. In embodiments, the TREK family protein is a TRAAK protein.
[0145] The term protein complex is used in accordance with its plain ordinary meaning and refers to a protein which is associated with an additional substance (e.g., another protein, protein subunit, or a compound). Protein complexes typically have defined quaternary structure. The association between the protein and the additional substance may be a covalent bond. In embodiments, the association between the protein and the additional substance (e.g., compound) is via non-covalent interactions. In embodiments, a protein complex refers to a group of two or more polypeptide chains. Proteins in a protein complex are linked by non-covalent protein-protein interactions. A non-limiting example of a protein complex is the proteasome.
[0146] The term protein aggregate is used in accordance with its plain ordinary meaning and refers to an aberrant collection or accumulation of proteins (e.g., misfolded proteins). Protein aggregates are often associated with diseases (e.g., amyloidosis). Typically, when a protein misfolds as a result of a change in the amino acid sequence or a change in the native environment which disrupts normal non-covalent interactions, and the misfolded protein is not corrected or degraded, the unfolded/misfolded protein may aggregate. There are three main types of protein aggregates that may form: amorphous aggregates, oligomers, and amyloid fibrils. In embodiments, protein aggregates are termed aggresomes.
[0147] The term selective or selectivity or the like in reference to a compound or agent refers to the compound's or agent's ability to cause an increase or decrease in activity of a particular molecular target, such as a TREK family protein, preferentially over one or more different molecular targets. In embodiments, a TREK family protein-selective compound refers to a compound (e.g., compound described herein) having selectivity towards a TREK family protein as provided herein.
[0148] As used herein, the term salt refers to acid or base salts of the compounds used in the methods of the present invention. Illustrative examples of acceptable salts are mineral acid (hydrochloric acid, hydrobromic acid, phosphoric acid, and the like) salts, organic acid (acetic acid, propionic acid, glutamic acid, citric acid and the like) salts, quaternary ammonium (methyl iodide, ethyl iodide, and the like) salts.
[0149] The terms bind and bound as used herein is used in accordance with its plain and ordinary meaning and refers to the association between atoms or molecules. The association can be direct or indirect. For example, bound atoms or molecules may be direct, e.g., by covalent bond or linker (e.g. a first linker or second linker), or indirect, e.g., by non-covalent bond (e.g. electrostatic interactions (e.g. ionic bond, hydrogen bond, halogen bond), van der Waals interactions (e.g. dipole-dipole, dipole-induced dipole, London dispersion), ring stacking (pi effects), hydrophobic interactions and the like).
[0150] The term capable of binding as used herein refers to a moiety (e.g. a compound as described herein) that is able to measurably bind to a target. In embodiments, a TREK family protein agonist comprises a cysteine binding moiety capable of covalently binding a TREK family protein at a cysteine residue corresponding to position 131 of a TREK-1 protein. In embodiments, where the cysteine binding moiety is capable of binding the target TREK family protein, the moiety is capable of binding with a Kd of less than about 10 M, 5 M, 1 M, 500 nM, 250 nM, 100 nM, 75 nM, 50 nM, 25 nM, 15 nM, 10 nM, 5 nM, 1 nM, or about 0.1 nM.
[0151] The terms treating, or treatment refers to any indicia of success in the therapy or amelioration of an injury, disease, pathology or condition, including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the injury, pathology or condition more tolerable to the patient; slowing in the rate of degeneration or decline; making the final point of degeneration less debilitating; improving a patient's physical or mental well-being. The treatment or amelioration of symptoms can be based on objective or subjective parameters; including the results of a physical examination, neuropsychiatric exams, and/or a psychiatric evaluation. The term treating and conjugations thereof, may include prevention of an injury, pathology, condition, or disease. In embodiments, treating is preventing. In embodiments, treating does not include preventing.
[0152] Treating or treatment as used herein (and as well-understood in the art) also broadly includes any approach for obtaining beneficial or desired results in a subject's condition, including clinical results. Beneficial or desired clinical results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions, diminishment of the extent of a disease, stabilizing (i.e., not worsening) the state of disease, prevention of a disease's transmission or spread, delay or slowing of disease progression, amelioration or palliation of the disease state, diminishment of the reoccurrence of disease, and remission, whether partial or total and whether detectable or undetectable. In other words, treatment as used herein includes any cure, amelioration, or prevention of a disease. Treatment may prevent the disease from occurring; inhibit the disease's spread; relieve the disease's symptoms, fully or partially remove the disease's underlying cause, shorten a disease's duration, or do a combination of these things.
[0153] Treating and treatment as used herein include prophylactic treatment. Treatment methods include administering to a subject a therapeutically effective amount of an active agent. The administering step may consist of a single administration or may include a series of administrations. The length of the treatment period depends on a variety of factors, such as the severity of the condition, the age of the patient, the concentration of active agent, the activity of the compositions used in the treatment, or a combination thereof. It will also be appreciated that the effective dosage of an agent used for the treatment or prophylaxis may increase or decrease over the course of a particular treatment or prophylaxis regime. Changes in dosage may result and become apparent by standard diagnostic assays known in the art. In some instances, chronic administration may be required. For example, the compositions are administered to the subject in an amount and for a duration sufficient to treat the patient. In embodiments, the treating or treatment is no prophylactic treatment.
[0154] The terms patient, patient in need thereof, subject, or subject in need thereof refers to a living organism suffering from or prone to a disease or condition that can be treated by administration of a pharmaceutical composition as provided herein. Non-limiting examples include humans, other mammals, bovines, rats, mice, dogs, monkeys, goat, sheep, cows, deer, and other non-mammalian animals. In some embodiments, a patient is human. In embodiments, a patient in need thereof is human. In embodiments, a subject is human. In embodiments, a subject in need thereof is human.
[0155] An effective amount is an amount sufficient for a compound to accomplish a stated purpose relative to the absence of the compound (e.g., achieve the effect for which it is administered, treat a disease, reduce enzyme activity, increase enzyme activity, reduce a signaling pathway, or reduce one or more symptoms of a disease or condition). An example of an effective amount is an amount sufficient to contribute to the treatment, prevention, or reduction of a symptom or symptoms of a disease, which could also be referred to as a therapeutically effective amount. A reduction of a symptom or symptoms (and grammatical equivalents of this phrase) means decreasing of the severity or frequency of the symptom(s), or elimination of the symptom(s). A prophylactically effective amount of a drug is an amount of a drug that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of an injury, disease, pathology or condition, or reducing the likelihood of the onset (or reoccurrence) of an injury, disease, pathology, or condition, or their symptoms. The full prophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses. Thus, a prophylactically effective amount may be administered in one or more administrations. An activity decreasing amount, as used herein, refers to an amount of antagonist required to decrease the activity of an enzyme relative to the absence of the antagonist. A function disrupting amount, as used herein, refers to the amount of antagonist required to disrupt the function of an enzyme or protein relative to the absence of the antagonist. The exact amounts will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); and Remington: The Science and Practice of Pharmacy, 20th Edition, 2003, Gennaro, Ed., Lippincott, Williams & Wilkins).
[0156] For any compound described herein, the therapeutically effective amount can be initially determined from cell culture assays. Target concentrations will be those concentrations of active compound(s) that are capable of achieving the methods described herein, as measured using the methods described herein or known in the art.
[0157] As is well known in the art, therapeutically effective amounts for use in humans can also be determined from animal models. For example, a dose for humans can be formulated to achieve a concentration that has been found to be effective in animals. The dosage in humans can be adjusted by monitoring compounds effectiveness and adjusting the dosage upwards or downwards, as described above. Adjusting the dose to achieve maximal efficacy in humans based on the methods described above and other methods is well within the capabilities of the ordinarily skilled artisan.
[0158] The term therapeutically effective amount, as used herein, refers to that amount of the therapeutic agent sufficient to ameliorate the disorder, as described above. For example, for the given parameter, a therapeutically effective amount will show an increase or decrease of at least 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%. Therapeutic efficacy can also be expressed as -fold increase or decrease. For example, a therapeutically effective amount can have at least a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a control.
[0159] Dosages may be varied depending upon the requirements of the patient and the compound being employed. The dose administered to a patient, in the context of the present disclosure, should be sufficient to effect a beneficial therapeutic response in the patient over time. The size of the dose also will be determined by the existence, nature, and extent of any adverse side-effects. Determination of the proper dosage for a particular situation is within the skill of the practitioner. Generally, treatment is initiated with smaller dosages which are less than the optimum dose of the compound. Thereafter, the dosage is increased by small increments until the optimum effect under circumstances is reached. Dosage amounts and intervals can be adjusted individually to provide levels of the administered compound effective for the particular clinical indication being treated. This will provide a therapeutic regimen that is commensurate with the severity of the individual's disease state.
[0160] As used herein, the term administering is used in accordance with its plain and ordinary meaning and includes oral administration, administration as a suppository, topical contact, intravenous, parenteral, intraperitoneal, intramuscular, intralesional, intrathecal, intranasal or subcutaneous administration, or the implantation of a slow-release device, e.g., a mini-osmotic pump, to a subject. Administration is by any route, including parenteral and transmucosal (e.g., buccal, sublingual, palatal, gingival, nasal, vaginal, rectal, or transdermal). Parenteral administration includes, e.g., intravenous, intramuscular, intra-arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial. Other modes of delivery include, but are not limited to, the use of liposomal formulations, intravenous infusion, transdermal patches, etc. In embodiments, the administering does not include administration of any active agent other than the recited active agent. In embodiments, the administering includes simultaneous or sequential administration of another active agent in addition to the recited active agents.
[0161] As used herein, the term co-administer it is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of one or more additional therapies. The compounds provided herein can be administered alone or can be coadministered to the patient. Coadministration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound). Thus, the preparations can also be combined, when desired, with other active substances (e.g. to reduce metabolic degradation). The compositions of the present disclosure can be delivered transdermally, by a topical route, or formulated as applicator sticks, solutions, suspensions, emulsions, gels, creams, ointments, pastes, jellies, paints, powders, and aerosols.
[0162] As used herein, the terms specific, specifically, specificity, or the like of a compound refers to the compound's ability to cause a particular action, such as inhibition, to a particular molecular target with minimal or no action to other proteins in the cell.
[0163] Nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded forms, and complements thereof. The term polynucleotide refers to a linear sequence of nucleotides. The term nucleotide typically refers to a single unit of a polynucleotide, i.e., a monomer. Nucleotides can be ribonucleotides, deoxyribonucleotides, or modified versions thereof. Examples of polynucleotides contemplated herein include single and double stranded DNA, single and double stranded RNA (including siRNA), and hybrid molecules having mixtures of single and double stranded DNA and RNA. Nucleic acid as used herein also refers to nucleic acids that have the same basic chemical structure as a naturally occurring nucleic acid. Such analogues have modified sugars and/or modified ring substituents, but retain the same basic chemical structure as the naturally occurring nucleic acid. A nucleic acid mimetic refers to chemical compounds that have a structure that is different from the general chemical structure of a nucleic acid, but that functions in a manner similar to a naturally occurring nucleic acid. Examples of such analogues include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, and peptide-nucleic acids (PNAs).
[0164] The term nucleotide typically refers to a compound containing a nucleoside or a nucleoside analogue and at least one phosphate group or a modified phosphate group linked to it by a covalent bond. Exemplary covalent bonds include, without limitation, an ester bond between the 3, 2 or 5 hydroxyl group of a nucleoside and a phosphate group.
[0165] The term nucleoside refers to a compound containing a sugar part and a nucleobase, e.g., a pyrimidine or purine base. Exemplary sugars include, without limitation, ribose, 2-deoxyribose, arabinose and the like. Exemplary nucleobases include, without limitation, thymine, uracil, cytosine, adenine, guanine.
[0166] The term nucleoside analogue may refer to a nucleoside any part of which is replaced by a chemical group of any nature. Exemplary nucleoside analogues include, without limitation, 2-substituted nucleosides such as 2-fluoro, 2-deoxy, 2-O-methyl, 2-OP-methoxyethyl, 2-O-allylriboribonucleosides, 2-amino, locked nucleic acid (LNA) monomers and the like. The term nucleoside analogue may also refer to a nucleoside in which the sugar or base part is modified, e.g., with a non-naturally occurring modification. Exemplary nucleoside analogues in which the sugar part is replaced with another cyclic structure include, without limitation, monomeric units of morpholinos (PMO) and tricyclo-DNA. Exemplary nucleoside analogues in which the sugar part is replaced with an acyclic structure include, without limitation, monomeric units of peptide nucleic acids (PNA) and glycerol nucleic acids (GNA). Suitably, nucleoside analogues may include nucleoside analogues in which the sugar part is replaced by a morpholine ring.
[0167] Nucleoside analogues may include deoxyadenosine analogues, adenosine analogues, deoxycytidine analogues, cytidine analogues, deoxyguanosine analogues, guanosine analogues, thymidine analogues, 5-methyluridine analogues, deoxyuridine analogues, or uridine analogues. Examples of deoxyadenosine analogues include didanosine (2, 3-dideoxyinosine) and vidarabine (9-D-arabinofuranosyladenine), fludarabine, pentostatin, cladribine. Examples of adenosine analogues include BCX4430 (Immucillin-A). Examples of cytidine analogues include gemcitabine, 5-aza-2-deoxycytidine, cytarabine. Examples of deoxycytidine analogues include cytarabine, emtricitabine, lamivudine, zalcitabine. Examples of guanosine and deoxyguanosine analogues include abacavir, acyclovir, entecavir. Examples of thymidine and 5-methyluridine analogues include stavudine, telbivudine, zidovudine. Examples of deoxyuridine analogues include idoxuridine and trifluridine.
[0168] The terms purine analogue or pyrimdine analogue refers to modifications, optionally non-naturally occurring modifications, in the nucleobase, for example hypoxanthine, xanthine, 2-aminopurine, 2,6-diaminopurine, 6-azauracil, 5-methylcytosine, 4-fluorouracil, 5-fluoruracil, 5-chlorouracil, 5-bromouracil, 5-iodouracil, 5-trifluoromethyluracil, 5-fluorocytosine, 5-chlorocytosine, 5-bromocytosine, 5-iodocytosine, 5-propynyluracil, 5-propynylcytosine, 7-deazaadenine, 7-deazaguanine, 7-deaza-8-azaadenine, 7-deaza-8-azaguanine, isocytosine, isoguanine, mercaptopurine, thioguanine. Exemplary pyrimidine analogues include, without limitation, 5-position substituted pyrimidines, e.g. substitution with 5-halo, 5-fluoro. Examples of purine analogues include, without limitation, 6- or 8-position substituted purines, e.g., substitution with 5-halo, 5-fluoro.
[0169] The term phosphate group as used herein refers to phosphoric acid H3PO4 wherein any hydrogen atoms are replaced by one, two or three organic radicals to give a phosphoester, phosphodiester, or phosphotriester, respectively. Oligonucleotides may be linked by phosphodiester, phosphorothioate or phosphorodithioate linkages.
[0170] In structures of this type, it will be appreciated that the labels 3 and 5, as applied to conventional sugar chemistry, apply by analogy.
[0171] The term gene means the segment of DNA involved in producing a protein; it includes regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons). The leader, the trailer, as well as the introns, include regulatory elements that are necessary during the transcription and the translation of a gene. Further, a protein gene product is a protein expressed from a particular gene.
[0172] The word expression or expressed as used herein in reference to a gene means the transcriptional and/or translational product of that gene. The level of expression of a DNA molecule in a cell may be determined on the basis of either the amount of corresponding mRNA that is present within the cell or the amount of protein encoded by that DNA produced by the cell. The level of expression of nucleic acid molecules may be detected by standard PCR or Northern blot methods well known in the art. See, Sambrook et al., 1989 Molecular Cloning: A Laboratory Manual, 18.1-18.88.
[0173] Expression of a transfected gene can occur transiently or stably in a cell. During transient expression the transfected gene is not transferred to the daughter cell during cell division. Since its expression is restricted to the transfected cell, expression of the gene is lost over time. In contrast, stable expression of a transfected gene can occur when the gene is co-transfected with another gene that confers a selection advantage to the transfected cell. Such a selection advantage may be a resistance towards a certain toxin that is presented to the cell.
[0174] The terms transfection, transduction, transfecting or transducing are used interchangeably throughout and are defined as a process of introducing a nucleic acid molecule or a protein to a cell. Nucleic acids are introduced to a cell using non-viral or viral-based methods. The nucleic acid molecules may be gene sequences encoding complete proteins or functional portions thereof. Non-viral methods of transfection include any appropriate transfection method that does not use viral DNA or viral particles as a delivery system to introduce the nucleic acid molecule into the cell. Exemplary non-viral transfection methods include calcium phosphate transfection, liposomal transfection, nucleofection, sonoporation, transfection through heat shock, magnetifection, and electroporation. In some embodiments, the nucleic acid molecules are introduced into a cell using electroporation following standard procedures well known in the art. For viral-based methods of transfection any useful viral vector may be used in the methods described herein. Examples for viral vectors include, but are not limited to retroviral, adenoviral, lentiviral and adeno-associated viral vectors. In some embodiments, the nucleic acid molecules are introduced into a cell using a retroviral vector following standard procedures well known in the art. The terms transfection or transduction also refer to introducing proteins into a cell from the external environment. Typically, transduction or transfection of a protein relies on attachment of a peptide or protein capable of crossing the cell membrane to the protein of interest. See, e.g., Ford et al. (2001) Gene Therapy 8:1-4 and Prochiantz (2007) Nat. Methods 4:119-20.
[0175] The term plasmid or expression vector refers to a nucleic acid molecule that encodes for genes and/or regulatory elements necessary for the expression of genes. Expression of a gene from a plasmid can occur in cis or in trans. If a gene is expressed in cis, gene and regulatory elements are encoded by the same plasmid. Expression in trans refers to the instance where the gene and the regulatory elements are encoded by separate plasmids.
[0176] The terms polypeptide, peptide and protein are used interchangeably herein to refer to a polymer of amino acid residues, wherein the polymer may optionally be conjugated to a moiety that does not consist of amino acids. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. A fusion protein refers to a chimeric protein encoding two or more separate protein sequences that are recombinantly expressed as a single moiety.
[0177] Conservatively modified variants applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids that encode identical or essentially identical amino acid sequences. Because of the degeneracy of the genetic code, a number of nucleic acid sequences will encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are silent variations, which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence.
[0178] As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a conservatively modified variant where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the disclosure. The following eight groups each contain amino acids that are conservative substitutions for one another: (1) Alanine (A), Glycine (G); (2) Aspartic acid (D), Glutamic acid (E); (3) Asparagine (N), Glutamine (Q); (4) Arginine (R), Lysine (K); (5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); (6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); (7) Serine (S), Threonine (T); and (8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
[0179] The term recombinant when used with reference, for example, to a cell, a nucleic acid, a protein, or a vector, indicates that the cell, nucleic acid, protein or vector has been modified by or is the result of laboratory methods. Thus, for example, recombinant proteins include proteins produced by laboratory methods. Recombinant proteins can include amino acid residues not found within the native (non-recombinant) form of the protein or can be include amino acid residues that have been modified (e.g., labeled).
[0180] The terms identical or percent identity, in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identity over a specified region, e.g., of the entire polypeptide sequences disclosed herein or individual domains of the polypeptides disclosed herein), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Such sequences are then considered to be substantially identical. This definition also refers to the complement of a test sequence. Optionally, the identity exists over a region that is at least about 50 nucleotides in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides in length.
[0181] Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
[0182] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
[0183] A comparison window, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of, e.g., a full length sequence or from 20 to 600, about 50 to about 200, or about 100 to about 150 amino acids or nucleotides in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Any methods of alignment of sequences for comparison well known in the art are contemplated. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman (1988) Proc. Nat'l. Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection (see, e.g., Ausubel et al., Current Protocols in Molecular Biology (1995 supplement)).
[0184] Example of an algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1977) Nuc. Acids Res. 25:3389-3402, and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) or 10, M=5, N=4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=4, and a comparison of both strands.
[0185] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
[0186] An indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross-reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically or substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below. Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequence.
[0187] The term complement, as used herein, refers to a nucleotide (e.g., RNA or DNA) or a sequence of nucleotides capable of base pairing with a complementary nucleotide or sequence of nucleotides. As described herein and commonly known in the art the complementary (matching) nucleotide of adenosine is thymidine and the complementary (matching) nucleotide of guanosine is cytosine. Thus, a complement may include a sequence of nucleotides that base pair with corresponding complementary nucleotides of a second nucleic acid sequence. The nucleotides of a complement may partially or completely match the nucleotides of the second nucleic acid sequence. Where the nucleotides of the complement completely match each nucleotide of the second nucleic acid sequence, the complement forms base pairs with each nucleotide of the second nucleic acid sequence. Where the nucleotides of the complement partially match the nucleotides of the second nucleic acid sequence only some of the nucleotides of the complement form base pairs with nucleotides of the second nucleic acid sequence. Examples of complementary sequences include coding and a non-coding sequences, wherein the non-coding sequence contains complementary nucleotides to the coding sequence and thus forms the complement of the coding sequence. A further example of complementary sequences are sense and antisense sequences, wherein the sense sequence contains complementary nucleotides to the antisense sequence and thus forms the complement of the antisense sequence.
[0188] An antisense nucleic acid as referred to herein is a nucleic acid (e.g., DNA or RNA molecule) that is complementary to at least a portion of a specific target nucleic acid (e.g., an mRNA translatable into a protein). In embodiments, the antisense nucleic acid is capable of reducing transcription of the target nucleic acid (e.g., mRNA from DNA) or reducing the translation or the amount of the target nucleic acid (e.g. mRNA) or altering transcript splicing (e.g. single stranded morpholino oligo). See, e.g., Weintraub, Scientific American, 262:40 (1990). In embodiments, synthetic antisense nucleic acids (e.g., oligonucleotides) are between 15 and 25 bases in length. In embodiments, the antisense nucleic acids are capable of hybridizing to (e.g., selectively hybridizing to) a target nucleic acid (e.g., target mRNA). In embodiments, the antisense nucleic acid hybridizes to the target nucleic acid sequence (e.g., mRNA) under stringent hybridization conditions. In embodiments, the antisense nucleic acid hybridizes to the target nucleic acid (e.g., mRNA) under moderately stringent hybridization conditions. In embodiments, the antisense nucleic acids may comprise naturally occurring nucleotides or modified nucleotides such as, e.g., phosphorothioate, methylphosphonate, and -anomeric sugar-phosphate, backbonemodified nucleotides. In the cell, the antisense nucleic acids may hybridize to the corresponding mRNA, forming a double-stranded molecule. In embodiments, the antisense nucleic acids interfere with the translation of the mRNA, since the cell will not translate an mRNA that is double-stranded. The use of antisense methods to inhibit the in vitro translation of genes is well known in the art (Marcus-Sakura, Anal. Biochem. 172:289, (1988)). Further, antisense molecules which bind directly to the DNA may be used. Antisense nucleic acids may be single or double stranded nucleic acids. Non-limiting examples of antisense nucleic acids include siRNAs (including their derivatives or pre-cursors, such as nucleotide analogues), short hairpin RNAs (shRNA), micro RNAs (miRNA), saRNAs (small activating RNAs) and small nucleolar RNAs (snoRNA) or certain of their derivatives or pre-cursors.
[0189] A siRNA, small interfering RNA, small RNA, or RNAi as provided herein, refers to a nucleic acid that forms a double stranded RNA, which double stranded RNA has the ability to reduce or inhibit expression of a gene or target gene when present in the same cell as the gene or target gene. The complementary portions of the nucleic acid that hybridize to form the double stranded molecule typically have substantial or complete identity. In one embodiment, a siRNA or RNAi is a nucleic acid that has substantial or complete identity to a target gene and forms a double stranded siRNA. In embodiments, the siRNA inhibits gene expression by interacting with a complementary cellular mRNA thereby interfering with the expression of the complementary mRNA. Typically, the nucleic acid is at least about 15-50 nucleotides in length (e.g., each complementary sequence of the double stranded siRNA is 15-50 nucleotides in length, and the double stranded siRNA is about 15-50 base pairs in length). In other embodiments, the length is 20-30 base nucleotides, preferably about 20-25 or about 24-29 nucleotides in length, e.g., 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length.
[0190] A saRNA, or small activating RNA as provided herein refers to a nucleic acid that forms a double stranded RNA, which double stranded RNA has the ability to increase or activate expression of a gene or target gene when present in the same cell as the gene or target gene. The complementary portions of the nucleic acid that hybridize to form the double stranded molecule typically have substantial or complete identity. In one embodiment, a saRNA is a nucleic acid that has substantial or complete identity to a target gene and forms a double stranded saRNA. Typically, the nucleic acid is at least about 15-50 nucleotides in length (e.g., each complementary sequence of the double stranded saRNA is 15-50 nucleotides in length, and the double stranded saRNA is about 15-50 base pairs in length). In other embodiments, the length is 20-30 base nucleotides, preferably about 20-25 or about 24-29 nucleotides in length, e.g., 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length.
[0191] A shRNA, short hairpin RNA, or small hairpin RNA as provided herein refers to an RNA molecule including a hairpin turn that has the ability to reduce or inhibit expression of a target gene or target nucleic acid when expressed in the same cell as the target gene or target nucleic acid. shRNA expression in a cell may be accomplished by delivery of the shRNA the cell using a plasmid or vector. Typically, the shRNA is cleaved by an enzyme (i.e. Dicer) to produce an siRNA product. The siRNA may then associate with RISC, thereby allowing target recognition.
[0192] A PIWI-interacting RNA or piRNA refers to a type of small non-coding RNA (sncRNA), which is 26-31 nucleotides in length and binds to PIWI proteins. In embodiments, piRNAs are independent of the Dicer enzyme and are produced by a single-stranded precursor. In embodiments, piRNA clusters in somatic cells are unidirectional. In embodiments, the majority of germline piRNA clusters are dual-stranded. In embodiments, most mature primary piRNAs contain uridine at the 5 end, and the 3 ends of piRNAs are uniquely methylated 2-OH structures. In embodiments, piRNAs are unevenly distributed among various genomic sequences, including exons, introns, and repeat sequences. In embodiments, piRNAs are derived from transposons and from flanking genomic sequences.
[0193] In embodiments, piRNAs are not degraded in circulation and are stably expressed in body fluids. PIWI proteins are mainly expressed in the germline and human tumors. The human PIWI protein subfamily consists of PIWIL1, PIWIL2, PIWIL3 and PIWIL4. In embodiments, piRNAs interact with PIWI subfamily proteins, resulting in the development of the piRNA-induced silencing complex (piRISC), which detects and silences complementary sequences at the transcriptional (TGS) and post-transcriptional (PTGS) levels.
[0194] A gapmeR as provided herein refers to a short DNA antisense oligonucleotide flanked by RNA sequences. In embodiments, the RNA sequences include or are sequences of RNA nucleotide analogs. In embodiments, the RNA nucleotide analog is independently a locked nucleic acid (LNA), 2-OMe, or 2-F modified bases. In embodiments, LNA sequences are RNA analogues locked into an ideal Watson-Crick base pairing conformation. In embodiments, LNAs, 2-OMe, or 2-F modified bases are chemical analogs of natural RNA nucleic acids and allow for an increase in nuclease resistance, reduced immunogenicity, and a decrease in toxicity. In embodiments, gapmers have a high binding affinity to the target mRNA. In embodiments, this high binding affinity may reduce off-target effects, non-specific binding, and unwanted gene silencing. In embodiments, gapmeRs utilize nucleotides modified with phosphorothioate (PS) groups. In humans, the gapmer DNA-mRNA duplex may be degraded by RNase H. In embodiments, the degradation of the mRNA prevents protein synthesis. In embodiments, gapmeRs are designed to hybridize to a target RNA sequence and silence the gene through the induction of RNase H cleavage. In embodiments, binding of the gapmer to the target has a higher affinity due to the modified RNA flanking regions, as well as resistance to degradation by nucleases.
[0195] As used herein the term small molecule refers to a low molecular weight organic compound, typically involved in a biological process as a substrate or product. In embodiments, small molecules have a mass range of 50-1500 daltons (Da). In embodiments, organic compounds with low molecular weight are small molecule drugs. In embodiments, small molecule drugs can be administered orally. In embodiments, small molecule drugs can pass through cell membranes to reach intracellular targets. In embodiments, small molecule drugs can pass through the blood-brain barrier.
[0196] A guide RNA or gRNA as provided herein refers to any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence. In aspects, the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm, is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more.
[0197] In embodiments, the polynucleotide (e.g., gRNA) is a single-stranded ribonucleic acid. In aspects, the polynucleotide (e.g., gRNA) is from about 10 to about 200 nucleic acid residues in length. In aspects, the polynucleotide (e.g., gRNA) is from about 50 to about 150 nucleic acid residues in length. In aspects, the polynucleotide (e.g., gRNA) is from about 80 to about 140 nucleic acid residues in length. In aspects, the polynucleotide (e.g., gRNA) is from about 90 to about 130 nucleic acid residues in length. In aspects, the polynucleotide (e.g., gRNA) is from about 100 to about 120 nucleic acid residues in length. In aspects, the length of the polynucleotide (e.g., gRNA) is about 113 nucleic acid residues in length.
[0198] In embodiments, a guide sequence (i.e., a DNA-targeting sequence) is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence (e.g., a genomic or mitochondrial DNA target sequence) and direct sequence-specific binding of a complex (e.g., CRISPR complex) to the target sequence. In aspects, the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm, is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more.
[0199] In aspects, the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm, is at least about 80%, 85%, 90%, 95%, or 100%. In aspects, the degree of complementarity is at least 90%. Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g., the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies, ELAND (Illumina, San Diego, Calif.), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net). In aspects, a guide sequence is about or more than about 10, 20, 30, 35, 40, 45, 50, 75, or more nucleotides in length. In aspects, a guide sequence is about 10 to about 150, about 15 to about 100 nucleotides in length. In aspects, a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length. In aspects, the guide sequence is about or more than about 20 nucleotides in length. The ability of a guide sequence to direct sequence-specific binding of a complex (e.g., CRISPR complex) to a target sequence may be assessed by any suitable assay. For example, the components of a CRISPR system sufficient to form a complex (e.g., CRISPR complex), including the guide sequence to be tested, may be provided to a host cell having the corresponding target sequence, such as by transfection with vectors encoding the components of the CRISPR sequence, followed by an assessment of preferential cleavage within the target sequence, such as by Surveyor assay known in the art. Similarly, cleavage of a target polynucleotide sequence may be evaluated in a test tube by providing the target sequence, components of a complex (e.g., CRISPR complex), including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions. Other assays are possible, and will occur to those skilled in the art. The terms sgRNA, single guide RNA, and single guide RNA sequence are used interchangeably and refer to the polynucleotide sequence including the crRNA sequence and optionally the tracrRNA sequence. The crRNA sequence includes a guide sequence (i.e., guide or spacer) and a tracr mate sequence (i.e., direct repeat(s)). The term guide sequence refers to the sequence that specifies the target site. In aspects, the two RNA can be encoded separately by a crRNA and tracrRNA as 2 RNA molecules which then form an RNA/RNA complex due to complementary base pairing between the crRNA and tracrRNA (i.e., before being competent to bind to nuclease-deficient RNA-guided DNA endonuclease enzyme). In aspects, a first nucleic acid includes a tracrRNA sequence, and a separate second nucleic acid includes a gRNA sequence lacking a tracrRNA sequence. In aspects, the first nucleic acid including the tracrRNA sequence and the second nucleic acid including the gRNA sequence interact with one another, and optionally are included in a complex (e.g., CRISPR complex).
[0200] In general, a tracr mate sequence includes any sequence that has sufficient complementarity with a tracrRNA sequence to promote one or more of: (1) excision of a guide sequence flanked by tracr mate sequences in a cell containing the corresponding tracr sequence; and (2) formation of a complex (e.g., CRISPR complex) at a target sequence, wherein the complex (e.g., CRISPR complex) comprises the tracr mate sequence hybridized to the tracr sequence. In general, degree of complementarity is with reference to the optimal alignment of the tracr mate sequence and tracrRNA sequence, along the length of the shorter of the two sequences. Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self-complementarity within either the tracrRNA sequence or tracr mate sequence. In aspects, the degree of complementarity between the tracrRNA sequence and tracr mate sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher. In aspects, the degree of complementarity is about or at least about 80%, 90%, 95%, or 100%. In aspects, the tracrRNA sequence is about or more than about 5, 10, 15, 20, 30, 40, 50, or more nucleotides in length. In aspects, the tracrRNA sequence and tracr mate sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin.
[0201] The term RNA-guided DNA endonuclease and the like refer, in the usual and customary sense, to an enzyme that cleave a phosphodiester bond within a DNA polynucleotide chain, wherein the recognition of the phosphodiester bond is facilitated by a separate RNA sequence (for example, a single guide RNA).
[0202] The term Class II CRISPR endonuclease refers to endonucleases that have similar endonuclease activity as Cas9 and participate in a Class II CRISPR system. An example Class II CRISPR system is the type II CRISPR locus from Streptococcus pyogenes SF370, which contains a cluster of four genes Cas9, Cas1, Cas2, and Csn1, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of non-repetitive sequences (spacers, about 30 bp each). The Cpf1 enzyme belongs to a putative type V CRISPR-Cas system. Both type II and type V systems are included in Class II of the CRISPR-Cas system.
[0203] The term nuclease-deficient RNA-guided DNA endonuclease enzyme and the like refer, in the usual and customary sense, to an RNA-guided DNA endonuclease (e.g., a mutated form of a naturally occurring RNA-guided DNA endonuclease) that targets a specific phosphodiester bond within a DNA polynucleotide, wherein the recognition of the phosphodiester bond is facilitated by a separate polynucleotide sequence (for example, a RNA sequence (e.g., single guide RNA (sgRNA)), but is incapable of cleaving the target phosphodiester bond to a significant degree (e.g., there is no measurable cleavage of the phosphodiester bond under physiological conditions). A nuclease-deficient RNA-guided DNA endonuclease thus retains DNA-binding ability (e.g., specific binding to a target sequence) when complexed with a polynucleotide (e.g., sgRNA), but lacks significant endonuclease activity (e.g., any amount of detectable endonuclease activity). In aspects, the nuclease-deficient RNA-guided DNA endonuclease enzyme is a CRISPR-associated protein. In aspects, the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9, dCas12a, dCpf1, ddCpf1, Cas-phi, a nuclease-deficient Cas9 variant, a nuclease-deficient Class II CRISPR endonuclease, a leucine zipper domain, a winged helix domain, a helix-turn-helix motif, a helix-loop-helix domain, an H1 MB-box domain, a Wor3 domain, an OB-fold domain, an immunoglobulin domain, or a B3 domain.
[0204] The term CRISPR-associated protein or CRISPR protein refers to any CRISPR protein that functions as a nuclease-deficient RNA-guided DNA endonuclease enzyme, i.e., a CRISPR protein in which catalytic sites for endonuclease activity are defective or lack activity. Exemplary CRISPR proteins include dCas9, dCpf1, ddCpf1, dCas12, ddCas12, dCas12a Cas-phi, a nuclease-deficient Cas9 variant, a nuclease-deficient Class II CRISPR endonuclease, and the like.
[0205] The term nuclease-deficient DNA endonuclease enzyme refers to a DNA endonuclease (e.g., a mutated form of a naturally occurring DNA endonuclease) that targets a specific phosphodiester bond within a DNA polynucleotide, but that does not require an RNA guide. In embodiments, the nuclease-deficient DNA endonuclease enzyme is a zinc finger domain or a transcription activator-like effector (TALE).
[0206] In embodiments, the nuclease-deficient DNA endonuclease enzyme is a zinc finger domain. The term zinc finger domain or zinc finger binding domain or zinc finger DNA binding domain are used interchangeably and refer to a protein, or a domain within a larger protein, that binds DNA in a sequence-specific manner through one or more zinc fingers, which are regions of amino acid sequence within the binding domain whose structure is stabilized through coordination of a zinc ion. In embodiments, the zinc finger domain is non-naturally occurring in that it is engineered to bind to a target site of choice. In aspects, the zinc finger binding domain refers to a protein, a domain within a larger protein, or a nuclease-deficient RNA-guided DNA endonuclease enzyme that is capable of binding to any zinc finger known in the art, such as the C2H2 type, the CCHC type, the PHD type, or the RING type of zinc fingers.
[0207] A CRISPR associated protein 9, Cas9, Csn1 or Cas9 protein as referred to herein includes any of the recombinant or naturally-occurring forms of the Cas9 endonuclease or variants or homologs thereof that maintain Cas9 endonuclease enzyme activity (e.g., within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to Cas9). In aspects, the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring Cas9 protein. In aspects, the Cas9 protein is substantially identical to the protein identified by the UniProt reference number Q99ZW2 or a variant or homolog having substantial identity thereto. In aspects, the Cas9 protein has at least 75% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q99ZW2. In aspects, the Cas9 protein has at least 80% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q99ZW2. In aspects, the Cas9 protein has at least 85% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q99ZW2. In aspects, the Cas9 protein has at least 90% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q99ZW2. In aspects, the Cas9 protein has at least 95% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q99ZW2.
[0208] In embodiments, the nuclease-deficient RNA-guided DNA endonuclease enzyme is ddCpf1 or ddCas12a. The terms DNAse-dead Cpf1 or ddCpf1 refer to mutated Acidaminococcus sp. Cpf1 (AsCpf1) resulting in the inactivation of Cpf1 DNAse activity.
[0209] In embodiments, the nuclease-deficient RNA-guided DNA endonuclease enzyme is dLbCpf1. The term dLbCpf1: refers to mutated Cpf1 from Lachnospiraceae bacterium ND2006 (LbCpf1) that lacks DNAse activity. In aspects, dLbCpf1 includes a D832A mutation. In aspects, the dLbCpf1 has substantially no detectable endonuclease (e.g., endodeoxyribo-nuclease) activity.
[0210] In embodiments, the nuclease-deficient RNA-guided DNA endonuclease enzyme is dFnCpf1. The term dFnCpf1 refers to mutated Cpf1 from Francisella novicida U112 (FnCpf1) that lacks DNAse activity. In aspects, dFnCpf1 includes a D917A mutation. In aspects, the dFnCpf1 has substantially no detectable endonuclease (e.g., endodeoxyribo-nuclease) activity.
[0211] A Cpf1 or Cpf1 protein as referred to herein includes any of the recombinant or naturally-occurring forms of the Cpf1 (CRISPR from Prevotella and Francisella 1) endonuclease or variants or homologs thereof that maintain Cpf1 endonuclease enzyme activity (e.g., within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to Cpf1). In aspects, the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g., a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring Cpf1 protein.
[0212] Antibodies are large, complex molecules (molecular weight of 150,000 or about 1320 amino acids) with intricate internal structure. A natural antibody molecule contains two identical pairs of polypeptide chains, each pair having one light chain and one heavy chain. Each light chain and heavy chain in turn consists of two regions: a variable (V) region involved in binding the target antigen, and a constant (C) region that interacts with other components of the immune system. The light and heavy chain variable regions come together in 3-dimensional space to form a variable region that binds the antigen (for example, a receptor on the surface of a cell). Within each light or heavy chain variable region, there are three short segments (averaging 10 amino acids in length) called the complementarity determining regions (CDRs). The six CDRs in an antibody variable domain (three from the light chain and three from the heavy chain) fold up together in 3-dimensional space to form the actual antibody binding site which docks onto the target antigen. The position and length of the CDRs have been precisely defined by Kabat, E. et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1983, 1987. The part of a variable region not contained in the CDRs is called the framework (FR), which forms the environment for the CDRs.
[0213] An antibody variant as provided herein refers to a polypeptide capable of binding to an antigen and including one or more structural domains (e.g., light chain variable domain, heavy chain variable domain) of an antibody or fragment thereof Non-limiting examples of antibody variants include single-domain antibodies or nanobodies, monospecific Fab2, bispecific Fab2, trispecific Fab3, monovalent IgGs, scFv, bispecific antibodies, bispecific diabodies, trispecific triabodies, scFv-Fc, minibodies, IgNAR, V-NAR, hcIgG, VhH, or peptibodies. A peptibody as provided herein refers to a peptide moiety attached (through a covalent or non-covalent linker) to the Fc domain of an antibody. Further non-limiting examples of antibody variants known in the art include antibodies produced by cartilaginous fish or camelids. A general description of antibodies from camelids and the variable regions thereof and methods for their production, isolation, and use may be found in references WO97/49805 and WO 97/49805 which are incorporated by reference herein in their entirety and for all purposes. Likewise, antibodies from cartilaginous fish and the variable regions thereof and methods for their production, isolation, and use may be found in WO2005/118629, which is incorporated by reference herein in its entirety and for all purposes.
[0214] The terms CDR L1, CDR L2 and CDR L3 as provided herein refer to the complementarity determining regions (CDR) 1, 2, and 3 of the variable light (L) chain of an antibody. In embodiments, the variable light chain provided herein includes in N-terminal to C-terminal direction a CDR L1, a CDR L2 and a CDR L3. Likewise, the terms CDR H1, CDR H2 and CDR H3 as provided herein refer to the complementarity determining regions (CDR) 1, 2, and 3 of the variable heavy (H) chain of an antibody. In embodiments, the variable light chain provided herein includes in N-terminal to C-terminal direction a CDR L1, a CDR L2 and a CDR L3.
[0215] The term antibody is used according to its commonly known meaning in the art. Antibodies exist, e.g., as intact immunoglobulins or as a number of well-characterized fragments produced by digestion with various peptidases. Thus, for example, pepsin digests an antibody below the disulfide linkages in the hinge region to produce F(ab)2, a dimer of Fab which itself is a light chain joined to VHCH1 by a disulfide bond. The F(ab)2 may be reduced under mild conditions to break the disulfide linkage in the hinge region, thereby converting the F(ab)2 dimer into an Fab monomer. The Fab monomer is essentially Fab with part of the hinge region (see Fundamental Immunology (Paul ed., 3d ed. 1993). While various antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such fragments may be synthesized de novo either chemically or by using recombinant DNA methodology. Thus, the term antibody, as used herein, also includes antibody fragments either produced by the modification of whole antibodies, or those synthesized de novo using recombinant DNA methodologies (e.g., single chain Fv) or those identified using phage display libraries (see, e.g., McCafferty et al., Nature 348:552-554 (1990)).
[0216] The term antigen as provided herein refers to molecules capable of binding to the antibody binding domain provided herein. An antigen binding domain as provided herein is a region of an antibody that binds to an antigen (epitope). As described above, the antigen binding domain is generally composed of one constant and one variable domain of each of the heavy and the light chain (VL, VH, CL and CH1, respectively). The paratope or antigen-binding site is formed on the N-terminus of the antigen binding domain. The two variable domains of an antigen binding domain typically bind the epitope on an antigen.
[0217] Antibodies exist, for example, as intact immunoglobulins or as a number of well-characterized fragments produced by digestion with various peptidases. Thus, for example, pepsin digests an antibody below the disulfide linkages in the hinge region to produce F(ab)2, a dimer of Fab which itself is a light chain joined to VHCH1 by a disulfide bond. The F(ab)2 may be reduced under mild conditions to break the disulfide linkage in the hinge region, thereby converting the F(ab)2 dimer into an Fab monomer. The Fab monomer is essentially the antigen binding portion with part of the hinge region (see Fundamental Immunology (Paul ed., 3d ed. 1993). While various antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such fragments may be synthesized de novo either chemically or by using recombinant DNA methodology. Thus, the term antibody, as used herein, also includes antibody fragments either produced by the modification of whole antibodies, or those synthesized de novo using recombinant DNA methodologies (e.g., single chain Fv) or those identified using phage display libraries (see, e.g., McCafferty et al., Nature 348:552-554 (1990)).
[0218] A single-chain variable fragment (scFv) is typically a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a short linker peptide of 10 to about 25 amino acids. The linker may usually be rich in glycine for flexibility, as well as serine or threonine for solubility. The linker can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa.
[0219] The epitope of an antibody is the region of its antigen to which the antibody binds. Two antibodies bind to the same or overlapping epitope if each competitively inhibits (blocks) binding of the other to the antigen. That is, a 1, 5, 10, 20 or 100 excess of one antibody inhibits binding of the other by at least 30% but preferably 50%, 75%, 90% or even 99% as measured in a competitive binding assay (see, e.g., Junghans et al., Cancer Res. 50:1495, 1990). Alternatively, two antibodies have the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other. Two antibodies have overlapping epitopes if some amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
[0220] Selective or selectivity or the like of a compound refers to the compound's ability to discriminate between molecular targets.
[0221] Specific, specifically, specificity, or the like of a compound refers to the compound's ability to cause a particular action, such as inhibition, to a particular molecular target with minimal or no action to other proteins in the cell.
[0222] Contacting is used in accordance with its plain ordinary meaning and refers to the process of allowing at least two distinct species (e.g., chemical compounds including biomolecules or cells) to become sufficiently proximal to react, interact or physically touch. It should be appreciated; however, the resulting reaction product can be produced directly from a reaction between the added reagents or from an intermediate from one or more of the added reagents that can be produced in the reaction mixture.
[0223] The term expression includes any step involved in the production of a polypeptide including, but not limited to, transcription, post-transcriptional modification, translation, post-translational modification, and secretion. Expression can be detected using conventional techniques for detecting protein (e.g., ELISA, Western blotting, flow cytometry, immunofluorescence, immunohistochemistry, etc.).
[0224] It should be noted that throughout the application that alternatives are written in Markush groups, for example, each amino acid position that contains more than one possible amino acid. It is specifically contemplated that each member of the Markush group should be considered separately, thereby comprising another embodiment, and the Markush group is not to be read as a single unit.
[0225] The term exogenous refers to a molecule or substance (e.g., a compound, nucleic acid or protein) that originates from outside a given cell or organism. For example, an exogenous promoter as referred to herein is a promoter that does not originate from the plant it is expressed by. Conversely, the term endogenous or endogenous promoter refers to a molecule or substance that is native to, or originates within, a given cell or organism.
[0226] As used herein, the term conjugated when referring to two moieties means the two moieties are bonded, wherein the bond or bonds connecting the two moieties may be covalent or non-covalent. In embodiments, the two moieties are covalently bonded to each other (e.g., directly or through a covalently bonded intermediary). In embodiments, the two moieties are non-covalently bonded (e.g. through ionic bond(s), Van Der Waal's bond(s)/interactions, hydrogen bond(s), polar bond(s), or combinations or mixtures thereof).
[0227] The term heterologous when used with reference to portions of a nucleic acid indicates that the nucleic acid including two or more subsequences that are not found in the same relationship to each other in nature. For instance, the nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged to make a new functional nucleic acid, e.g., a promoter from one source and a coding region from another source. Similarly, a heterologous protein indicates that the protein including two or more subsequences that are not found in the same relationship to each other in nature (e.g., a fusion protein).
[0228] The terms isolate or isolated, when applied to a nucleic acid, virus, or protein, denotes that the nucleic acid, virus, or protein is essentially free of other cellular components with which it is associated in the natural state. It can be, for example, in a homogeneous state and may be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. An RNA that is the predominant species present in a preparation is substantially purified.
[0229] Biological sample or sample refer to materials obtained from or derived from a subject or patient. A biological sample includes sections of tissues such as biopsy and autopsy samples, and frozen sections taken for histological purposes. Such samples include bodily fluids such as blood and blood fractions or products (e.g., serum, plasma, platelets, red blood cells, and the like), sputum, tissue, cultured cells (e.g., primary cultures, explants, and transformed cells) stool, urine, synovial fluid, joint tissue, synovial tissue, synoviocytes, fibroblast-like synoviocytes, macrophage-like synoviocytes, immune cells, hematopoietic cells, fibroblasts, macrophages, T cells, etc. In embodiments, a biological sample is a tissue.
[0230] In embodiments, a biological sample is blood. In embodiments, a biological sample is a serum sample (e.g., the fluid and solute component of blood without the clotting factors). In embodiments, a biological sample is a plasma sample (e.g, the liquid portion of blood). In embodiments, a biological sample is cell-free RNA obtained from blood.
[0231] Liquid biological sample refers to liquid materials obtained or derived from a subject or patient. Liquid biological samples include bodily fluids such as blood and blood fractions or products (e.g., serum, plasma, platelets, red blood cells, and the like), sputum, urine, synovial fluid, and the like. In embodiments, a liquid biological sample is a blood sample.
[0232] The term prevent is used in accordance with its plain and ordinary meaning and refers to a decrease in the occurrence of disease symptoms in a patient. The prevention may be complete (no detectable symptoms) or partial, such that fewer symptoms are observed than would likely occur absent treatment.
[0233] The terms virus or virus particle are used according to its plain ordinary meaning within Virology and refers to a virion including the viral genome (e.g. DNA, RNA, single strand, double strand), viral capsid and associated proteins, and in the case of enveloped viruses (e.g. herpesvirus), an envelope including lipids and optionally components of host cell membranes, and/or viral proteins.
[0234] As used herein, the term Trek Family Protein refers to a protein belonging to the TRK subgroup of a family of K.sub.2P channels. The family contains subgroups of K2P channels which include, but are not limited to, TWIK (tandem of P-domains in a weak inward rectifying K+ channel); TREK, TWIK-related K+ channel; TASK (two-pore domain, acid-sensitive K+ channel); TRAAK (two-pore domain related arachidonic acid activated K+ channel); THIK (two-pore domain halothane inhibited K+ channel); TALK (two-pore domain alkaline activated K+ channel); and TRESK (TWIK-related spinal cord potassium channel). In embodiments, K.sub.2P channels are potassium channels characterized by the presence of two pore domains. In embodiments, K.sub.2P channels assemble as dimers of four transmembrane segments (M1-M4) and two-pore domain (P1 and P2). In embodiments, K.sub.2P channels have an extended M1-P1 extracellular loop and cytosolic N- and C-termini. In embodiments, K.sub.2P channels comprise the sequence Gly-Tyr(Phe)-Gly in the first pore (P1) and Gly-Leu(Phe)-Gly in the second pore (P2). In embodiments, TREK family proteins are found on nerve calls. In embodiments, TREK family proteins are found on heart cells. In embodiments, TREK family proteins are found on smooth muscle cells. In embodiments, TREK family proteins are found on pancreas cells. In embodiments, TREK family proteins are found on prostate cells.
[0235] As used herein, the term TREK-i refers to a K.sub.2P channel protein that controls cell excitability and maintains the membrane potential below the threshold of depolarization. In embodiments, TREK1 channels are expressed in dorsal root ganglion (DRG) neurons. In embodiments, TREK1 regulates the excitability of somatosensory nociceptive neurons. In embodiments, TREK-1 regulates pain perception. In embodiments, TREK-1 regulates depression. In embodiments, TREK-1 regulates the response to anesthesia. In embodiments, TREK-1 is expressed in the brain. In embodiments, TREK-1 is expressed in the heart. In embodiments, TREK-1 is expressed in smooth muscle cells. In embodiments, TREK-1 is expressed in the pancreas. In embodiments, TREK-1 is expressed in the prostate. In embodiments, the TREK-1 protein encoded by the KCNK2 gene has the amino acid sequence set forth in or corresponding to Entrez 3776, UniProt 095069, RefSeq (protein) NP_001017424.1, RefSeq (protein) NP_001017425.2, or RefSeq (protein) NP_055032.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0236] As used herein, the term TREK-2 refers to a K.sub.2P channel protein expressed mainly in the cerebellum, spleen and testis. In embodiments, TREK-2 channels are expressed in small DRG neurons. In embodiments, TREK-2 controls the resting membrane potential. In embodiments, TREK-2 channels are mechanosensitive. In embodiments, TREK-2 channels are activated by heat. In embodiments, TREK-2 channels limit spontaneous pain. In embodiments, TREK-2 channels limit neuropathic pain. In embodiments, TREK-2 channels limit hyperalgesia. In embodiments, TREK-2 protects epithelial cells against pressure-induced apoptosis. In embodiments, TREK-2 is expressed in renal epithelial cells. In embodiments, TREK-2 activation prevents kidney damage under conditions of increased blood pressure. In embodiments, TREK-2 activation preserves kidney function under high blood pressure. In embodiments, TREK-2 activation protects against neuropathic pain. In embodiments, the TREK-2 protein encoded by the KCNK10 gene has the amino acid sequence set forth in or corresponding to Entrez 54207, UniProt P57789, RefSeq (protein) NP_066984.1, RefSeq (protein) NP_612190.1, or RefSeq (protein) NP_612191.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0237] As used herein, the term TRAAK refers to members of the two pore domain K.sub.2P channel family. In embodiments, TRAAK proteins are found in the nervous system. In embodiments, TRAAK channels are mechanically gated. In embodiments, TRAAK is found in the brain. In embodiments, TRAAK is found in the spinal cord. In embodiments, TRAAK is found in the retina. In embodiments, TRAAK regulates neuronal excitability. In embodiments, TRAAK is expressed in the olfactory system. In embodiments, TRAAK is expressed in the cerebral cortex. In embodiments, TRAAK is expressed in the hippocampal formation. In embodiments, TRAAK is expressed in the habenula. In embodiments, TRAAK is expressed in the basal ganglia. In embodiments, TRAAK is expressed in the cerebellum. In embodiments, TRAAK channels regulate maintenance of the resting membrane potential in excitable cell types. In embodiments, abnormal TRAAK expression may cause facial dysmorphism. In embodiments, abnormal TRAAK expression may cause hypertrichosis. In embodiments, abnormal TRAAK expression may cause epilepsy. In embodiments, abnormal TRAAK expression may cause developmental delay. In embodiments, abnormal TRAAK expression may cause gingival overgrowth. In embodiments, abnormal TRAAK expression may cause neuronal dysplasia. In embodiments, abnormal TRAAK expression may cause cerebral ischemia following a stroke. In embodiments, TRAAK is activated by arachidonic acid. In embodiments, the TRAAK protein encoded by the KCNK4 gene has the amino acid sequence set forth in or corresponding to Entrez 50801, UniProt Q9NYG8, RefSeq (protein) NP_001304019.1, or RefSeq (protein) NP_201567.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0238] As used herein, the term THIK-1 refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the THIK-1 protein encoded by the KCNK13 gene has the amino acid sequence set forth in or corresponding to Entrez 56659, UniProt Q9HB14, or RefSeq (protein) NP_071337.2. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0239] As used herein, the term THIK-2 refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the THIK-2 protein encoded by the KCNK12 gene has the amino acid sequence set forth in or corresponding to Entrez 56660, UniProt Q9HB15, or RefSeq (protein) NP_071338.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0240] As used herein, the term TWIK-1 refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the TWIK-1 protein encoded by the KCNK1 gene has the amino acid sequence set forth in or corresponding to Entrez 3775, UniProt 000180, or RefSeq (protein) NP_002236.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0241] As used herein, the term TWIK-2 refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the TWIK-2 protein encoded by the KCNK6 gene has the amino acid sequence set forth in or corresponding to Entrez 9424, UniProt Q9Y257, or RefSeq (protein) NP_004814.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0242] As used herein, the term KCNK7 refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the KCNK7 protein encoded by the KCNK7 gene has the amino acid sequence set forth in or corresponding to Entrez 10089, UniProt Q9Y2U2, RefSeq (protein) NP_005705.1, RefSeq (protein) NP_203133.1, RefSeq (protein) NP_203134.1, or RefSeq (protein) NP_258416.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0243] As used herein, the term TRESK refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the TRESK protein encoded by the KCNK18 gene has the amino acid sequence set forth in or corresponding to Entrez 338567, UniProt Q7Z418, or RefSeq (protein) NP_862823.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0244] As used herein, the term TASK-i refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the TASK-1 protein encoded by the KCNK3 gene has the amino acid sequence set forth in or corresponding to Entrez 3777, UniProt 014649, or RefSeq (protein) NP_002237.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0245] As used herein, the term TASK-3 refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the TASK-3 protein encoded by the KCNK9 gene has the amino acid sequence set forth in or corresponding to Entrez 51305, UniProt Q9NPC2, or RefSeq (protein) NP_001269463.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0246] As used herein, the term TASK-5 refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the TASK-5 protein encoded by the KCNK15 gene has the amino acid sequence set forth in or corresponding to Entrez 60598, UniProt Q9H427, or RefSeq (protein) NP_071753.2. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0247] As used herein, the term TALK-i refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the TALK-1 protein encoded by the KCNK16 gene has the amino acid sequence set forth in or corresponding to Entrez 83795, UniProt Q96T55, RefSeq (protein) NP_001128577.1, RefSeq (protein) NP_001128578.1, RefSeq (protein) NP_001128579.1, or RefSeq (protein) NP_115491.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0248] As used herein, the term TALK-2 refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the TALK-2 protein encoded by the KCNK17 gene has the amino acid sequence set forth in or corresponding to Entrez 89822, UniProt Q96T54, RefSeq (protein) NP_001128583.1, or RefSeq (protein) NP_113648.2. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
[0249] As used herein, the term TASK-2 refers to a K.sub.2P channel protein (including homologs, isoforms, and functional fragments thereof). In embodiments, the TASK-2 protein encoded by the KCNK5 gene has the amino acid sequence set forth in or corresponding to Entrez 8645, UniProt 095279, or RefSeq (protein) NP_003731.1. In embodiments, the amino acid sequence sequence is the sequence known at the time of filing of the present application.
II. Compounds
[0250] In an aspect is provided a compound, or a pharmaceutically acceptable salt thereof, having the formula:
##STR00004##
[0251] L.sup.1 is a bond, substituted or unsubstituted alkylene (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2) or substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered).
[0252] R.sup.1 is hydrogen, halogen, CX.sup.1.sub.3, CHX.sup.1.sub.2, CH.sub.2X.sup.1, OCX.sup.1.sub.3, OCHX.sup.1.sub.2, OCH.sub.2X.sup.1, CN, N.sub.3, SO.sub.n1R.sup.1A, SO.sub.v1NR.sup.1BR.sup.1C, NHNR.sup.1BR.sup.1C, ONR.sup.1BR.sup.1C, NHC(O)NHNR.sup.1BR.sup.1C, NHC(O)NR.sup.1BR.sup.1C, N(O).sub.m1, NR.sup.1BR.sup.1C, C(O)R.sup.1D, C(O)OR.sup.1D, C(O)NR.sup.1BR.sup.1C, OR.sup.1A, NR.sup.1BSO.sub.2R.sup.1A, NR.sup.1BC(O)R.sup.1D, NR.sup.1BC(O)OR.sup.1D, NR.sup.1BOR.sup.1D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0253] R.sup.2 is hydrogen, halogen, CX.sup.23, CHX.sup.2.sub.2, CH.sub.2X.sup.2, OCX.sup.2.sub.3, OCHX.sup.2.sub.2, OCH.sub.2X.sup.2, CN, N.sub.3, SO.sub.n2R.sup.2A, SO.sub.v2NR.sup.2B, R.sup.2C, NHNR.sup.2B, R.sup.2C, ONR.sup.2BR.sup.2C, NHC(O)NHNR.sup.2BR.sup.2C, NHC(O)NR.sup.2BR.sup.2C, N(O).sub.m2, NR.sup.2BR.sup.2C, C(O)R.sup.2D, C(O)OR.sup.2D, C(O)NR.sup.2BR.sup.2C, OR.sup.2A, NR.sup.2BSO.sub.2R.sup.2A, NR.sup.2BC(O)R.sup.2D, NR.sup.2BC(O)OR.sup.2D, NR.sup.2BOR.sup.2D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0254] R.sup.3 is hydrogen, halogen, CX.sup.3.sub.3, CHX.sup.3.sub.2, CH.sub.2X.sup.3, OCX.sup.3.sub.3, OCHX.sup.3.sub.2, OCH.sub.2X.sup.3, CN, N.sub.3, SO.sub.n3R.sup.3A, SO.sub.v3NR.sup.3BR.sup.3C, NHNR.sup.3BR.sup.3C, ONR.sup.3BR.sup.3C, NHC(O)NHNR.sup.3BR.sup.3C, NHC(O)NR.sup.3BR.sup.3C, N(O).sub.m3, NR.sup.3BR.sup.3C, C(O)R.sup.3D, C(O)OR.sup.3D, C(O)NR.sup.3BR.sup.3C OR.sup.3A, NR.sup.3BSO.sub.2R.sup.3A, NR.sup.3BC(O)R.sup.3D, NR.sup.3BC(O)OR.sup.3D, NR.sup.3BOR.sup.3D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0255] R.sup.4 is hydrogen, halogen, CX.sup.4.sub.3, CHX.sup.4.sub.2, CH.sub.2X.sup.4, OCX.sup.4.sub.3, OCHX.sup.4.sub.2, OCH.sub.2X.sup.4, CN, N.sub.3, SO.sub.n4R.sup.4A, SO.sub.v4NR.sup.4BR.sup.4C, NHNR.sup.4BR.sup.4C, ONR.sup.4BR.sup.4C, NHC(O)NHNR.sup.4BR.sup.4C, NHC(O)NR.sup.4BR.sup.4C, N(O).sub.m4, NR.sup.4BR.sup.4C, C(O)R.sup.4D, C(O)OR.sup.4D, C(O)NR.sup.4BR.sup.4C, OR.sup.4A, NR.sup.4BSO.sub.2R.sup.4A, NR.sup.4BC(O)R.sup.4D, NR.sup.4BC(O)OR.sup.4D, NR.sup.4BOR.sup.4D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0256] R.sup.5 is hydrogen, halogen, CX.sup.5.sub.3, CHX.sup.5.sub.2, CH.sub.2X.sup.5, OCX.sup.5.sub.3, OCHX.sup.5.sub.2, OCH.sub.2X.sup.5, CN, N.sub.3, SO.sub.n5R.sup.5A, SO.sub.v5NR.sup.5BR.sup.5C, NHNR.sup.5BR.sup.5C, ONR.sup.5BR.sup.5C, NHC(O)NHNR.sup.5BR.sup.5C, NHC(O)NR.sup.5BR.sup.5C, N(O).sub.m5, NR.sup.5BR.sup.5C, C(O)R.sup.5D, C(O)OR.sup.5D, C(O)NR.sup.5BR.sup.5C, OR.sup.5A, NR.sup.5BSO.sub.2R.sup.5A, NR.sup.5BC(O)R.sup.5D, NR.sup.5BC(O)OR.sup.5D, NR.sup.5BOR.sup.5D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0257] R.sup.6 is hydrogen, a substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), or substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered); wherein R.sup.6 is optionally joined with L.sup.1 to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered); or wherein R.sup.6 is optionally joined with R.sup.7 to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0258] R.sup.7 is independently halogen, CX.sup.7.sub.3, CHX.sup.7.sub.2, CH.sub.2X.sup.7, OCX.sup.7.sub.3, OCHX.sup.7.sub.2, OCH.sub.2X.sup.7, CN, N.sub.3, SO.sub.n7R.sup.7A, SO.sub.v7NR.sup.7BR.sup.7C, NHNR.sup.7BR.sup.7C, ONR.sup.7BR.sup.7C, NHC(O)NHNR.sup.7BR.sup.7C, NHC(O)NR.sup.7BR.sup.7C, N(O).sub.m7, NR.sup.7BR.sup.7C, C(O)R.sup.7D, C(O)OR.sup.7D, C(O)NR.sup.7BR.sup.7C, OR.sup.7A, NR.sup.7BSO.sub.2R.sup.7A, NR.sup.7BC(O)R.sup.7D, NR.sup.7BC(O)OR.sup.7D, NR.sup.7BOR.sup.7D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); two R.sup.7 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0259] R.sup.8 is a cysteine binding moiety or a serine binding moiety.
[0260] R.sup.1A, R.sup.1B, Ric, R.sup.1D, R.sup.2A, R.sup.2B, R.sup.2C, R.sup.2D, R.sup.3A, R.sup.3B, R.sup.3C, R.sup.3D, R.sup.4A, R.sup.4B, R.sup.4C, R.sup.4D, R.sup.5A, R.sup.5B, R.sup.5C, R.sup.5D, R.sup.7A, R.sup.7B, R.sup.7C, and R.sup.7D are independently hydrogen, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, OCCl.sub.3, OCBr.sub.3, OCF.sub.3, OCI.sub.3, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2F, OCH.sub.2I, OCHCl.sub.2, OCHBr.sub.2, OCHF.sub.2, OCHI.sub.2, N.sub.3, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.1A and R.sup.1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.2A and R.sup.2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.3A and R.sup.3B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.4A and R.sup.4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.5A and R.sup.5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); and R.sup.7A and R.sup.7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0261] X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, and X.sup.7 are independently F, Cl, Br, or I.
[0262] The symbols n1, n2, n3, n4, n4, and n7 are independently an integer from 0 to 4.
[0263] The symbols m1, m2, m3, m4, m5, m7, v1, v2, v3, v4, v5, and v7 are independently 1 or 2.
[0264] The symbol n is an integer from 0 to 3.
[0265] In an aspect is provided a compound, or a pharmaceutically acceptable salt thereof, having the formula:
##STR00005##
L.sup.1 is a bond, substituted or unsubstituted alkylene or substituted or unsubstituted heteroalkylene. R.sup.1 is independently is hydrogen, halogen, CX.sup.1.sub.3, CHX.sup.1.sub.2, CH.sub.2X.sup.1, OCX.sup.1.sub.3, OCHX.sup.1.sub.2, OCH.sub.2X.sup.1, CN, N.sub.3, SO.sub.v1R.sup.1ASO.sub.v1NR.sup.1BR.sup.1C, NHNR.sup.1BR.sup.1C, ONR.sup.1BR.sup.1C, NHC(O)NHNR.sup.1BR.sup.1C, NHC(O)NR.sup.1BR.sup.1C, N(O).sub.m1, NR.sup.1BR.sup.1C, C(O)R.sup.1D, C(O)OR.sup.1D, C(O)NR.sup.1BR.sup.1C, OR.sup.1A, NR.sup.1BSO.sub.2R.sup.1A, NR.sup.1BC(O)R.sup.1D, NR.sup.1BC(O)OR.sup.1D, NR.sup.1BOR.sup.1D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); two R.sup.1 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). R.sup.2 is independently hydrogen, halogen, CX.sup.2.sub.3, CHX.sup.2.sub.2, CH.sub.2X.sup.2, OCX.sup.2.sub.3, OCHX.sup.2.sub.2, OCH.sub.2X.sup.2, CN, N.sub.3, SO.sub.n2R.sup.2A, SO.sub.v2NR.sup.2BR.sup.2C, NHNR.sup.2BR.sup.2C, ONR.sup.2BR.sup.2C, NHC(O)NHNR.sup.2BR.sup.2C, NHC(O)NR.sup.2BR.sup.2C, N(O).sub.m2, NR.sup.2BR.sup.2C, C(O)R.sup.2D, C(O)OR.sup.2D, C(O)NR.sup.2BR.sup.2C, OR.sup.2A, NR.sup.2BSO.sub.2R.sup.2A, NR.sup.2BC(O)R.sup.2D, NR.sup.2BC(O)OR.sup.2D, NR.sup.2BOR.sup.2D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); two R.sup.2 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). R.sup.3 is independently hydrogen, halogen, CX.sup.3.sub.3, CHX.sup.3.sub.2, CH.sub.2X.sup.3, OCX.sup.3.sub.3, OCHX.sup.3.sub.2, OCH.sub.2X.sup.3, CN, N.sub.3, SO.sub.n3R.sup.3A, SO.sub.v3NR.sup.3BR.sup.3C, NHNR.sup.3BR.sup.3C, ONR.sup.3BR.sup.3C, NHC(O)NHNR.sup.3BR.sup.3C, NHC(O)NR.sup.3BR.sup.3C, N(O).sub.m3, NR.sup.3BR.sup.3C, C(O)R.sup.3D, C(O)OR.sup.3D, C(O)NR.sup.3BR.sup.3C, OR.sup.3A, NR.sup.3BSO.sub.2R.sup.3A, NR.sup.3BC(O)R.sup.3D, NR.sup.3BC(O)OR.sup.3D, NR.sup.3BOR.sup.3D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); two R.sup.3 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). R.sup.4 is independently hydrogen, halogen, CX.sup.4.sub.3, CHX.sup.4.sub.2, CH.sub.2X.sup.4, OCX.sup.4.sub.3, OCHX.sup.4.sub.2, OCH.sub.2X.sup.4, CN, N.sub.3, SO.sub.n4R.sup.4A, SO.sub.v4NR.sup.4BR.sup.4C, NHNR.sup.4BR.sup.4C, ONR.sup.4BR.sup.4C, NHC(O)NHNR.sup.4BR.sup.4C, NHC(O)NR.sup.4BR.sup.4C, N(O).sub.m4, NR.sup.4BR.sup.4C, C(O)R.sup.4D, C(O)OR.sup.4D, C(O)NR.sup.4BR.sup.4C, OR.sup.4A, NR.sup.4BSO.sub.2R.sup.4A, NR.sup.4BC(O)R.sup.4D, NR.sup.4BC(O)OR.sup.4D, NR.sup.4BOR.sup.4D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); two R.sup.4 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). R.sup.5 is independently hydrogen, halogen, CX.sup.5.sub.3, CHX.sup.5.sub.2, CH.sub.2X.sup.5, OCX.sup.5.sub.3, OCHX.sup.5.sub.2, OCH.sub.2X.sup.5, CN, N.sub.3, SO.sub.n5R.sup.5A, SO.sub.v5NR.sup.5BR.sup.5C, NHNR.sup.5BR.sup.5C, ONR.sup.5BR.sup.5C, NHC(O)NHNR.sup.5BR.sup.5C, NHC(O)NR.sup.5BR.sup.5C, N(O).sub.m5, NR.sup.5BR.sup.5C, C(O)R.sup.5D, C(O)OR.sup.5D, C(O)NR.sup.5BR.sup.5C, OR.sup.5A, NR.sup.5BSO.sub.2R.sup.5A, NR.sup.5BC(O)R.sup.5D, NR.sup.5BC(O)OR.sup.5D, NR.sup.5BOR.sup.5D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); two R.sup.5 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). R.sup.6 is independently a substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), or substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered); wherein R.sup.6 is optionally joined with L.sup.1 to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered). R.sup.7 is independently halogen, CX.sup.7.sub.3, CHX.sup.7.sub.2, CH.sub.2X.sup.7, OCX.sup.7.sub.3, OCHX.sup.7.sub.2, OCH.sub.2X.sup.7, CN, N.sub.3, SO.sub.n7R.sup.7A, SO.sub.v7NR.sup.7BR.sup.7C, NHNR.sup.7BR.sup.7C, ONR.sup.7BR.sup.7C, NHC(O)NHNR.sup.7BR.sup.7C, NHC(O)NR.sup.7BR.sup.7C, N(O).sub.m7, NR.sup.7BR.sup.7C, C(O)R.sup.7D, C(O)OR.sup.7D, C(O)NR.sup.7BR.sup.7C, OR.sup.7A, NR.sup.7BSO.sub.2R.sup.7A, NR.sup.7BC(O)R.sup.7D, NR.sup.7BC(O)OR.sup.7D, NR.sup.7BOR.sup.7D, SF.sub.5, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); two R.sup.7 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). R.sup.8 is a cysteine binding moiety or a serine binding moiety. R.sup.1A, R.sup.1B, R.sup.1C, R.sup.1D, R.sup.2A, R.sup.2B, R.sup.2C, R.sup.2D, R.sup.3A, R.sup.3B, R.sup.3C, R.sup.3D, R.sup.4A, R.sup.4B, R.sup.4C, R.sup.4D, R.sup.5A, R.sup.5B, R.sup.5C, R.sup.5D, R.sup.7A, R.sup.7B, R.sup.7C, and R.sup.7D are independently hydrogen, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CN, OH, NH.sub.2, COOH, CONH.sub.2, NO.sub.2, SH, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, OCCl.sub.3, OCBr.sub.3, OCF.sub.3, OCI.sub.3, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2F, OCH.sub.2I, OCHCl.sub.2, OCHBr.sub.2, OCHF.sub.2, OCHI.sub.2, N.sub.3, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.1A and R.sup.1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.1A and R.sup.1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.2A, and R.sup.2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.3A and R.sup.3B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.4A and R.sup.4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.5A and R.sup.5B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); and R.sup.7A and R.sup.7B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, and X.sup.7 are independently F, Cl, Br, or I. The symbols n1, n2, n3, n4, n4, and n7 are an integer from 0 to 4. The symbols m1, m2, m3, m4, m5, m7, v1, v2, v3, v4, v5, and v7 are independently 1 or 2. The symbol n is an integer from 0 to 3.
[0266] In embodiments, a substituted L.sup.1(e.g., substituted alkylene or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L.sup.1 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L.sup.1 is substituted, it is substituted with at least one substituent group. In embodiments, when L.sup.1 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L.sup.1 is substituted, it is substituted with at least one lower substituent group.
[0267] In embodiments, L.sup.1 is a bond, substituted or unsubstituted C.sub.1-C.sub.6 alkylene, or substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L.sup.1 is a bond. In embodiments, L.sup.1 is substituted or unsubstituted C.sub.1-C.sub.6 alkylene. In embodiments, L.sup.1 is substituted or unsubstituted 2 to 6 membered heteroalkylene.
[0268] In embodiments, L.sup.1 is unsubstituted C.sub.1-C.sub.6 alkylene. In embodiments, L.sup.1 is unsubstituted methylene. In embodiments, L.sup.1 is unsubstituted ethylene. In embodiments, L.sup.1 is unsubstituted propylene. In embodiments, L.sup.1 is unsubstituted n-propylene. In embodiments, L.sup.1 is unsubstituted isopropylene. In embodiments, L.sup.1 is unsubstituted butylene. In embodiments, L.sup.1 is unsubstituted n-butylene. In embodiments, L.sup.1 is unsubstituted isobutylene. In embodiments, L.sup.1 is unsubstituted tert-butylene.
[0269] In embodiments, a substituted R.sup.1 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.1 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.1 is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.1 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.1 is substituted, it is substituted with at least one lower substituent group.
[0270] In embodiments, a substituted R.sup.1A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.1A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.1A is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.1A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.1A is substituted, it is substituted with at least one lower substituent group.
[0271] In embodiments, a substituted R.sup.1B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.1B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.1B is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.1B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.1B is substituted, it is substituted with at least one lower substituent group.
[0272] In embodiments, a substituted ring formed when R.sup.1A and R.sup.1B substituents bonded to the same nitrogen atom are joined (e.g., substituted heterocycloalkyl and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.1A and R.sup.1B substituents bonded to the same nitrogen atom are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.1A and R.sup.1B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.1A and R.sup.1B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.1A and R.sup.1B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one lower substituent group.
[0273] In embodiments, a substituted R.sup.1C (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.1C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.1C is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.1C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.1C is substituted, it is substituted with at least one lower substituent group.
[0274] In embodiments, a substituted R.sup.1D (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.1D is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.1D is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.1D is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.1D is substituted, it is substituted with at least one lower substituent group.
[0275] In embodiments, R.sup.1 is independently halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0276] In embodiments, R.sup.1 is independently hydrogen or halogen. In embodiments, R.sup.1 is independently hydrogen. In embodiments, R.sup.1 is independently halogen. In embodiments, R.sup.1 is independently F. In embodiments, R.sup.1 is independently Cl. In embodiments, R.sup.1 is independently Br. In embodiments, R.sup.1 is independently I. In embodiments, R.sup.1 is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.1 is unsubstituted methyl. In embodiments, R.sup.1 is unsubstituted ethyl. In embodiments, R.sup.1 is unsubstituted propyl. In embodiments, R.sup.1 is unsubstituted n-propyl. In embodiments, R.sup.1 is unsubstituted isopropyl. In embodiments, R.sup.1 is unsubstituted butyl. In embodiments, R.sup.1 is unsubstituted n-butyl. In embodiments, R.sup.1 is unsubstituted isobutyl. In embodiments, R.sup.1 is unsubstituted tert-butyl.
[0277] In embodiments, R.sup.1A is hydrogen. In embodiments, R.sup.1A is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.1A is unsubstituted methyl. In embodiments, R.sup.1A is unsubstituted ethyl. In embodiments, R.sup.1A is unsubstituted propyl. In embodiments, R.sup.1A is unsubstituted n-propyl. In embodiments, R.sup.1A is unsubstituted isopropyl. In embodiments, R.sup.1A is unsubstituted butyl. In embodiments, R.sup.1A is unsubstituted n-butyl. In embodiments, R.sup.1A is unsubstituted isobutyl. In embodiments, R.sup.1A is unsubstituted tert-butyl.
[0278] In embodiments, R.sup.1B is hydrogen. In embodiments, R.sup.1B is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.1B is unsubstituted methyl. In embodiments, R.sup.1B is unsubstituted ethyl. In embodiments, R.sup.1B is unsubstituted propyl. In embodiments, R.sup.1B is unsubstituted n-propyl. In embodiments, R.sup.1B is unsubstituted isopropyl. In embodiments, R.sup.1B is unsubstituted butyl. In embodiments, R.sup.1B is unsubstituted n-butyl. In embodiments, R.sup.1B is unsubstituted isobutyl. In embodiments, R.sup.1B is unsubstituted tert-butyl.
[0279] In embodiments, R.sup.1C is hydrogen. In embodiments, R.sup.1C is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.1C is unsubstituted methyl. In embodiments, R.sup.1C is unsubstituted ethyl. In embodiments, R.sup.1C is unsubstituted propyl. In embodiments, R.sup.1C is unsubstituted n-propyl. In embodiments, R.sup.1C is unsubstituted isopropyl. In embodiments, R.sup.1C is unsubstituted butyl. In embodiments, R.sup.1C is unsubstituted n-butyl. In embodiments, R.sup.1C is unsubstituted isobutyl. In embodiments, R.sup.1C is unsubstituted tert-butyl.
[0280] In embodiments, R.sup.1D is hydrogen. In embodiments, R.sup.1D is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.1D is unsubstituted methyl. In embodiments, R.sup.1D is unsubstituted ethyl. In embodiments, R.sup.1D is unsubstituted propyl. In embodiments, R.sup.1D is unsubstituted n-propyl. In embodiments, R.sup.1D is unsubstituted isopropyl. In embodiments, R.sup.1D is unsubstituted butyl. In embodiments, R.sup.1D is unsubstituted n-butyl. In embodiments, R.sup.1D is unsubstituted isobutyl. In embodiments, R.sup.1D is unsubstituted tert-butyl.
[0281] In embodiments, a substituted R.sup.2 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.2 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.2 is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.2 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.2 is substituted, it is substituted with at least one lower substituent group.
[0282] In embodiments, a substituted R.sup.2A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.2A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.2A is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.2A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.2A is substituted, it is substituted with at least one lower substituent group.
[0283] In embodiments, a substituted R.sup.2B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.2B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.2B is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.2B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.2B is substituted, it is substituted with at least one lower substituent group.
[0284] In embodiments, a substituted ring formed when R.sup.2A and R.sup.2B substituents bonded to the same nitrogen atom are joined (e.g., substituted heterocycloalkyl and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.2A and R.sup.2B substituents bonded to the same nitrogen atom are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.2A and R.sup.2B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.2A and R.sup.2B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.2A and R.sup.2B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one lower substituent group.
[0285] In embodiments, a substituted R.sup.2C (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.2C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.2C is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.2C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.2C is substituted, it is substituted with at least one lower substituent group.
[0286] In embodiments, a substituted R.sup.2D (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.2D is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.2D is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.2D is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.2D is substituted, it is substituted with at least one lower substituent group.
[0287] In embodiments, R.sup.2 is independently oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0288] In embodiments, R.sup.2 is independently halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0289] In embodiments, R.sup.2 is independently hydrogen or halogen. In embodiments, R.sup.2 is independently hydrogen. In embodiments, R.sup.2 is independently halogen. In embodiments, R.sup.2 is independently F. In embodiments, R.sup.2 is independently Cl. In embodiments, R.sup.2 is independently Br. In embodiments, R.sup.2 is independently I. In embodiments, R.sup.2 is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.2 is unsubstituted methyl. In embodiments, R.sup.2 is unsubstituted ethyl. In embodiments, R.sup.2 is unsubstituted propyl. In embodiments, R.sup.2 is unsubstituted n-propyl. In embodiments, R.sup.2 is unsubstituted isopropyl. In embodiments, R.sup.2 is unsubstituted butyl. In embodiments, R.sup.2 is unsubstituted n-butyl. In embodiments, R.sup.2 is unsubstituted isobutyl. In embodiments, R.sup.2 is unsubstituted tert-butyl.
[0290] In embodiments, R.sup.2A is hydrogen. In embodiments, R.sup.2A is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.2A is unsubstituted methyl. In embodiments, R.sup.2A is unsubstituted ethyl. In embodiments, R.sup.2A is unsubstituted propyl. In embodiments, R.sup.2A is unsubstituted n-propyl. In embodiments, R.sup.2A is unsubstituted isopropyl. In embodiments, R.sup.2A is unsubstituted butyl. In embodiments, R.sup.2A is unsubstituted n-butyl. In embodiments, R.sup.2A is unsubstituted isobutyl. In embodiments, R.sup.2A is unsubstituted tert-butyl.
[0291] In embodiments, R.sup.2B is hydrogen. In embodiments, R.sup.2B is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.2B is unsubstituted methyl. In embodiments, R.sup.2B is unsubstituted ethyl. In embodiments, R.sup.2B is unsubstituted propyl. In embodiments, R.sup.2B is unsubstituted n-propyl. In embodiments, R.sup.2B is unsubstituted isopropyl. In embodiments, R.sup.2B is unsubstituted butyl. In embodiments, R.sup.2B is unsubstituted n-butyl. In embodiments, R.sup.2B is unsubstituted isobutyl. In embodiments, R.sup.2B is unsubstituted tert-butyl.
[0292] In embodiments, R.sup.2C is hydrogen. In embodiments, R.sup.2C is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.2C is unsubstituted methyl. In embodiments, R.sup.2C is unsubstituted ethyl. In embodiments, R.sup.2C is unsubstituted propyl. In embodiments, R.sup.2C is unsubstituted n-propyl. In embodiments, R.sup.2C is unsubstituted isopropyl. In embodiments, R.sup.2C is unsubstituted butyl. In embodiments, R.sup.2C is unsubstituted n-butyl. In embodiments, R.sup.2C is unsubstituted isobutyl. In embodiments, R.sup.2C is unsubstituted tert-butyl.
[0293] In embodiments, R.sup.2D is hydrogen. In embodiments, R.sup.2D is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.2D is unsubstituted methyl. In embodiments, R.sup.2D is unsubstituted ethyl. In embodiments, R.sup.2D is unsubstituted propyl. In embodiments, R.sup.2D is unsubstituted n-propyl. In embodiments, R.sup.2D is unsubstituted isopropyl. In embodiments, R.sup.2D is unsubstituted butyl. In embodiments, R.sup.2D is unsubstituted n-butyl. In embodiments, R.sup.2D is unsubstituted isobutyl. In embodiments, R.sup.2D is unsubstituted tert-butyl.
[0294] In embodiments, a substituted R.sup.3 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.3 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.3 is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.3 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.3 is substituted, it is substituted with at least one lower substituent group.
[0295] In embodiments, a substituted R.sup.3A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.3A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.3A is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.3A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.3A is substituted, it is substituted with at least one lower substituent group.
[0296] In embodiments, a substituted R.sup.3B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.3B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.3B is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.3B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.3B is substituted, it is substituted with at least one lower substituent group.
[0297] In embodiments, a substituted ring formed when R.sup.3A and R.sup.3B substituents bonded to the same nitrogen atom are joined (e.g., substituted heterocycloalkyl and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.3A and R.sup.3B substituents bonded to the same nitrogen atom are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.3A and R.sup.3B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.3A, and R.sup.3B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.3A and R.sup.3B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one lower substituent group.
[0298] In embodiments, a substituted R.sup.3C (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.3C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.3C is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.3C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.3C is substituted, it is substituted with at least one lower substituent group.
[0299] In embodiments, a substituted R.sup.3D (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.3D is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.3D is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.3D is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.3D is substituted, it is substituted with at least one lower substituent group.
[0300] In embodiments, R.sup.3 is independently oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0301] In embodiments, R.sup.3 is independently halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0302] In embodiments, R.sup.3 is independently halogen or substituted or unsubstituted C.sub.1-C.sub.4 alkynyl. In embodiments, R.sup.3 is independently halogen. In embodiments, R.sup.3 is independently F. In embodiments, R.sup.3 is independently Cl. In embodiments, R.sup.3 is independently Br. In embodiments, R.sup.3 is independently I. In embodiments, R.sup.3 is independently substituted or unsubstituted C.sub.1-C.sub.4 alkynyl. In embodiments, R.sup.3 is unsubstituted methyne (e.g., methynyl).
[0303] In embodiments, R.sup.3 is unsubstituted ethyne (e.g., ethynyl). In embodiments, R.sup.3 is unsubstituted propyne (e.g., propynyl). In embodiments, R.sup.3 is unsubstituted n-propyne (e.g., n-propynyl). In embodiments, R.sup.3 is unsubstituted isopropyne (e.g., isopropynyl). In embodiments, R.sup.3 is unsubstituted butyne (e.g., butynyl). In embodiments, R.sup.3 is unsubstituted n-butyne (e.g., n-butynyl). In embodiments, R.sup.3 is unsubstituted isobutyne (e.g., isobutynyl).
[0304] In embodiments, R.sup.3 is unsubstituted tert-butyne (e.g., tert-butynyl). In embodiments, R.sup.3 is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.3 is unsubstituted methyl. In embodiments, R.sup.3 is unsubstituted ethyl. In embodiments, R.sup.3 is unsubstituted propyl. In embodiments, R.sup.3 is unsubstituted n-propyl. In embodiments, R.sup.3 is unsubstituted isopropyl. In embodiments, R.sup.3 is unsubstituted butyl. In embodiments, R.sup.3 is unsubstituted n-butyl. In embodiments, R.sup.3 is unsubstituted isobutyl. In embodiments, R.sup.3 is unsubstituted tert-butyl.
[0305] In embodiments, R.sup.3A is hydrogen. In embodiments, R.sup.3A is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.3A is unsubstituted methyl. In embodiments, R.sup.3A is unsubstituted ethyl. In embodiments, R.sup.3A is unsubstituted propyl. In embodiments, R.sup.3A is unsubstituted n-propyl. In embodiments, R.sup.3A is unsubstituted isopropyl. In embodiments, R.sup.3A is unsubstituted butyl. In embodiments, R.sup.3A is unsubstituted n-butyl. In embodiments, R.sup.3A is unsubstituted isobutyl. In embodiments, R.sup.3A is unsubstituted tert-butyl.
[0306] In embodiments, R.sup.3B is hydrogen. In embodiments, R.sup.3B is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.3B is unsubstituted methyl. In embodiments, R.sup.3B is unsubstituted ethyl. In embodiments, R.sup.3B is unsubstituted propyl. In embodiments, R.sup.3B is unsubstituted n-propyl. In embodiments, R.sup.3B is unsubstituted isopropyl. In embodiments, R.sup.3B is unsubstituted butyl. In embodiments, R.sup.3B is unsubstituted n-butyl. In embodiments, R.sup.3B is unsubstituted isobutyl. In embodiments, R.sup.3B is unsubstituted tert-butyl.
[0307] In embodiments, R.sup.3C is hydrogen. In embodiments, R.sup.3C is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.3C is unsubstituted methyl. In embodiments, R.sup.3C is unsubstituted ethyl. In embodiments, R.sup.3C is unsubstituted propyl. In embodiments, R.sup.3C is unsubstituted n-propyl. In embodiments, R.sup.3C is unsubstituted isopropyl. In embodiments, R.sup.3C is unsubstituted butyl. In embodiments, R.sup.3C is unsubstituted n-butyl. In embodiments, R.sup.3C is unsubstituted isobutyl. In embodiments, R.sup.3C is unsubstituted tert-butyl.
[0308] In embodiments, R.sup.3D is hydrogen. In embodiments, R.sup.3D is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.3D is unsubstituted methyl. In embodiments, R.sup.3D is unsubstituted ethyl. In embodiments, R.sup.3D is unsubstituted propyl. In embodiments, R.sup.3D is unsubstituted n-propyl. In embodiments, R.sup.3D is unsubstituted isopropyl. In embodiments, R.sup.3D is unsubstituted butyl. In embodiments, R.sup.3D is unsubstituted n-butyl. In embodiments, R.sup.3D is unsubstituted isobutyl. In embodiments, R.sup.3D is unsubstituted tert-butyl.
[0309] In embodiments, a substituted R.sup.4 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.4 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.4 is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.4 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.4 is substituted, it is substituted with at least one lower substituent group.
[0310] In embodiments, a substituted R.sup.4A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.4A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.4A is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.4A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.4A is substituted, it is substituted with at least one lower substituent group.
[0311] In embodiments, a substituted R.sup.4B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.4B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.4B is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.4B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.4B is substituted, it is substituted with at least one lower substituent group.
[0312] In embodiments, a substituted ring formed when R.sup.4A and R.sup.4B substituents bonded to the same nitrogen atom are joined (e.g., substituted heterocycloalkyl and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.4A and R.sup.4B substituents bonded to the same nitrogen atom are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.4A and R.sup.4B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.4A, and R.sup.4B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.4A and R.sup.4B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one lower substituent group.
[0313] In embodiments, a substituted R.sup.4C (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.4C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.4C is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.4C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.4C is substituted, it is substituted with at least one lower substituent group.
[0314] In embodiments, a substituted R.sup.4D, (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.4D is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.4D is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.4D, is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.4D, is substituted, it is substituted with at least one lower substituent group.
[0315] In embodiments, R.sup.4 is independently oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0316] In embodiments, R.sup.4 is independently halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0317] In embodiments, R.sup.4 is hydrogen. In embodiments, R.sup.4 is halogen. In embodiments, R.sup.4 is F. In embodiments, R.sup.4 is Cl. In embodiments, R.sup.4 is Br. In embodiments, R.sup.4 is I.
[0318] In embodiments, R.sup.4 is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.4 is unsubstituted methyl. In embodiments, R.sup.4 is unsubstituted ethyl. In embodiments, R.sup.4 is unsubstituted propyl. In embodiments, R.sup.4 is unsubstituted n-propyl. In embodiments, R.sup.4 is unsubstituted isopropyl. In embodiments, R.sup.4 is unsubstituted butyl. In embodiments, R.sup.4 is unsubstituted n-butyl. In embodiments, R.sup.4 is unsubstituted isobutyl. In embodiments, R.sup.4 is unsubstituted tert-butyl.
[0319] In embodiments, R.sup.4A is hydrogen. In embodiments, R.sup.4A is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.4A is unsubstituted methyl. In embodiments, R.sup.4A is unsubstituted ethyl. In embodiments, R.sup.4A is unsubstituted propyl. In embodiments, R.sup.4A is unsubstituted n-propyl. In embodiments, R.sup.4A is unsubstituted isopropyl. In embodiments, R.sup.4A is unsubstituted butyl. In embodiments, R.sup.4A is unsubstituted n-butyl. In embodiments, R.sup.4A is unsubstituted isobutyl. In embodiments, R.sup.4A is unsubstituted tert-butyl.
[0320] In embodiments, R.sup.4B is hydrogen. In embodiments, R.sup.4B is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.4B is unsubstituted methyl. In embodiments, R.sup.4B is unsubstituted ethyl. In embodiments, R.sup.4B is unsubstituted propyl. In embodiments, R.sup.4B is unsubstituted n-propyl. In embodiments, R.sup.4B is unsubstituted isopropyl. In embodiments, R.sup.4B is unsubstituted butyl. In embodiments, R.sup.4B is unsubstituted n-butyl. In embodiments, R.sup.4B is unsubstituted isobutyl. In embodiments, R.sup.4B is unsubstituted tert-butyl.
[0321] In embodiments, R.sup.4C is hydrogen. In embodiments, R.sup.4C is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.4C is unsubstituted methyl. In embodiments, R.sup.4C is unsubstituted ethyl. In embodiments, R.sup.4C is unsubstituted propyl. In embodiments, R.sup.4C is unsubstituted n-propyl. In embodiments, R.sup.4C is unsubstituted isopropyl. In embodiments, R.sup.4C is unsubstituted butyl. In embodiments, R.sup.4C is unsubstituted n-butyl. In embodiments, R.sup.4C is unsubstituted isobutyl. In embodiments, R.sup.4C is unsubstituted tert-butyl.
[0322] In embodiments, R.sup.4D is hydrogen. In embodiments, R.sup.4D, is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.4D, is unsubstituted methyl. In embodiments, R.sup.4D, is unsubstituted ethyl. In embodiments, R.sup.4D, is unsubstituted propyl. In embodiments, R.sup.4D, is unsubstituted n-propyl. In embodiments, R.sup.4D, is unsubstituted isopropyl. In embodiments, R.sup.4D, is unsubstituted butyl. In embodiments, R.sup.4D, is unsubstituted n-butyl. In embodiments, R.sup.4D, is unsubstituted isobutyl. In embodiments, R.sup.4D, is unsubstituted tert-butyl.
[0323] In embodiments, a substituted R.sup.5 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.5 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.S is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.S is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.S is substituted, it is substituted with at least one lower substituent group.
[0324] In embodiments, a substituted R.sup.5A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.5A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.5A is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.5A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.5A is substituted, it is substituted with at least one lower substituent group.
[0325] In embodiments, a substituted R.sup.5B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.5B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.5B is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.5B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.5B is substituted, it is substituted with at least one lower substituent group.
[0326] In embodiments, a substituted ring formed when R.sup.5A and R.sup.5B substituents bonded to the same nitrogen atom are joined (e.g., substituted heterocycloalkyl and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.5A and R.sup.5B substituents bonded to the same nitrogen atom are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.5A and R.sup.5B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.5A and R.sup.5B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.5A and R.sup.5B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one lower substituent group.
[0327] In embodiments, a substituted R.sup.5C (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.5C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.5C is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.5C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.5C is substituted, it is substituted with at least one lower substituent group.
[0328] In embodiments, a substituted R.sup.5D (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.5D is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.5D is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.5D is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.5D is substituted, it is substituted with at least one lower substituent group.
[0329] In embodiments, R.sup.5 is independently oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0330] In embodiments, R.sup.5 is independently halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0331] In embodiments, R.sup.5 is hydrogen. In embodiments, R.sup.5 is halogen. In embodiments, R.sup.5 is F. In embodiments, R.sup.5 is Cl. In embodiments, R.sup.5 is Br. In embodiments, R.sup.5 is I.
[0332] In embodiments, R.sup.5 is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.5 is unsubstituted methyl. In embodiments, R.sup.5 is unsubstituted ethyl. In embodiments, R.sup.5 is unsubstituted propyl. In embodiments, R.sup.5 is unsubstituted n-propyl. In embodiments, R.sup.5 is unsubstituted isopropyl. In embodiments, R.sup.5 is unsubstituted butyl. In embodiments, R.sup.5 is unsubstituted n-butyl. In embodiments, R.sup.5 is unsubstituted isobutyl. In embodiments, R.sup.5 is unsubstituted tert-butyl.
[0333] In embodiments, R.sup.5A is hydrogen. In embodiments, R.sup.5A is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.5A is unsubstituted methyl. In embodiments, R.sup.5A is unsubstituted ethyl. In embodiments, R.sup.5A is unsubstituted propyl. In embodiments, R.sup.5A is unsubstituted n-propyl. In embodiments, R.sup.5A is unsubstituted isopropyl. In embodiments, R.sup.5A is unsubstituted butyl. In embodiments, R.sup.5A is unsubstituted n-butyl. In embodiments, R.sup.5A is unsubstituted isobutyl. In embodiments, R.sup.5A is unsubstituted tert-butyl.
[0334] In embodiments, R.sup.5B is hydrogen. In embodiments, R.sup.5B is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.5B is unsubstituted methyl. In embodiments, R.sup.5B is unsubstituted ethyl. In embodiments, R.sup.5B is unsubstituted propyl. In embodiments, R.sup.5B is unsubstituted n-propyl. In embodiments, R.sup.5B is unsubstituted isopropyl. In embodiments, R.sup.5B is unsubstituted butyl. In embodiments, R.sup.5B is unsubstituted n-butyl. In embodiments, R.sup.5B is unsubstituted isobutyl. In embodiments, R.sup.5B is unsubstituted tert-butyl.
[0335] In embodiments, R.sup.5C is hydrogen. In embodiments, R.sup.5C is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.5C is unsubstituted methyl. In embodiments, R.sup.5C is unsubstituted ethyl. In embodiments, R.sup.5C is unsubstituted propyl. In embodiments, R.sup.5C is unsubstituted n-propyl. In embodiments, R.sup.5C is unsubstituted isopropyl. In embodiments, R.sup.5C is unsubstituted butyl. In embodiments, R.sup.5C is unsubstituted n-butyl. In embodiments, R.sup.5C is unsubstituted isobutyl. In embodiments, R.sup.5C is unsubstituted tert-butyl.
[0336] In embodiments, R.sup.5D is hydrogen. In embodiments, R.sup.5D is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.5D is unsubstituted methyl. In embodiments, R.sup.5D is unsubstituted ethyl. In embodiments, R.sup.5D is unsubstituted propyl. In embodiments, R.sup.5D is unsubstituted n-propyl. In embodiments, R.sup.5D is unsubstituted isopropyl. In embodiments, R.sup.5D is unsubstituted butyl. In embodiments, R.sup.5D is unsubstituted n-butyl. In embodiments, R.sup.5D is unsubstituted isobutyl. In embodiments, R.sup.5D is unsubstituted tert-butyl.
[0337] In embodiments, a substituted R.sup.6 (e.g., substituted alkyl and/or substituted heteroalkyl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.6 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.6 is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.6 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.6 is substituted, it is substituted with at least one lower substituent group.
[0338] In embodiments, a substituted ring formed when R.sup.6 and L.sup.1 substituents are joined (e.g., substituted heterocycloalkyl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.6 and L.sup.1 substituents are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.6 and L.sup.1 substituents are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.6 and L.sup.1 substituents are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.6 and L.sup.1 substituents are joined is substituted, it is substituted with at least one lower substituent group.
[0339] In embodiments, a substituted ring formed when R.sup.6 and R.sup.7 substituents are joined (e.g., substituted heterocycloalkyl and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.6 and R.sup.7 substituents are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.6 and R.sup.7 substituents are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.6 and R.sup.7 substituents are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.6 and R.sup.7 substituents are joined is substituted, it is substituted with at least one lower substituent group.
[0340] In embodiments, R.sup.6 is independently hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl or R.sup.6 and L.sup.1 are joined together to form a substituted or unsubstituted 5 to 7 membered heterocycloalkyl.
[0341] In embodiments, R.sup.6 is independently hydrogen. In embodiments, R.sup.6 is unsubstituted methyl. In embodiments, R.sup.6 is unsubstituted ethyl. In embodiments, R.sup.6 is unsubstituted propyl. In embodiments, R.sup.6 is unsubstituted n-propyl. In embodiments, R.sup.6 is unsubstituted isopropyl. In embodiments, R.sup.6 is unsubstituted butyl. In embodiments, R.sup.6 is unsubstituted n-butyl. In embodiments, R.sup.6 is unsubstituted isobutyl. In embodiments, R.sup.6 is unsubstituted tert-butyl. In embodiments, R.sup.6 and L.sup.1 are joined together to form a substituted or unsubstituted 5 to 7 membered heterocycloalkyl. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted pyrrolidine. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted pyrazolidine. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted imidazolidine. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted tetrahydrofuran. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted 1,3-dioxolane. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted tetrahydrothiophene. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted sulfolane. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted 2,4-thiazolidinedione. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted succinimide. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted 2-oxazolidone. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted hydantoin. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted piperidine. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted piperazine. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted tetrahydropyran. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted thiane. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted dithiane. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted trithiane.
[0342] In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted morpholine. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted thiomorpholine. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted dioxine. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted thiomorpholine dioxide.
[0343] In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted oxepane. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted azepane. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted thiopane. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted azepan-2-one. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted azepan-5-one. In embodiments, R.sup.6 and L.sup.1 are joined together to form an unsubstituted piperidin-2-one.
[0344] In embodiments, R.sup.6 and R.sup.7 are joined to form a substituted or unsubstituted 3 to 8 membered heterocycloalkyl or substituted or unsubstituted 5 to 10 membered heteroaryl. In embodiments, R.sup.6 and R.sup.7 are joined to form a substituted 3 to 8 membered heterocycloalkyl.
[0345] In embodiments, R.sup.6 and R.sup.7 are joined to form a substituted oxazepanyl. In embodiments, R.sup.6, and R.sup.7 are joined to form a substituted oxo-substituted oxazepanyl. In embodiments, R.sup.6 and R.sup.7 are joined to form a substituted azepanyl. In embodiments, R.sup.6 and R.sup.7 are joined to form an oxo-substituted azepanyl. In embodiments, R.sup.6 and R.sup.7 are joined to form a substituted piperidinyl. In embodiments, R.sup.6 and R.sup.7 are joined to form a substituted oxo-substituted piperidinyl.
[0346] In embodiments, a substituted R.sup.7 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.7 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.7 is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.7 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.7 is substituted, it is substituted with at least one lower substituent group.
[0347] In embodiments, a substituted ring formed when two R.sup.7 substituents are joined (e.g., substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when two R.sup.7 substituents are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when two R.sup.7 substituents are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when two R.sup.7 substituents are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when two R.sup.7 substituents are joined is substituted, it is substituted with at least one lower substituent group.
[0348] In embodiments, a substituted R.sup.7A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.7A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.7A is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.7A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.7A is substituted, it is substituted with at least one lower substituent group.
[0349] In embodiments, a substituted R.sup.7B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.7B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.7B is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.7B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.7B is substituted, it is substituted with at least one lower substituent group.
[0350] In embodiments, a substituted ring formed when R.sup.7A and R.sup.7B substituents bonded to the same nitrogen atom are joined (e.g., substituted heterocycloalkyl and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.7A and R.sup.7B substituents bonded to the same nitrogen atom are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.7A and R.sup.7B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.7A, and R.sup.7B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.7A and R.sup.7B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one lower substituent group.
[0351] In embodiments, a substituted R.sup.7C (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.7C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.7C is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.7C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.7C is substituted, it is substituted with at least one lower substituent group.
[0352] In embodiments, a substituted R.sup.7D (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.7D is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.7D is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.7D is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.7D is substituted, it is substituted with at least one lower substituent group.
[0353] In embodiments, R.sup.7 is independently oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0354] In embodiments, R.sup.7 is independently halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0355] In embodiments, R.sup.7 is a substituted or unsubstituted C.sub.1-C.sub.4 alkyl, substituted or unsubstituted 2 to 4 membered heteroalkyl, substituted or unsubstituted C.sub.3-C.sub.5 cycloalkyl, substituted or unsubstituted 3 to 8 membered heterocycloalkyl, substituted or unsubstituted C.sub.6-C.sub.10 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl.
[0356] In embodiments, R.sup.7 is an unsubstituted C.sub.1-C.sub.4 alkyl, unsubstituted 2 to 4 membered heteroalkyl, unsubstituted C.sub.3-C.sub.8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C.sub.6-C.sub.10 aryl, or unsubstituted 5 to 10 membered heteroaryl.
[0357] In embodiments, R.sup.7 is an unsubstituted methyl. In embodiments, R.sup.7 is unsubstituted ethyl. In embodiments, R.sup.7 is unsubstituted propyl. In embodiments, R.sup.7 is unsubstituted n-propyl. In embodiments, R.sup.7 is unsubstituted isopropyl. In embodiments, R.sup.7 is unsubstituted butyl. In embodiments, R.sup.7 is unsubstituted n-butyl. In embodiments, R.sup.7 is unsubstituted isobutyl. In embodiments, R.sup.7 is unsubstituted tert-butyl.
[0358] In embodiments, R.sup.7 is an unsubstituted cyclopropyl. In embodiments, R.sup.7 is an unsubstituted cyclobutyl. In embodiments, R.sup.7 is an unsubstituted cyclopentyl. In embodiments, R.sup.7 is an unsubstituted cycohexyl. In embodiments, R.sup.7 is an unsubstituted cycloheptyl. In embodiments, R.sup.7 is an unsubstituted cyclooctyl.
[0359] In embodiments, R.sup.7 is an unsubstituted aziridine. In embodiments, R.sup.7 is an unsubstituted oxirane. In embodiments, R.sup.7 is an unsubstituted thiirane. In embodiments, R.sup.7 is an unsubstituted azetidine. In embodiments, R.sup.7 is an unsubstituted 1,3-diazetidine. In embodiments, R.sup.7 is an unsubstituted oxetane. In embodiments, R.sup.7 is an unsubstituted thietane. In embodiments, R.sup.7 is an unsubstituted pyrrolidine. In embodiments, R.sup.7 is an unsubstituted pyrazolidine. In embodiments, R.sup.7 is an unsubstituted imidazolidine. In embodiments, R.sup.7 is an unsubstituted tetrahydrofuran. In embodiments, R.sup.7 is an unsubstituted 1,3-dioxolane. In embodiments, R.sup.7 is an unsubstituted tetrahydrothiophene. In embodiments, R.sup.7 and L.sup.1 is an unsubstituted sulfolane. In embodiments, R.sup.7 is an unsubstituted 2,4-thiazolidibedione. In embodiments, R.sup.7 is an unsubstituted succinimide. In embodiments, R.sup.7 is an unsubstituted 2-oxazolidone. In embodiments, R.sup.7 is an unsubstituted hydantoin. In embodiments, R.sup.7 is an unsubstituted piperidine. In embodiments, R.sup.7 is an unsubstituted piperazine. In embodiments, R.sup.7 is an unsubstituted tetrahydropyran. In embodiments, R.sup.7 is an unsubstituted thiane. In embodiments, R.sup.7 is an unsubstituted dithiane.
[0360] In embodiments, R.sup.7 is an unsubstituted trithiane. In embodiments, R.sup.7 is an unsubstituted morpholine. In embodiments, R.sup.7 is an unsubstituted thiomorpholine. In embodiments, R.sup.7 is an unsubstituted dioxine. In embodiments, R.sup.7 is an unsubstituted thiomorpholine dioxide. In embodiments, R.sup.7 is an unsubstituted oxepane. In embodiments, R.sup.7 is an unsubstituted azepane. In embodiments, R.sup.7 is an unsubstituted thiopane. In embodiments, R.sup.7 is an unsubstituted azocane. In embodiments, R.sup.7 is an unsubstituted thiocane.
[0361] In embodiments, R.sup.7 is an unsubstituted phenyl.
[0362] In embodiments, R.sup.7 is an unsubstituted pyridine. In embodiments, R.sup.7 is an unsubstituted pyrudazine. In embodiments, R.sup.7 is an unsubstituted pyrimidine. In embodiments, R.sup.7 is an unsubstituted pyrazine. In embodiments, R.sup.7 is an unsubstituted triazine. In embodiments, R.sup.7 is an unsubstituted pyran. In embodiments, R.sup.7 is an unsubstituted 1,4-dioxine. In embodiments, R.sup.7 is an unsubstituted thiopyran. In embodiments, R.sup.7 is an unsubstituted oxazine. In embodiments, R.sup.7 is an unsubstituted thiazine. In embodiments, R.sup.7 is an unsubstituted cytosine. In embodiments, R.sup.7 is an unsubstituted thymine. In embodiments, R.sup.7 is an unsubstituted uracil. In embodiments, R.sup.7 is an unsubstituted 1,4,5,6-tetrahydrocyclopenta[b]pyrrole. In embodiments, R.sup.7 is an unsubstituted tetrahydropyrrolo[3,2-b]pyrrole. In embodiments, R.sup.7 is an unsubstituted dihydropyrrolo[3,2-b]pyrrole. In embodiments, R.sup.7 is an unsubstituted furo[2,3-b]pyrrole. In embodiments, R.sup.7 is an unsubstituted thieno[2,3-b]pyrrole. In embodiments, R.sup.7 is an unsubstituted indole. In embodiments, R.sup.7 is an unsubstituted isoindole. In embodiments, R.sup.7 is an unsubstituted dihydro-1H-indene. In embodiments, R.sup.7 is an unsubstituted indene. In embodiments, R.sup.7 is an unsubstituted indolene. In embodiments, R.sup.7 is an unsubstituted indolizine. In embodiments, R.sup.7 is an unsubstituted 1H-indazole. In embodiments, R.sup.7 is an unsubstituted benzimidazole. In embodiments, R.sup.7 is an unsubstituted azaindole. In embodiments, R.sup.7 is an unsubstituted azaindazole. In embodiments, R.sup.7 is an unsubstituted pyrazolo[1,5-a]pyrimidine. In embodiments, R.sup.7 is an unsubstituted purine. In embodiments, R.sup.7 is an unsubstituted benzofuran. In embodiments, R.sup.7 is an unsubstituted isobenzofuran. In embodiments, R.sup.7 is an unsubstituted benzo[c]thiophene. In embodiments, R.sup.7 is an unsubstituted benzizoxazole. In embodiments, R.sup.7 is an unsubstituted benzisothiazole. In embodiments, R.sup.7 is an unsubstituted benzoxazole. In embodiments, R.sup.7 is an unsubstituted benzthiazole. In embodiments, R.sup.7 is an unsubstituted benzo[c][1,2,5]thiadiazole. In embodiments, R.sup.7 is an unsubstituted adenine. In embodiments, R.sup.7 is an unsubstituted guanine. In embodiments, R.sup.7 is an unsubstituted quinolone. In embodiments, R.sup.7 is an unsubstituted isoquinoline. In embodiments, R.sup.7 is an unsubstituted dihydroquinooline. In embodiments, R.sup.7 is an unsubstituted tetrahydroquinoline. In embodiments, R.sup.7 is an unsubstituted quinolizine. In embodiments, R.sup.7 is an unsubstituted quinoxaline. In embodiments, R.sup.7 is an unsubstituted quinizolilne. In embodiments, R.sup.7 is an unsubstituted cinnoline. In embodiments, R.sup.7 is an unsubstituted phthalazine. In embodiments, R.sup.7 is an unsubstituted pyridopyrimidine. In embodiments, R.sup.7 is an unsubstituted pyridopyrazine. In embodiments, R.sup.7 is an unsubstituted pteridine. In embodiments, R.sup.7 is an unsubstituted benzooxazine. In embodiments, R.sup.7 is an unsubstituted quinolinone. In embodiments, R.sup.7 is an unsubstituted isoquinolinone. In embodiments, R.sup.7 is an unsubstituted azepine. In embodiments, R.sup.7 is an unsubstituted diazepine. In embodiments, R.sup.7 is an unsubstituted thiepine. In embodiments, R.sup.7 is an unsubstituted thiazepine. In embodiments, R.sup.7 is an unsubstituted azocine. In embodiments, R.sup.7 is an unsubstituted azecine.
[0363] In embodiments, R.sup.7A is hydrogen. In embodiments, R.sup.7A is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.7A is unsubstituted methyl. In embodiments, R.sup.7A is unsubstituted ethyl. In embodiments, R.sup.7A is unsubstituted propyl. In embodiments, R.sup.7A is unsubstituted n-propyl. In embodiments, R.sup.7A is unsubstituted isopropyl. In embodiments, R.sup.7A is unsubstituted butyl. In embodiments, R.sup.7A is unsubstituted n-butyl. In embodiments, R.sup.7A is unsubstituted isobutyl. In embodiments, R.sup.7A is unsubstituted tert-butyl.
[0364] In embodiments, R.sup.7B is hydrogen. In embodiments, R.sup.7B is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.7B is unsubstituted methyl. In embodiments, R.sup.7B is unsubstituted ethyl. In embodiments, R.sup.7B is unsubstituted propyl. In embodiments, R.sup.7B is unsubstituted n-propyl. In embodiments, R.sup.7B is unsubstituted isopropyl. In embodiments, R.sup.7B is unsubstituted butyl. In embodiments, R.sup.7B is unsubstituted n-butyl. In embodiments, R.sup.7B is unsubstituted isobutyl. In embodiments, R.sup.7B is unsubstituted tert-butyl.
[0365] In embodiments, R.sup.7C is hydrogen. In embodiments, R.sup.7C is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.7C is unsubstituted methyl. In embodiments, R.sup.7C is unsubstituted ethyl. In embodiments, R.sup.7C is unsubstituted propyl. In embodiments, R.sup.7C is unsubstituted n-propyl. In embodiments, R.sup.7C is unsubstituted isopropyl. In embodiments, R.sup.7C is unsubstituted butyl. In embodiments, R.sup.7C is unsubstituted n-butyl. In embodiments, R.sup.7C is unsubstituted isobutyl. In embodiments, R.sup.7C is unsubstituted tert-butyl.
[0366] In embodiments, R.sup.7D is hydrogen. In embodiments, R.sup.7D is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.7D is unsubstituted methyl. In embodiments, R.sup.7D is unsubstituted ethyl. In embodiments, R.sup.7D is unsubstituted propyl. In embodiments, R.sup.7D is unsubstituted n-propyl. In embodiments, R.sup.7D is unsubstituted isopropyl. In embodiments, R.sup.7D is unsubstituted butyl. In embodiments, R.sup.7D is unsubstituted n-butyl. In embodiments, R.sup.7D is unsubstituted isobutyl. In embodiments, R.sup.7D is unsubstituted tert-butyl.
[0367] In embodiments, n is 0. In embodiments, n is 1. In embodiments, n is 2. In embodiments, n is 3.
[0368] In embodiments, R.sup.8 is a cysteine binding moiety. In embodiments, R.sup.8 is a serine binding moiety.
[0369] In embodiments, the cysteine binding moiety is:
##STR00006##
[0370] R.sup.15 is independently hydrogen, halogen, CX.sup.15.sub.3, CHX.sup.15.sub.2, CH.sub.2X.sup.15, CN, SO.sub.n15R.sup.15D, SO.sub.v15NR.sup.15AR.sup.15B, NHNR.sup.15AR.sup.15B, ONR.sup.15AR.sup.15B, NHC(O)NHNR.sup.15AR.sup.15B, NHC(O)NR.sup.15AR.sup.15B, N(O).sub.m15, NR.sup.15AR.sup.15B, C(O)R.sup.15C, C(O)OR.sup.15C, C(O)NR.sup.15AR.sup.15B, OR.sup.15D, NR.sup.15ASO.sub.2R.sup.15D, NR.sup.15AC(O)R.sup.15C, NR.sup.15AC(O)OR.sup.15C, NR.sup.15AOR.sup.15C, OCX.sup.15.sub.3, OCHX.sup.15.sub.2, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0371] R.sup.16 is independently hydrogen, halogen, CX.sup.16.sub.3, CHX.sup.16.sub.2, CH.sub.2X.sup.16, CN, SO.sub.n16R.sup.16D, SO.sub.v16NR.sup.16AR.sup.16B, NHNR.sup.16AR.sup.16B, ONR.sup.16AR.sup.16B, NHC(O)NHNR.sup.16AR.sup.16B, NHC(O)NR.sup.16AR.sup.16B, N(O).sub.m16, NR.sup.16AR.sup.16B, C(O)R.sup.16C, C(O)OR.sup.16C, C(O)NR.sup.16AR.sup.16B, OR.sup.16D, NR.sup.16ASO.sub.2R.sup.16D, NR.sup.16AC(O)R.sup.16C, NR.sup.16AC(O)OR.sup.16C, NR.sup.16AOR.sup.16C, OCX.sup.16.sub.3, OCHX.sup.16.sub.2, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0372] R.sup.17 is independently hydrogen, halogen, CX.sup.17.sub.3, CHX.sup.17.sub.2, CH.sub.2X.sup.17, CN, SO.sub.n17R.sup.17D, SO.sub.v17NR.sup.17AR.sup.17B, NHNR.sup.17AR.sup.17B, ONR.sup.17AR.sup.17B, NHC(O)NHNR.sup.17AR.sup.17B, NHC(O)NR.sup.17AR.sup.17B, N(O).sub.m17, NR.sup.17AR.sup.17B, C(O)R.sup.17C, C(O)OR.sup.17C, C(O)NR.sup.17AR.sup.17B, OR.sup.17D, NR.sup.17ASO.sub.2R.sup.17D, NR.sup.17AC(O)R.sup.17C, NR.sup.17AC(O)OR.sup.17C, NR.sup.17AOR.sup.17C, OCX.sup.17.sub.3, OCHX.sup.17.sub.2, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0373] R.sup.18 is independently hydrogen, CX.sup.18.sub.3, CHX.sup.18.sub.2, CH.sub.2X.sup.18, C(O)R.sup.18C, C(O)OR.sup.18C, C(O)NR.sup.18AR.sup.18B, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0374] R.sup.15A, R.sup.15B, R.sup.15C, R.sup.15D, R.sup.16A, R.sup.16B, R.sup.16C, R.sup.16D, R.sup.17A, R.sup.17B, R.sup.17C, R.sup.17D, R.sup.18A, R.sup.18B, and R.sup.18C are independently hydrogen, CX.sub.3, CN, COOH, CONH.sub.2, CHX.sub.2, CH.sub.2X, substituted or unsubstituted alkyl (e.g., C.sub.1-C.sub.8, C.sub.1-C.sub.6, C.sub.1-C.sub.4, or C.sub.1-C.sub.2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C.sub.3-C.sub.8, C.sub.3-C.sub.6, C.sub.4-C.sub.6, or C.sub.5-C.sub.6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C.sub.6-C.sub.10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.15A and R.sup.15B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.16A and R.sup.16B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.17A and R.sup.17B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); R.sup.18A and R.sup.18B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered) or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
[0375] X, X.sup.15, X.sup.16, X.sup.17, and X.sup.18 are independently F, Cl, Br, or I.
[0376] The symbols n15, n16, and n17 are independently an integer from 0 to 4.
[0377] The symbols m15, m16, m17, v15, v16, and v17 are independently an integer from 1 to 2.
[0378] In embodiments, the cysteine binding moiety is:
##STR00007##
In embodiments, the cysteine binding moiety is
##STR00008##
In embodiments, the cysteine binding moiety is
##STR00009##
In embodiments, the cysteine binding moiety is
##STR00010##
In embodiments, the cysteine binding moiety is
##STR00011##
In embodiments, the cysteine binding moiety is
##STR00012##
In embodiments, the cysteine binding moiety is OH
##STR00013##
In embodiments, the cysteine binding moiety is
##STR00014##
In embodiments, the cysteine binding moiety is
##STR00015##
In embodiments, the cysteine binding moiety is
##STR00016##
In embodiments, the cysteine binding moiety is
##STR00017##
In embodiments, the cysteine binding moiety is
##STR00018##
[0379] In embodiments, a substituted R.sup.15 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.15 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.15 is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.15 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.15 is substituted, it is substituted with at least one lower substituent group.
[0380] In embodiments, a substituted R.sup.15A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.15A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.15A is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.15A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.15A is substituted, it is substituted with at least one lower substituent group.
[0381] In embodiments, a substituted R.sup.15B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.15B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.15B is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.15B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.15B is substituted, it is substituted with at least one lower substituent group.
[0382] In embodiments, a substituted ring formed when R.sup.15A and R.sup.15B substituents bonded to the same nitrogen atom are joined (e.g., substituted heterocycloalkyl and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.15A and R.sup.15B substituents bonded to the same nitrogen atom are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.15A and R.sup.15B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.15A and R.sup.15B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.15A and R.sup.15B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one lower substituent group.
[0383] In embodiments, a substituted R.sup.15C (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.15C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.15C is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.15C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.15C is substituted, it is substituted with at least one lower substituent group.
[0384] In embodiments, a substituted R.sup.15D (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.15D is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.15D is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.15D is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.5D is substituted, it is substituted with at least one lower substituent group.
[0385] In embodiments, R.sup.15 is independently oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0386] In embodiments, R.sup.15 is independently halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0387] In embodiments, R.sup.15 is independently hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl or substituted or unsubstituted 2 to 4 membered heteroalkyl. In embodiments, R.sup.15 is hydrogen. In embodiments, R.sup.15 is unsubstituted methyl. In embodiments, R.sup.15 is unsubstituted ethyl. In embodiments, R.sup.15 is unsubstituted propyl. In embodiments, R.sup.15 is unsubstituted n-propyl. In embodiments, R.sup.15 is unsubstituted isopropyl. In embodiments, R.sup.15 is unsubstituted butyl. In embodiments, R.sup.15 is unsubstituted n-butyl. In embodiments, R.sup.15 is unsubstituted isobutyl. In embodiments, R.sup.15 is unsubstituted tert-butyl.
[0388] In embodiments, R.sup.15A is hydrogen. In embodiments, R.sup.15A is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.15A is unsubstituted methyl. In embodiments, R.sup.15A is unsubstituted ethyl. In embodiments, R.sup.15A is unsubstituted propyl. In embodiments, R.sup.15A is unsubstituted n-propyl. In embodiments, R.sup.15A is unsubstituted isopropyl. In embodiments, R.sup.15A is unsubstituted butyl. In embodiments, R.sup.15A is unsubstituted n-butyl. In embodiments, R.sup.15A is unsubstituted isobutyl. In embodiments, R.sup.15A is unsubstituted tert-butyl.
[0389] In embodiments, R.sup.15B is hydrogen. In embodiments, R.sup.15B is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.15B is unsubstituted methyl. In embodiments, R.sup.15B is unsubstituted ethyl. In embodiments, R.sup.15B is unsubstituted propyl. In embodiments, R.sup.15B is unsubstituted n-propyl. In embodiments, R.sup.15B is unsubstituted isopropyl. In embodiments, R.sup.15B is unsubstituted butyl. In embodiments, R.sup.15B is unsubstituted n-butyl. In embodiments, R.sup.15B is unsubstituted isobutyl. In embodiments, R.sup.15B is unsubstituted tert-butyl.
[0390] In embodiments, R.sup.15C is hydrogen. In embodiments, R.sup.15C is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.15C is unsubstituted methyl. In embodiments, R.sup.15C is unsubstituted ethyl. In embodiments, R.sup.15C is unsubstituted propyl. In embodiments, R.sup.15C is unsubstituted n-propyl. In embodiments, R.sup.15C is unsubstituted isopropyl. In embodiments, R.sup.15C is unsubstituted butyl. In embodiments, R.sup.15C is unsubstituted n-butyl. In embodiments, R.sup.15C is unsubstituted isobutyl. In embodiments, R.sup.15C is unsubstituted tert-butyl.
[0391] In embodiments, R.sup.15D is hydrogen. In embodiments, R.sup.15D is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.15D is unsubstituted methyl. In embodiments, R.sup.15D is unsubstituted ethyl. In embodiments, R.sup.15D is unsubstituted propyl. In embodiments, R.sup.15D is unsubstituted n-propyl. In embodiments, R.sup.15D is unsubstituted isopropyl. In embodiments, R.sup.15D is unsubstituted butyl. In embodiments, R.sup.15D is unsubstituted n-butyl. In embodiments, R.sup.15D is unsubstituted isobutyl. In embodiments, R.sup.15D is unsubstituted tert-butyl.
[0392] In embodiments, a substituted R.sup.16 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.16 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.16 is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.16 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.16 is substituted, it is substituted with at least one lower substituent group.
[0393] In embodiments, a substituted R.sup.16A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.16A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.16A is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.16A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.16A is substituted, it is substituted with at least one lower substituent group.
[0394] In embodiments, a substituted R.sup.16B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.16B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.16B is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.16B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.16B is substituted, it is substituted with at least one lower substituent group.
[0395] In embodiments, a substituted ring formed when R.sup.16A and R.sup.16B substituents bonded to the same nitrogen atom are joined (e.g., substituted heterocycloalkyl and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.16A and R.sup.16B, substituents bonded to the same nitrogen atom are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.16A and R.sup.16B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.16A and R.sup.16B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.16A and R.sup.16B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one lower substituent group.
[0396] In embodiments, a substituted R.sup.16C (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.16C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.16C is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.16C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.16C is substituted, it is substituted with at least one lower substituent group.
[0397] In embodiments, a substituted R.sup.16D (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.16D is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.16D is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.16D is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.16D is substituted, it is substituted with at least one lower substituent group.
[0398] In embodiments, R.sup.16 is independently oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0399] In embodiments, R.sup.16 is independently halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0400] In embodiments, R.sup.16 is independently hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl or substituted or unsubstituted 2 to 4 membered heteroalkyl. In embodiments, R.sup.16 is hydrogen. In embodiments, R.sup.16 is unsubstituted methyl. In embodiments, R.sup.16 is unsubstituted ethyl. In embodiments, R.sup.16 is unsubstituted propyl. In embodiments, R.sup.16 is unsubstituted n-propyl. In embodiments, R.sup.16 is unsubstituted isopropyl. In embodiments, R.sup.16 is unsubstituted butyl. In embodiments, R.sup.16 is unsubstituted n-butyl. In embodiments, R.sup.16 is unsubstituted isobutyl. In embodiments, R.sup.16 is unsubstituted tert-butyl. In embodiments, R.sup.16 is unsubstituted C.sub.3-C.sub.8 cycloalkyl. In embodiments, R.sup.16 is unsubstituted cyclopropyl. In embodiments, R.sup.16 is unsubstituted cyclobutyl. In embodiments, R.sup.16 is unsubstituted cyclopentyl. In embodiments, R.sup.16 is unsubstituted cyclohexyl. In embodiments, R.sup.16 is unsubstituted cycloheptyl. In embodiments, R.sup.16 is unsubstituted cyclooctyl. In embodiments, R.sup.16 is unsubstituted 5 to 6 membered heteroaryl. In embodiments, R.sup.16 is unsubstituted thienyl. In embodiments, R.sup.16 is unsubstituted 1-thienyl.
[0401] In embodiments, R.sup.16 is unsubstituted 2-thienyl. In embodiments, R.sup.16 is unsubstituted furanyl.
[0402] In embodiments, R.sup.16 is unsubstituted 1-furanyl. In embodiments, R.sup.16 is unsubstituted 2-furanyl. In embodiments, R.sup.16 is substituted or unsubstituted phenyl. In embodiments, R.sup.16 is substituted phenyl. In embodiments, R.sup.16 is unsubstituted phenyl. In embodiments, R.sup.16 is unsubstituted fused ring aryl. In embodiments, R.sup.16 is
##STR00019##
[0403] In embodiments, R.sup.16A is hydrogen. In embodiments, R.sup.16A is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.16A is unsubstituted methyl. In embodiments, R.sup.16A is unsubstituted ethyl. In embodiments, R.sup.16A is unsubstituted propyl. In embodiments, R.sup.16A is unsubstituted n-propyl. In embodiments, R.sup.16A is unsubstituted isopropyl. In embodiments, R.sup.16A is unsubstituted butyl. In embodiments, R.sup.16A is unsubstituted n-butyl. In embodiments, R.sup.16A is unsubstituted isobutyl. In embodiments, R.sup.16A is unsubstituted tert-butyl.
[0404] In embodiments, R.sup.16B is hydrogen. In embodiments, R.sup.16B is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.16B is unsubstituted methyl. In embodiments, R.sup.16B is unsubstituted ethyl. In embodiments, R.sup.16B is unsubstituted propyl. In embodiments, R.sup.16B is unsubstituted n-propyl. In embodiments, R.sup.16B is unsubstituted isopropyl. In embodiments, R.sup.16B is unsubstituted butyl. In embodiments, R.sup.16B is unsubstituted n-butyl. In embodiments, R.sup.16B is unsubstituted isobutyl. In embodiments, R.sup.16B is unsubstituted tert-butyl.
[0405] In embodiments, R.sup.16C is hydrogen. In embodiments, R.sup.16C is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.16C is unsubstituted methyl. In embodiments, R.sup.16C is unsubstituted ethyl. In embodiments, R.sup.16C is unsubstituted propyl. In embodiments, R.sup.16C is unsubstituted n-propyl. In embodiments, R.sup.16C is unsubstituted isopropyl. In embodiments, R.sup.16C is unsubstituted butyl. In embodiments, R.sup.16C is unsubstituted n-butyl. In embodiments, R.sup.16C is unsubstituted isobutyl. In embodiments, R.sup.16C is unsubstituted tert-butyl.
[0406] In embodiments, R.sup.16D is hydrogen. In embodiments, R.sup.16D is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.16D is unsubstituted methyl. In embodiments, R.sup.16D is unsubstituted ethyl. In embodiments, R.sup.16D is unsubstituted propyl. In embodiments, R.sup.16D is unsubstituted n-propyl. In embodiments, R.sup.16D is unsubstituted isopropyl. In embodiments, R.sup.16D is unsubstituted butyl. In embodiments, R.sup.16D is unsubstituted n-butyl. In embodiments, R.sup.16D is unsubstituted isobutyl. In embodiments, R.sup.16D is unsubstituted tert-butyl.
[0407] In embodiments, a substituted R.sup.17 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.17 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.17 is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.17 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.17 is substituted, it is substituted with at least one lower substituent group.
[0408] In embodiments, a substituted R.sup.17A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.17A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.17A is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.17A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.17A is substituted, it is substituted with at least one lower substituent group.
[0409] In embodiments, a substituted R.sup.17B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.17B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.17B is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.17B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.17B is substituted, it is substituted with at least one lower substituent group.
[0410] In embodiments, a substituted ring formed when R.sup.17A and R.sup.17B substituents bonded to the same nitrogen atom are joined (e.g., substituted heterocycloalkyl and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.17A and R.sup.17B, substituents bonded to the same nitrogen atom are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.17A and R.sup.17B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.17A and R.sup.17B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.17A and R.sup.17B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one lower substituent group.
[0411] In embodiments, a substituted R.sup.17C (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.17C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.17C is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.17C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.17C is substituted, it is substituted with at least one lower substituent group.
[0412] In embodiments, a substituted R.sup.17D (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.17D is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.17D is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.17D is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.17D is substituted, it is substituted with at least one lower substituent group.
[0413] In embodiments, R.sup.17 is independently oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0414] In embodiments, R.sup.17 is independently halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0415] In embodiments, R.sup.17 is independently hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl or substituted or unsubstituted 2 to 4 membered heteroalkyl. In embodiments, R.sup.17 is hydrogen. In embodiments, R.sup.17 is unsubstituted methyl. In embodiments, R.sup.17 is unsubstituted ethyl. In embodiments, R.sup.17 is unsubstituted propyl. In embodiments, R.sup.17 is unsubstituted n-propyl. In embodiments, R.sup.17 is unsubstituted isopropyl. In embodiments, R.sup.17 is unsubstituted butyl. In embodiments, R.sup.17 is unsubstituted n-butyl. In embodiments, R.sup.17 is unsubstituted isobutyl. In embodiments, R.sup.17 is unsubstituted tert-butyl. In embodiments, R.sup.17 is CN.
[0416] In embodiments, R.sup.17A is hydrogen. In embodiments, R.sup.17A is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.17A is unsubstituted methyl. In embodiments, R.sup.17A is unsubstituted ethyl. In embodiments, R.sup.17A is unsubstituted propyl. In embodiments, R.sup.17A is unsubstituted n-propyl. In embodiments, R.sup.17A is unsubstituted isopropyl. In embodiments, R.sup.17A is unsubstituted butyl. In embodiments, R.sup.17A is unsubstituted n-butyl. In embodiments, R.sup.17A is unsubstituted isobutyl. In embodiments, R.sup.17A is unsubstituted tert-butyl.
[0417] In embodiments, R.sup.17B is hydrogen. In embodiments, R.sup.17B is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.17B is unsubstituted methyl. In embodiments, R.sup.17B is unsubstituted ethyl. In embodiments, R.sup.17B is unsubstituted propyl. In embodiments, R.sup.17B is unsubstituted n-propyl. In embodiments, R.sup.17B is unsubstituted isopropyl. In embodiments, R.sup.17B is unsubstituted butyl. In embodiments, R.sup.17B is unsubstituted n-butyl. In embodiments, R.sup.17B is unsubstituted isobutyl. In embodiments, R.sup.17B is unsubstituted tert-butyl.
[0418] In embodiments, R.sup.17C is hydrogen. In embodiments, R.sup.17C is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.17C is unsubstituted methyl. In embodiments, R.sup.17C is unsubstituted ethyl. In embodiments, R.sup.17C is unsubstituted propyl. In embodiments, R.sup.17C is unsubstituted n-propyl. In embodiments, R.sup.17C is unsubstituted isopropyl. In embodiments, R.sup.17C is unsubstituted butyl. In embodiments, R.sup.17C is unsubstituted n-butyl. In embodiments, R.sup.17C is unsubstituted isobutyl. In embodiments, R.sup.17C is unsubstituted tert-butyl.
[0419] In embodiments, R.sup.17D is hydrogen. In embodiments, R.sup.17D is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.17D is unsubstituted methyl. In embodiments, R.sup.17D is unsubstituted ethyl. In embodiments, R.sup.17D is unsubstituted propyl. In embodiments, R.sup.17D is unsubstituted n-propyl. In embodiments, R.sup.17D is unsubstituted isopropyl. In embodiments, R.sup.17D is unsubstituted butyl. In embodiments, R.sup.17D is unsubstituted n-butyl. In embodiments, R.sup.17D is unsubstituted isobutyl. In embodiments, R.sup.17D is unsubstituted tert-butyl.
[0420] In embodiments, a substituted R.sup.18 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.18 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.18 is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.18 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.18 is substituted, it is substituted with at least one lower substituent group.
[0421] In embodiments, a substituted R.sup.18A (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.18A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.18A is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.18A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.18A is substituted, it is substituted with at least one lower substituent group.
[0422] In embodiments, a substituted R.sup.18B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.18B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.18B is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.18B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.8B is substituted, it is substituted with at least one lower substituent group.
[0423] In embodiments, a substituted ring formed when R.sup.18A and R.sup.18B substituents bonded to the same nitrogen atom are joined (e.g., substituted heterocycloalkyl and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted ring formed when R.sup.18A and R.sup.18B substituents bonded to the same nitrogen atom are joined is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when the substituted ring formed when R.sup.18A and R.sup.18B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one substituent group. In embodiments, when the substituted ring formed when R.sup.18A and R.sup.18B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when the substituted ring formed when R.sup.18A and R.sup.18B substituents bonded to the same nitrogen atom are joined is substituted, it is substituted with at least one lower substituent group.
[0424] In embodiments, a substituted R.sup.18C (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R.sup.18C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R.sup.18C is substituted, it is substituted with at least one substituent group. In embodiments, when R.sup.18C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R.sup.18C is substituted, it is substituted with at least one lower substituent group.
[0425] In embodiments, R.sup.18 is independently oxo, halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0426] In embodiments, R.sup.18 is independently halogen, CCl.sub.3, CBr.sub.3, CF.sub.3, CI.sub.3, CHCl.sub.2, CHBr.sub.2, CHF.sub.2, CHI.sub.2, CH.sub.2Cl, CH.sub.2Br, CH.sub.2F, CH.sub.2I, OCCl.sub.3, OCF.sub.3, OCBr.sub.3, OCI.sub.3, OCHCl.sub.2, OCHBr.sub.2, OCHI.sub.2, OCHF.sub.2, OCH.sub.2Cl, OCH.sub.2Br, OCH.sub.2I, OCH.sub.2F, CN, SO.sub.3H, OSO.sub.3H, SO.sub.2NH.sub.2, NHNH.sub.2, ONH.sub.2, NHC(O)NHNH.sub.2, NHC(O)NH.sub.2, NO.sub.2, NH.sub.2, C(O)H, C(O)OH, CONH.sub.2, OH, SH, NHSO.sub.2H, NHC(O)H, NHC(O)OH, NHOH, SF.sub.5, N.sub.3, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
[0427] In embodiments, R.sup.18 is independently hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl or substituted or unsubstituted 2 to 4 membered heteroalkyl. In embodiments, R.sup.18 is hydrogen. In embodiments, R.sup.18 is unsubstituted methyl. In embodiments, R.sup.18 is unsubstituted ethyl. In embodiments, R.sup.18 is unsubstituted propyl. In embodiments, R.sup.18 is unsubstituted n-propyl. In embodiments, R.sup.18 is unsubstituted isopropyl. In embodiments, R.sup.18 is unsubstituted butyl. In embodiments, R.sup.18 is unsubstituted n-butyl. In embodiments, R.sup.18 is unsubstituted isobutyl. In embodiments, R.sup.18 is unsubstituted tert-butyl.
[0428] In embodiments, R.sup.18A is hydrogen. In embodiments, R.sup.18A is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.18A is unsubstituted methyl. In embodiments, R.sup.18A is unsubstituted ethyl. In embodiments, R.sup.18A is unsubstituted propyl. In embodiments, R.sup.18A is unsubstituted n-propyl. In embodiments, R.sup.18A is unsubstituted isopropyl. In embodiments, R.sup.18A is unsubstituted butyl. In embodiments, R.sup.18A is unsubstituted n-butyl. In embodiments, R.sup.18A is unsubstituted isobutyl. In embodiments, R.sup.18A is unsubstituted tert-butyl.
[0429] In embodiments, R.sup.18B is hydrogen. In embodiments, R.sup.18B is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.18B is unsubstituted methyl. In embodiments, R.sup.18B is unsubstituted ethyl. In embodiments, R.sup.18B is unsubstituted propyl. In embodiments, R.sup.18B is unsubstituted n-propyl. In embodiments, R.sup.18B is unsubstituted isopropyl. In embodiments, R is unsubstituted butyl. In embodiments, R.sup.18B is unsubstituted n-butyl. In embodiments, R is unsubstituted isobutyl. In embodiments, R.sup.18B is unsubstituted tert-butyl.
[0430] In embodiments, R.sup.18C is hydrogen. In embodiments, R.sup.18C is unsubstituted C.sub.1-C.sub.4 alkyl. In embodiments, R.sup.18C is unsubstituted methyl. In embodiments, R.sup.18C is unsubstituted ethyl. In embodiments, R.sup.18C is unsubstituted propyl. In embodiments, R.sup.18C is unsubstituted n-propyl. In embodiments, R.sup.18C is unsubstituted isopropyl. In embodiments, R.sup.18C is unsubstituted butyl. In embodiments, R.sup.18C is unsubstituted n-butyl. In embodiments, R.sup.18C is unsubstituted isobutyl. In embodiments, R.sup.18C is unsubstituted tert-butyl.
[0431] In embodiments, X.sup.16 is halogen. In embodiments, X.sup.16 is F. In embodiments, X.sup.16 is Cl. In embodiments, X.sup.16 is Br. In embodiments, X.sup.16 is I.
[0432] In embodiments, X.sup.17 is halogen. In embodiments, X.sup.17 is F. In embodiments, X.sup.17 is Cl. In embodiments, X.sup.17 is Br. In embodiments, X.sup.17 is I.
[0433] In embodiments, the serine binding moiety is:
##STR00020##
wherein R.sup.15, R.sup.16, R.sup.17, R.sup.18, and X.sup.17 are as described herein, including embodiments.
[0434] In embodiments, the serine binding moiety is
##STR00021##
In embodiments, the serine binding moiety is
##STR00022##
In embodiments, the serine binding moiety is
##STR00023##
In embodiments, the serine binding moiety is
##STR00024##
In embodiments, the serine binding moiety is
##STR00025##
In embodiments, the serine binding moiety is
##STR00026##
In embodiments, the serine binding moiety is
##STR00027##
In embodiments, the serine binding moiety is
##STR00028##
In embodiments, the serine binding moiety is
##STR00029##
In embodiments, the serine binding moiety is
##STR00030##
In embodiments, the serine binding moiety is:
##STR00031##
In embodiments, the serine binding moiety is
##STR00032##
In embodiments, the serine binding moiety is
##STR00033##
In embodiments, the serine binding moiety is
##STR00034##
In embodiments, the serine binding moiety is
##STR00035##
In embodiments, the serine binding moiety is
##STR00036##
In embodiments, the serine binding moiety is
##STR00037##
In embodiments, the serine binding moiety is
##STR00038##
In embodiments, the serine binding moiety is
##STR00039##
In embodiments, the serine binding moiety is
##STR00040##
In embodiments, the serine binding moiety is
##STR00041##
[0435] In embodiments, when L.sup.1 is substituted, L.sup.1 is substituted with one or more first substituent groups denoted by R.sup.L1.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.L1.1 substituent group is substituted, the R.sup.L1.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.L1.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.L1.2 substituent group is substituted, the R.sup.L1.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.L1.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, L.sup.1, R.sup.L1.1, R.sup.L1.2, and R.sup.L1.3 have values corresponding to the values of L.sup.WW, R.sup.LWW.1, R.sup.LWW.2, and R.sup.LWW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein L.sup.WW, R.sup.LWW.1, R.sup.LWW.2, and R.sup.LWW.3 are L.sup.1, R.sup.L1.1, R.sup.L1.2, and R.sup.L1.3, respectively.
[0436] In embodiments, when R.sup.1 is substituted, R.sup.1 is substituted with one or more first substituent groups denoted by R.sup.1.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1 substituent group is substituted, the R.sup.1.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.1.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1.2 substituent group is substituted, the R.sup.1.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.1.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.1, R.sup.1.1, R.sup.1.2, and R.sup.1.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.1, R.sup.1.1, R.sup.1.2, and R.sup.1.3, respectively.
[0437] In embodiments, when R.sup.1A is substituted, R.sup.1A is substituted with one or more first substituent groups denoted by R.sup.1A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1A.1 substituent group is substituted, the R.sup.1A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.1A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1A.2 substituent group is substituted, the R.sup.1A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.1A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.1A, R.sup.1A.1, R.sup.1A.2, and R.sup.1A.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.1A, R.sup.1A.1, R.sup.1A.2, and R.sup.1A.3, respectively.
[0438] In embodiments, when R.sup.1B is substituted, R.sup.1B is substituted with one or more first substituent groups denoted by R.sup.1B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1B.1 substituent group is substituted, the R.sup.1B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.1B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1B.2 substituent group is substituted, the R.sup.1B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.1B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.1B, R.sup.1B.1, R.sup.1B.2, and R.sup.1B.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.1B, R.sup.1B.1, R.sup.1B.2, and R.sup.1B.3, respectively.
[0439] In embodiments, when R.sup.1A and R.sup.1B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.1A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1A.1 substituent group is substituted, the R.sup.1A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.1A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1A.2 substituent group is substituted, the R.sup.1A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.1A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.1A.1, R.sup.1A.2, and R.sup.1A.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.1A.1, R.sup.1A.2, and R.sup.1A.3, respectively.
[0440] In embodiments, when R.sup.1A and R.sup.1B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.1B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1B.1 substituent group is substituted, the R.sup.1B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.1B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1B.2 substituent group is substituted, the R.sup.1B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.1B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.1B.1, R.sup.1B.2, and R.sup.1B.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.1B.1, R.sup.1B.2, and R.sup.1B.3, respectively.
[0441] In embodiments, when R.sup.1C is substituted, R.sup.1C is substituted with one or more first substituent groups denoted by R.sup.1C.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1C.1 substituent group is substituted, the R.sup.1C.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.1C.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1C.2 substituent group is substituted, the R.sup.1C.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.1C.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, Ric, Rici, R.sup.1C.2, and R.sup.1C.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to Ric, Rici, R.sup.1C.2, and R.sup.1C.3, respectively.
[0442] In embodiments, when R.sup.1D is substituted, R.sup.1D is substituted with one or more first substituent groups denoted by R.sup.1D.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1D.1 substituent group is substituted, the R.sup.1D.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.1D.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.1D.2 substituent group is substituted, the R.sup.1D.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.1D.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.1D, R.sup.1D.1, R.sup.1D.2, and R.sup.1D.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.1D, R.sup.1D.1, R.sup.1D.2, and R.sup.1D.3, respectively.
[0443] In embodiments, when R.sup.2 is substituted, R.sup.2 is substituted with one or more first substituent groups denoted by R.sup.2.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2.1 substituent group is substituted, the R.sup.2.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.2.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2.2 substituent group is substituted, the R.sup.2.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.2.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.2, R.sup.2.1, R.sup.2.2, and R.sup.2.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.2, R.sup.2.1, R.sup.2.2, and R.sup.2.3, respectively.
[0444] In embodiments, when R.sup.2A is substituted, R.sup.2A is substituted with one or more first substituent groups denoted by R.sup.2A1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2A.1 substituent group is substituted, the R.sup.2A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.2A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2A.2 substituent group is substituted, the R.sup.2A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.2A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.2A, R.sup.2A.1, R.sup.2A.2, and R.sup.2A.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.2A, R.sup.2A.1, R.sup.2A.2, and R.sup.2A.3, respectively.
[0445] In embodiments, when R.sup.2B is substituted, R.sup.2B is substituted with one or more first substituent groups denoted by R.sup.2B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2B.1 substituent group is substituted, the R.sup.2B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.2B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2B.2 substituent group is substituted, the R.sup.2B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.2B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.2B, R.sup.2B.1, R.sup.2B.2, and R.sup.2B.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.2B, R.sup.2B.1, R.sup.2B.2, and R.sup.2B.3, respectively.
[0446] In embodiments, when R.sup.2A and R.sup.2B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.2A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2A.1 substituent group is substituted, the R.sup.2A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.2A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2A.2 substituent group is substituted, the R.sup.2A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.2A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.2A.1, R.sup.2A.2, and R.sup.2A.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.2A.1, R.sup.2A.2, and R.sup.2A.3, respectively.
[0447] In embodiments, when R.sup.2A and R.sup.2B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.2B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2B.1 substituent group is substituted, the R.sup.2B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.2B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2B.2 substituent group is substituted, the R.sup.2B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.2B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.2B.1, R.sup.2B.2, and R.sup.2B.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.2B.1, R.sup.2B.2, and R.sup.2B.3, respectively.
[0448] In embodiments, when R.sup.2C is substituted, R.sup.2C is substituted with one or more first substituent groups denoted by R.sup.2C.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2C.1 substituent group is substituted, the R.sup.2C.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.2C.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2C.2 substituent group is substituted, the R.sup.2C.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.2C.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.2C, R.sup.2C.1, R.sup.2C.2, and R.sup.2C.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.2C, R.sup.2C.1, R.sup.2C.2, and R.sup.2C.3, respectively.
[0449] In embodiments, when R.sup.2D is substituted, R.sup.2D is substituted with one or more first substituent groups denoted by R.sup.2D.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2D.1 substituent group is substituted, the R.sup.2D.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.2D.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.2D.2 substituent group is substituted, the R.sup.2D.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.2D.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.2D, R.sup.2D.1, R.sup.2D.2, and R.sup.2D.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.2D, R.sup.2D.1, R.sup.2D.2, and R.sup.2D.3, respectively.
[0450] In embodiments, when R.sup.3 is substituted, R.sup.3 is substituted with one or more first substituent groups denoted by R.sup.3.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3.1 substituent group is substituted, the R.sup.3.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.3.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3.2 substituent group is substituted, the R.sup.3.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.3.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.3, R.sup.3.1, R.sup.3.2, and R.sup.3.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.3, R.sup.3.1, R.sup.3.2, and R.sup.3.3, respectively.
[0451] In embodiments, when R.sup.3A is substituted, R.sup.3A is substituted with one or more first substituent groups denoted by R.sup.3A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3A.1 substituent group is substituted, the R.sup.3A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.3A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3A.2 substituent group is substituted, the R.sup.3A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.3A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.3A, R.sup.3A.1, R.sup.3A.2, and R.sup.3A.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.3A, R.sup.3A.1, R.sup.3A.2, and R.sup.3A.3, respectively.
[0452] In embodiments, when R.sup.3B is substituted, R.sup.3B is substituted with one or more first substituent groups denoted by R.sup.3B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3B.1 substituent group is substituted, the R.sup.3B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.3B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3B.2 substituent group is substituted, the R.sup.3B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.3B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.3B, R.sup.3B.1, R.sup.3B.2, and R.sup.3B.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.3B, R.sup.3B.1, R.sup.3B.2, and R.sup.3B.3, respectively.
[0453] In embodiments, when R.sup.3A and R.sup.3B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.3A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3A.1 substituent group is substituted, the R.sup.3A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.3A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3A.2 substituent group is substituted, the R.sup.3A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.3A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.3A.1, R.sup.3A.2, and R.sup.3A.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.3A.1, R.sup.3A.2, and R.sup.3A.3, respectively.
[0454] In embodiments, when R.sup.3A and R.sup.3B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.3B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3B.1 substituent group is substituted, the R.sup.3B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.3B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3B.2 substituent group is substituted, the R.sup.3B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.3B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.3B.1, R.sup.3B.2, and R.sup.3B.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.3B.1, R.sup.3B.2, and R.sup.3B.3, respectively.
[0455] In embodiments, when R.sup.3C is substituted, R.sup.3C is substituted with one or more first substituent groups denoted by R.sup.3C.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3C.1 substituent group is substituted, the R.sup.3C.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.3C.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3C.2 substituent group is substituted, the R.sup.3C.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.3C.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.3C, R.sup.3C.1, R.sup.3C.2, and R.sup.3C.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.3C, R.sup.3C.1, R.sup.2C.2, and R.sup.3C.3, respectively.
[0456] In embodiments, when R.sup.3D is substituted, R.sup.3D is substituted with one or more first substituent groups denoted by R.sup.3D.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3D.1 substituent group is substituted, the R.sup.3D.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.3D.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.3D.2 substituent group is substituted, the R.sup.3D.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.3D.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.3D, R.sup.3D.1, R.sup.3D.2, and R.sup.3D.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.3D, R.sup.3D.1, R.sup.3D.2, and R.sup.3D.3, respectively.
[0457] In embodiments, when R.sup.4 is substituted, R.sup.4 is substituted with one or more first substituent groups denoted by R.sup.4.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4.1 substituent group is substituted, the R.sup.4.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.4.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4.2 substituent group is substituted, the R.sup.4.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.4.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.4, R.sup.4.1, R.sup.4.2, and R.sup.4.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.4, R.sup.4.1, R.sup.4.2, and R.sup.4.3, respectively.
[0458] In embodiments, when R.sup.4A is substituted, R.sup.4A is substituted with one or more first substituent groups denoted by R.sup.4A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4A.1 substituent group is substituted, the R.sup.4A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.4A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4A.2 substituent group is substituted, the R.sup.4A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.4A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.4A, R.sup.4A.1, R.sup.4A.2, and R.sup.4A.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.4A, R.sup.4A.1, R.sup.4A.2, and R.sup.4A.3, respectively.
[0459] In embodiments, when R.sup.4B is substituted, R.sup.4B is substituted with one or more first substituent groups denoted by R.sup.4B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4B.1 substituent group is substituted, the R.sup.4B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.4B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4B.2 substituent group is substituted, the R.sup.4B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.4B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.4B, R.sup.4B.1, R.sup.4B.2, and R.sup.4B.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.4B, R.sup.4B.1, R.sup.4B.2, and R.sup.4B.3, respectively.
[0460] In embodiments, when R.sup.4A and R.sup.4B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.4A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4A.1 substituent group is substituted, the R.sup.4A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.4A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4A.2 substituent group is substituted, the R.sup.4A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.4A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.4A.1, R.sup.4A.2, and R.sup.4A.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.4A.1, R.sup.4A.2, and R.sup.4A.3, respectively.
[0461] In embodiments, when R.sup.4A and R.sup.4B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.4B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4B.1 substituent group is substituted, the R.sup.4B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.4B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4B.2 substituent group is substituted, the R.sup.4B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.4B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.4B.1, R.sup.4B.2, and R.sup.4B.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.4B.1, R.sup.4B.2, and R.sup.4B.3, respectively.
[0462] In embodiments, when R.sup.4C is substituted, R.sup.4C is substituted with one or more first substituent groups denoted by R.sup.4C.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4C.1 substituent group is substituted, the R.sup.4C.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.4C.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4C.2 substituent group is substituted, the R.sup.4C.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.4C.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.4C, R.sup.4C.1, R.sup.4C.2, and R.sup.4C.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.4C, R.sup.4C.1, R.sup.4C.2, and R.sup.4C.3, respectively.
[0463] In embodiments, when R.sup.4D, is substituted, R.sup.4D is substituted with one or more first substituent groups denoted by R.sup.4D.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4D.1 substituent group is substituted, the R.sup.4D.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.4D.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.4D.2 substituent group is substituted, the R.sup.4D.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.4D.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.4D, R.sup.4D.1, R.sup.4D.2, and R.sup.4D.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.4D, R.sup.4D.1, R.sup.4D.2, and R.sup.4D.3, respectively.
[0464] In embodiments, when R.sup.5 is substituted, R.sup.5 is substituted with one or more first substituent groups denoted by R.sup.5.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5.1 substituent group is substituted, the R.sup.5.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.5.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5.2 substituent group is substituted, the R.sup.5.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.5.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.5, R.sup.5.1, R.sup.5.2, and R.sup.5.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.5, R.sup.5.1, R.sup.5.2, and R.sup.5.3, respectively.
[0465] In embodiments, when R.sup.5A is substituted, R.sup.5A is substituted with one or more first substituent groups denoted by R.sup.5A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5A.1 substituent group is substituted, the R.sup.5A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.5A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5A.2 substituent group is substituted, the R.sup.5A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.5A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.5A, R.sup.5A.1, R.sup.5A.2, and R.sup.5A.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.5A, R.sup.5A.1, R.sup.5A.2, and R.sup.5A.3, respectively.
[0466] In embodiments, when R.sup.5B is substituted, R.sup.5B is substituted with one or more first substituent groups denoted by R.sup.5B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5B.1 substituent group is substituted, the R.sup.5B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.5B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5B.2 substituent group is substituted, the R.sup.5B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.5B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.5B, R.sup.5B.1, R.sup.5B.2, and R.sup.5B.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.5B, R.sup.5B.1, R.sup.5B.2, and R.sup.5B.3, respectively.
[0467] In embodiments, when R.sup.5A and R.sup.5B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.5A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5A.1 substituent group is substituted, the R.sup.5A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.5A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5A.2 substituent group is substituted, the R.sup.5A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.5A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.5A.1, R.sup.5A.2, and R.sup.5A.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.5A.1, R.sup.5A.2, and R.sup.5A.3, respectively.
[0468] In embodiments, when R.sup.5A and R.sup.5B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.5B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5B.1 substituent group is substituted, the R.sup.5B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.5B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5B.2 substituent group is substituted, the R.sup.5B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.5B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.5B.1, R.sup.5B.2, and R.sup.5B.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.5B.1, R.sup.5B.2, and R.sup.5B.3, respectively.
[0469] In embodiments, when R.sup.5C is substituted, R.sup.5C is substituted with one or more first substituent groups denoted by R.sup.5C.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5C.1 substituent group is substituted, the R.sup.5C.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.5C.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5C.2 substituent group is substituted, the R.sup.5C.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.5C.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.5C, R.sup.5C.1, R.sup.5C.2, and R.sup.5C.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.5C, R.sup.5C.1, R.sup.5C.2, and R.sup.5C.3, respectively.
[0470] In embodiments, when R.sup.5D is substituted, R.sup.5D is substituted with one or more first substituent groups denoted by R.sup.5D.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5D.1 substituent group is substituted, the R.sup.5D.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.5D.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.5D.2 substituent group is substituted, the R.sup.5D.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.5D.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.5D, R.sup.5D.1, R.sup.5D.2, and R.sup.5D.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.5D, R.sup.5D.1, R.sup.5D.2, and R.sup.5D.3, respectively.
[0471] In embodiments, when R.sup.6 is substituted, R.sup.6 is substituted with one or more first substituent groups denoted by R.sup.6.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.6.1 substituent group is substituted, the R.sup.6.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.6.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.6.2 substituent group is substituted, the R.sup.6.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.6.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.6, R.sup.6.1, R.sup.6.2, and R.sup.6.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.6, R.sup.6.1, R.sup.6.2, and R.sup.6.3, respectively.
[0472] In embodiments, when R.sup.6 and L.sup.1 substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl), the moiety is substituted with one or more first substituent groups denoted by R.sup.6.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.61 substituent group is substituted, the R.sup.6.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.6.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.6.2 substituent group is substituted, the R.sup.6.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.6.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.6.1, R.sup.6.2, and R.sup.63 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.6.1, R.sup.6.2, and R.sup.6.3, respectively.
[0473] In embodiments, when R.sup.6 and L.sup.1 substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl), the moiety is substituted with one or more first substituent groups denoted by L.sup.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an L.sup.1.1 substituent group is substituted, the L.sup.1.1 substituent group is substituted with one or more second substituent groups denoted by L.sup.1.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an L.sup.1.2 substituent group is substituted, the L.sup.1.2 substituent group is substituted with one or more third substituent groups denoted by L.sup.1.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, L.sup.1.1, L.sup.1.2, and L.sup.1.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to L.sup.1.1, L.sup.1.2, and L.sup.1.3, respectively.
[0474] In embodiments, when R.sup.6 and R.sup.7 substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.6.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.6.1 substituent group is substituted, the R.sup.6.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.6.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.6.2 substituent group is substituted, the R.sup.6.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.6.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.6.1, R.sup.6.2, and R.sup.6.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.6.1, R.sup.6.2, and R.sup.6.3, respectively.
[0475] In embodiments, when R.sup.6 and R.sup.7 substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.7.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7.1 substituent group is substituted, the R.sup.7.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.7.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7.2 substituent group is substituted, the R.sup.7.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.7.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.7.1, R.sup.7.2, and R.sup.7.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.7.1, R.sup.7.2, and R.sup.7.3, respectively.
[0476] In embodiments, when R.sup.7 is substituted, R.sup.7 is substituted with one or more first substituent groups denoted by R.sup.7.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7.1 substituent group is substituted, the R.sup.7.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.7.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7.2 substituent group is substituted, the R.sup.7.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.7.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.7, R.sup.7.1, R.sup.7.2, and R.sup.7.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.7, R.sup.7.1, R.sup.7.2, and R.sup.7.3, respectively.
[0477] In embodiments, when two adjacent R.sup.7 substituents are optionally joined to form a moiety that is substituted (e.g., a substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.7.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7.1 substituent group is substituted, the R.sup.7.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.7.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7.2 substituent group is substituted, the R.sup.7.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.7.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.7, R.sup.7.1, R.sup.7.2, and R.sup.7.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.7, R.sup.7.1, R.sup.7.2, and R.sup.7.3, respectively.
[0478] In embodiments, when R.sup.7A is substituted, R.sup.7A is substituted with one or more first substituent groups denoted by R.sup.7A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7A.1 substituent group is substituted, the R.sup.7A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.7A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7A.2 substituent group is substituted, the R.sup.7A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.7A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.7A, R.sup.7A.1, R.sup.7A.2, and R.sup.7A.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.7A, R.sup.71, R.sup.7A.2, and R.sup.7A.3, respectively.
[0479] In embodiments, when R.sup.7B is substituted, R.sup.7B is substituted with one or more first substituent groups denoted by R.sup.7B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7B.1 substituent group is substituted, the R.sup.7B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.7B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7B.2 substituent group is substituted, the R.sup.7B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.7B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.7B, R.sup.7B.1, R.sup.7B.2, and R.sup.7B.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.7B, R.sup.7B.1, R.sup.7B.2, and R.sup.7B.3, respectively.
[0480] In embodiments, when R.sup.7A and R.sup.7B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.7A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7A.1 substituent group is substituted, the R.sup.7A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.7A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7A.2 substituent group is substituted, the R.sup.7A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.7A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.7A.1, R.sup.7A.2, and R.sup.7A.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.7A.1, R.sup.7A.2, and R.sup.7A.3, respectively.
[0481] In embodiments, when R.sup.7A and R.sup.7B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.7B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7B.1 substituent group is substituted, the R.sup.7B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.7B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7B.2 substituent group is substituted, the R.sup.7B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.7B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.7B.1, R.sup.7B.2, and R.sup.7B.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.7B.1, R.sup.7B.2, and R.sup.7B.3, respectively.
[0482] In embodiments, when R.sup.7C is substituted, R.sup.7C is substituted with one or more first substituent groups denoted by R.sup.7C.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7C.1 substituent group is substituted, the R.sup.7C.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.7C.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7C.2 substituent group is substituted, the R.sup.7C.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.7C.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.7C, R.sup.7C.1, R.sup.7C.2, and R.sup.7C.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.7C, R.sup.7C.1, R.sup.7C.2, and R.sup.7C.3, respectively.
[0483] In embodiments, when R.sup.7D is substituted, R.sup.7D is substituted with one or more first substituent groups denoted by R.sup.7D.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7D.1 substituent group is substituted, the R.sup.7D.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.7D.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.7D.2 substituent group is substituted, the R.sup.7D.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.7D.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.7D, R.sup.7D.1, R.sup.7D.2, and R.sup.7D.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.7D, R.sup.7D.1, R.sup.7D.2, and R.sup.7D.3, respectively.
[0484] In embodiments, when R.sup.15 is substituted, R.sup.15 is substituted with one or more first substituent groups denoted by R.sup.15.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15.1 substituent group is substituted, the R.sup.15.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.15.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15.2 substituent group is substituted, the R.sup.15.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.15.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.15, R.sup.15.1, R.sup.15.2, and R.sup.15.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.15, R.sup.15.1, R.sup.15.2, and R.sup.15.3, respectively.
[0485] In embodiments, when R.sup.15A is substituted, R.sup.15A is substituted with one or more first substituent groups denoted by R.sup.15A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15A.1 substituent group is substituted, the R.sup.15A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.15A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15A.2 substituent group is substituted, the R.sup.15A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.15A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.15A, R.sup.15A.1, R.sup.15A.2, and R.sup.15A.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.15A, R.sup.15A.1, R.sup.15A.2, and R.sup.15A.3, respectively.
[0486] In embodiments, when R.sup.15B is substituted, R.sup.15B is substituted with one or more first substituent groups denoted by R.sup.15B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15B.1 substituent group is substituted, the R.sup.15B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.15B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15B.2 substituent group is substituted, the R.sup.15B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.15B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.15B, R.sup.15B.1, R.sup.15B.2, and R.sup.15B.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.15B, R.sup.15B.1, R.sup.15B.2 and R.sup.15.3, respectively.
[0487] In embodiments, when R.sup.15A and R.sup.15B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.15A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15A.1 substituent group is substituted, the R.sup.15A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.15A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15A.2 substituent group is substituted, the R.sup.15A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.15A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.15A.1, R.sup.15A.2, and R.sup.15A.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.15A.1, R.sup.15A.2, and R.sup.15A.3, respectively.
[0488] In embodiments, when R.sup.15A and R.sup.15B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.15B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15B.1 substituent group is substituted, the R.sup.15B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.15B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15B.2 substituent group is substituted, the R.sup.15B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.15B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.15B.1, R.sup.15B.2, and R.sup.15B.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.15B.1, R.sup.15B.2, and R.sup.15B.3, respectively.
[0489] In embodiments, when R.sup.15C is substituted, R.sup.15C is substituted with one or more first substituent groups denoted by R.sup.15C.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15C.1 substituent group is substituted, the R.sup.15C.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.15C.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15C.2 substituent group is substituted, the R.sup.15C.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.15C.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.15C, R.sup.15C.1, R.sup.15C.2, and R.sup.15C.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.15C, R.sup.15C.1, R.sup.15C.2, and R.sup.15C.3, respectively.
[0490] In embodiments, when R.sup.15D is substituted, R.sup.15D is substituted with one or more first substituent groups denoted by R.sup.15D.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15D.1 substituent group is substituted, the R.sup.15D.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.15D.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.15D.2 substituent group is substituted, the R.sup.15D.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.15D.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.15D, R.sup.15D.1, R.sup.15D.2, and R.sup.15D.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.15D, R.sup.15D.1, R.sup.15D.2 and R.sup.15D.3, respectively.
[0491] In embodiments, when R.sup.16 is substituted, R.sup.16 is substituted with one or more first substituent groups denoted by R.sup.16.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16.1 substituent group is substituted, the R.sup.16.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.16.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16.2 substituent group is substituted, the R.sup.16.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.163 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.16, R.sup.16.1, R.sup.16.2, and R.sup.16.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.16, R.sup.16.1, R.sup.16.2, and R.sup.16.3, respectively.
[0492] In embodiments, when R.sup.16A is substituted, R.sup.16A is substituted with one or more first substituent groups denoted by R.sup.16A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16A.1 substituent group is substituted, the R.sup.16A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.16A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16A.2 substituent group is substituted, the R.sup.16A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.16A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.16A, R.sup.16A.1, R.sup.16A.2, and R.sup.16A.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.16A, R.sup.16A.1, R.sup.16A.2, and R.sup.16A.3, respectively.
[0493] In embodiments, when R.sup.16B is substituted, R.sup.16B is substituted with one or more first substituent groups denoted by R.sup.16B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16B.1 substituent group is substituted, the R.sup.16B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.16B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16B.2 substituent group is substituted, the R.sup.16B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.16B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.16B, R.sup.16B.1, R.sup.16B.2, and R.sup.16B.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.16B, R.sup.16B.1, R.sup.16B.2 and R.sup.16.3, respectively.
[0494] In embodiments, when R.sup.16A and R.sup.16B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.16A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16A.1 substituent group is substituted, the R.sup.16A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.6A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16A.2 substituent group is substituted, the R.sup.16A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.16A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.16A.1, R.sup.16A.2, and R.sup.16A.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.16A.1, R.sup.16A.2, and R.sup.16A.3, respectively.
[0495] In embodiments, when R.sup.16A and R.sup.16B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.16B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16B.1 substituent group is substituted, the R.sup.16B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.16B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16B.2 substituent group is substituted, the R.sup.16B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.16B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.16B.1, R.sup.16B.2, and R.sup.16B.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.16B.1, R.sup.16B.2, and R.sup.16B.3, respectively.
[0496] In embodiments, when R.sup.16C is substituted, R.sup.16C is substituted with one or more first substituent groups denoted by R.sup.16C.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16C.1 substituent group is substituted, the R.sup.16C.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.16C.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16C.2 substituent group is substituted, the R.sup.16C.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.16C.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.16C, R.sup.16C.1, R.sup.16C.2, and R.sup.16C.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.16C, R.sup.16C.1, R.sup.16C.2 and R.sup.16C.3, respectively.
[0497] In embodiments, when R.sup.16D is substituted, R.sup.16D is substituted with one or more first substituent groups denoted by R.sup.16D.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16D.1 substituent group is substituted, the R.sup.16D.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.16D.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.16D.2 substituent group is substituted, the R.sup.16D.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.16D.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.16D, R.sup.16D.1, R.sup.16D.2, and R.sup.16D.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.16D, R.sup.16D.1, R.sup.16D.2, and R.sup.16D.3, respectively.
[0498] In embodiments, when R.sup.17 is substituted, R.sup.17 is substituted with one or more first substituent groups denoted by R.sup.17.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17.1 substituent group is substituted, the R.sup.17.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.17.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17.2 substituent group is substituted, the R.sup.17.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.17.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.17, R.sup.17.1, R.sup.17.2, and R.sup.17.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.17, R.sup.17.1, R.sup.17.2, and R.sup.17.3, respectively.
[0499] In embodiments, when R.sup.17A is substituted, R.sup.17A is substituted with one or more first substituent groups denoted by R.sup.17A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17A.1 substituent group is substituted, the R.sup.17A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.17A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17A.2 substituent group is substituted, the R.sup.17A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.17A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.17A, R.sup.17A.1, R.sup.17A.2, and R.sup.17A.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.17A, R.sup.17A.1, R.sup.17A.2, and R.sup.17A.3, respectively.
[0500] In embodiments, when R.sup.17B is substituted, R.sup.17B is substituted with one or more first substituent groups denoted by R.sup.17B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17B.1 substituent group is substituted, the R.sup.17B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.17B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17B.2 substituent group is substituted, the R.sup.17B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.17B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.17B, R.sup.17B.1, R.sup.17B.2, and R.sup.17B.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.17B, R.sup.17B.1, R.sup.17B.2, and R.sup.17B.3, respectively.
[0501] In embodiments, when R.sup.17A and R.sup.17B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.17A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17A.1 substituent group is substituted, the R.sup.17A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.17A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17A.2 substituent group is substituted, the R.sup.17A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.17A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.17A.1, R.sup.17A.2, and R.sup.17A.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.17A.1, R.sup.17A.2, and R.sup.17A.3, respectively.
[0502] In embodiments, when R.sup.17A and R.sup.17B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.17B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17B.1 substituent group is substituted, the R.sup.17B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.17B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17B.2 substituent group is substituted, the R.sup.17B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.17B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.17B.1, R.sup.17B.2, and R.sup.17B.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.17B.1, R.sup.17B.2, and R.sup.17B.3, respectively.
[0503] In embodiments, when R.sup.17C is substituted, R.sup.17C is substituted with one or more first substituent groups denoted by R.sup.17C.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17C.1 substituent group is substituted, the R.sup.17C.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.17C.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17C.2 substituent group is substituted, the R.sup.17C.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.17C.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.17C, R.sup.17C.1, R.sup.17C.2, and R.sup.17C.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.17C, R.sup.17C.1, R.sup.17C.2 and R.sup.17C.3, respectively.
[0504] In embodiments, when R.sup.17D is substituted, R.sup.17D is substituted with one or more first substituent groups denoted by R.sup.17D.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17D.1 substituent group is substituted, the R.sup.17D.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.17D.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.17D.2 substituent group is substituted, the R.sup.17D.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.17D.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.17D, R.sup.17D.1, R.sup.17D.2, and R.sup.17D.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.17D, R.sup.17D.1, R.sup.17D.2 and R.sup.17D.3, respectively.
[0505] In embodiments, when R.sup.18 is substituted, R.sup.18 is substituted with one or more first substituent groups denoted by R.sup.18.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18.1 substituent group is substituted, the R.sup.18.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.18.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18.2 substituent group is substituted, the R.sup.18.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.18.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.18, R.sup.18.1, R.sup.18.2, and R.sup.18.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.18, R.sup.18.1, R.sup.18.2, and R.sup.18.3, respectively.
[0506] In embodiments, when R.sup.18A is substituted, R.sup.18A is substituted with one or more first substituent groups denoted by R.sup.18A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18A.1 substituent group is substituted, the R.sup.18A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.18A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18A.2 substituent group is substituted, the R.sup.18A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.18A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.18A, R.sup.18A.1, R.sup.18A.2, and R.sup.18A.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.18A, R.sup.18A.1, R.sup.18A.2 and R.sup.18A.3, respectively.
[0507] In embodiments, when R.sup.18B is substituted, R.sup.18B is substituted with one or more first substituent groups denoted by R.sup.18B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18B.1 substituent group is substituted, the R.sup.18B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.18B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18B.2 substituent group is substituted, the R.sup.18B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.18B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.18B, R.sup.18B.1, R.sup.18B.2, and R.sup.18B.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.18B, R.sup.18B.1, R.sup.18B.2, and R.sup.18B.3, respectively.
[0508] In embodiments, when R.sup.18A and R.sup.18B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.18A.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18A.1 substituent group is substituted, the R.sup.18A.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.18A.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18A.2 substituent group is substituted, the R.sup.18A.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.18A.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.18A.1, R.sup.18A.2, and R.sup.18A.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.18A.1, R.sup.18A.2, and R.sup.18A.3, respectively.
[0509] In embodiments, when R.sup.18A and R.sup.18B substituents bonded to the same nitrogen atom are optionally joined to form a moiety that is substituted (e.g., a substituted heterocycloalkyl or substituted heteroaryl), the moiety is substituted with one or more first substituent groups denoted by R.sup.18B.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18B.1 substituent group is substituted, the R.sup.18B.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.18B.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18B.2 substituent group is substituted, the R.sup.18B.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.18B.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.18B.1, R.sup.18B.2, and R.sup.18B.3 have values corresponding to the values of R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.18B.1, R.sup.18B.2, and R.sup.18B.3, respectively.
[0510] In embodiments, when R.sup.18C is substituted, R.sup.18C is substituted with one or more first substituent groups denoted by R.sup.18C.1 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18C.1 substituent group is substituted, the R.sup.18C.1 substituent group is substituted with one or more second substituent groups denoted by R.sup.18C.2 as explained in the definitions section above in the description of first substituent group(s). In embodiments, when an R.sup.18C.2 substituent group is substituted, the R.sup.18C.2 substituent group is substituted with one or more third substituent groups denoted by R.sup.18C.3 as explained in the definitions section above in the description of first substituent group(s). In the above embodiments, R.sup.18C, R.sup.18C.1, R.sup.18C.2, and R.sup.18C.3 have values corresponding to the values of R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3, respectively, as explained in the definitions section above in the description of first substituent group(s), wherein R.sup.WW, R.sup.WW.1, R.sup.WW.2, and R.sup.WW.3 correspond to R.sup.18C, R.sup.18C.1, R.sup.18C.2, and R.sup.18C.3, respectively.
[0511] In embodiments, the compound has the formula:
##STR00042## ##STR00043## ##STR00044## ##STR00045## ##STR00046##
[0512] In embodiments, the compound has the formula:
##STR00047##
In embodiments, the compound has the formula:
##STR00048##
In embodiments, the compound has the formula
##STR00049##
In embodiments, the compound has the formula:
##STR00050##
In embodiments, the compound has the formula
##STR00051##
In embodiments, the compound has the formula:
##STR00052##
In embodiments, the compound has the formula:
##STR00053##
In embodiments, the compound has the formula:
##STR00054##
In embodiments, the compound has the formula:
##STR00055##
In embodiments, the compound has the formula:
##STR00056##
In embodiments, the compound has the formula:
##STR00057##
In embodiments, the compound has the formula:
##STR00058##
In embodiments, the compound has the formula:
##STR00059##
In embodiments, the compound has the formula:
##STR00060##
In embodiments, the compound has the formula:
##STR00061##
In embodiments, the compound has the formula:
##STR00062##
In embodiments, the compound has the formula:
##STR00063##
In embodiments, the compound has the formula:
##STR00064##
In embodiments, the compound has the formula:
##STR00065##
In embodiments, the compound has the formula:
##STR00066##
In embodiments, the compound has the formula:
##STR00067##
In embodiments, the compound has the formula
##STR00068##
In embodiments, the compound has the formula:
##STR00069##
In embodiments, the compound has the formula:
##STR00070##
In embodiments, the compound has the formula:
##STR00071##
In embodiments, the compound has the formula:
##STR00072##
In embodiments, the compound has the formula:
##STR00073##
In embodiments, the compound has the formula:
##STR00074##
In embodiments, the compound has the formula:
##STR00075##
In embodiments, the compound has the formula:
##STR00076##
In embodiments, the compound has the formula:
##STR00077##
In embodiments, the compound has the formula:
##STR00078##
In embodiments, the compound has the formula:
##STR00079##
In embodiments, the compound has the formula:
##STR00080##
In embodiments, the compound has the formula:
##STR00081##
In embodiments, the compound has the formula:
##STR00082##
In embodiments, the compound has the formula:
##STR00083##
In embodiments, the compound has the formula:
##STR00084##
In embodiments, the compound has the formula:
##STR00085##
In embodiments, the compound has the formula:
##STR00086##
In embodiments, the compound has the formula:
##STR00087##
In embodiments, the compound has the formula:
##STR00088##
In embodiments, the compound has the formula:
##STR00089##
In embodiments, the compound has the formula:
##STR00090##
In embodiments, the compound has the formula:
##STR00091##
In embodiments, the compound has the formula:
##STR00092##
In embodiments, the compound has the formula:
##STR00093##
In embodiments, the compound has the formula:
##STR00094##
In embodiments, the compound has the formula:
##STR00095##
In embodiments, the compound has the formula:
##STR00096##
In embodiments, the compound has the formula:
##STR00097##
In embodiments, the compound has the formula:
##STR00098##
In embodiments, the compound has the formula:
##STR00099##
[0513] As used herein, the labels CAT335 and ML337 are used interchangeably, and refer to the structure having the formula:
##STR00100##
[0514] As used herein, the labels CAT335a and ML337a are used interchangeably, and refer to the structure having the formula:
##STR00101##
[0515] As used herein, the labels CAT335b and ML337b are used interchangeably, and refer to the structure having the formula:
##STR00102##
[0516] In embodiments, the compound is useful as a comparator compound. In embodiments, the comparator compound can be used to assess the activity of a test compound as set forth in an assay described herein (e.g., in the examples section, figures, or tables).
[0517] In embodiments, the compound is a compound as described herein, including in embodiments. In embodiments the compound is a compound described herein (e.g., in the examples section, figures, tables, or claims).
III. Modified Proteins
[0518] In an aspect is provided a K.sub.2P family protein or homolog thereof including a cysteine residue at an amino position corresponding to position 131 of TREK-1. In embodiments is provided a K.sub.2P family protein including a cysteine residue at an amino position corresponding to position 131 of TREK-1. In embodiments is provided a K2P family protein including a cysteine residue at an amino position corresponding to position 131 of TREK-1 and a phenylalanine at an amino acid position corresponding to position 286 of TREK-1. In embodiments is provided a K2P family protein including a cysteine residue at an amino position corresponding to position 131 of TREK-1 and no other mutations relative to the wild type sequence of said K2P family protein. In embodiments is provided a K2P family protein including a cysteine residue at an amino position corresponding to position 131 of TREK-1 and a phenylalanine at an amino acid position corresponding to position 286 of TREK-1 and no other mutations relative to the wild type sequence of said K2P family protein.
[0519] In embodiments, the K.sub.2P family protein is a TREK family protein. In embodiments, the TREK family protein is a TREK-1 protein, a TREK-2 protein, or a TRAAK protein. In embodiments, the K.sub.2P family protein is a THIK-1 protein or a THIK-2 protein. In embodiments, the K.sub.2P family protein is a TWIK-1 protein, a TWIK-2 protein, or a KCNK7 protein. In embodiments, the K.sub.2P family protein is a TRESK protein. In embodiments, the K.sub.2P family protein is a TASK-1 protein, a TASK-3 protein, or a TASK-5 protein. In embodiments, the K.sub.2P family protein is a TALK-1 protein, a TALK-2 protein, or a TASK-2 protein.
[0520] In embodiments, provided herein are modified TREK family proteins comprising a cysteine residue. In embodiments, the cysteine residue is not found in a natural TREK family protein. In embodiments, the cysteine residue is positioned at an amino position corresponding to position 131 of TREK-1. In embodiments is provided a TREK family protein including a cysteine residue at an amino position corresponding to position 131 of TREK-1. In embodiments is provided aTREK family protein including a cysteine residue at an amino position corresponding to position 131 of TREK-1 and a phenylalanine at an amino acid position corresponding to position 286 of TREK-1. In embodiments is provided a TREK family protein including a cysteine residue at an amino position corresponding to position 131 of TREK-1 and no other mutations relative to the wild type sequence of said TREK family protein. In embodiments is provided a TREK family protein including a cysteine residue at an amino position corresponding to position 131 of TREK-1 and a phenylalanine at an amino acid position corresponding to position 286 of TREK-1 and no other mutations relative to the wild type sequence of said TREK family protein. In embodiments, the TREK family protein is a TREK-1 protein, a TREK-2 protein or a TRAAK protein. In embodiments, the TREK family protein is a TREK-1 protein. In embodiments, the TREK family protein is a TREK-2 protein. In embodiments, the TREK family protein is a TRAAK protein.
[0521] In embodiments, the TREK-1 protein comprises SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 1. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 1.
[0522] In embodiments, the TREK-1 protein comprises SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 2. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 2.
[0523] In embodiments, the TREK-1 protein comprises SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 3. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 3.
[0524] In embodiments, the TREK-1 protein comprises SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 4. In embodiments, the TREK-1 protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 4.
[0525] In embodiments, the TREK-2 protein comprises SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 5. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 5.
[0526] In embodiments, the TREK-2 protein comprises SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 6. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 6.
[0527] In embodiments, the TREK-2 protein comprises SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 7. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 7.
[0528] In embodiments, the TREK-2 protein comprises SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 8. In embodiments, the TREK-2 protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 8.
[0529] In embodiments, the TRAAK protein comprises SEQ ID NO: 9. In embodiments, the TRAAK protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 9. In embodiments, the TRAAK protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 9.
[0530] In embodiments, the TRAAK protein comprises SEQ ID NO: 10. In embodiments, the TRAAK protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 10. In embodiments, the TRAAK protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 10.
[0531] In embodiments, the TRAAK protein comprises SEQ ID NO: 11. In embodiments, the TRAAK protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 11. In embodiments, the TRAAK protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 11.
[0532] In embodiments, the TRAAK protein comprises SEQ ID NO: 12. In embodiments, the TRAAK protein comprises a 100 amino acid contiguous sequence of SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 80% identity to SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 80% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 85% identity to SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 85% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 90% identity to SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 90% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 95% identity to SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 95% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 96% identity to SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 96% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 97% identity to SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 97% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 98% identity to SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 98% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 99% identity to SEQ ID NO: 12. In embodiments, the TRAAK protein comprises an amino acid sequence that has 99% identity to a 100 amino acid contiguous sequence of SEQ ID NO: 12.
IV. Methods of Treatment
[0533] Provided herein, inter alia, are methods for treating a disease or adverse condition related to low TREK family protein activity in a subject in need thereof. The disclosed methods comprise administering to the subject a nucleic acid encoding a TREK family protein as provided herein (e.g. TREK-1, TREK-2 or TRAAK protein) and a TREK family protein agonist as provided herein. In embodiments, the TREK family protein agonist comprises a cysteine binding moiety capable of covalently binding the TREK family protein at the modified cysteine residue. In embodiments, the nucleic acid encoding a TREK family protein as provided herein and the TREK family protein agonist are provided in an effective amount, also referred to herein as a combined effective amount. In embodiments, the nucleic acid encoding a TREK family protein as provided herein and the TREK family protein agonist are provided in a therapeutically effective amount, also referred to herein as a combined therapeutically effective amount. In embodiments, the nucleic acid encoding a TREK family protein as provided herein is provided in an effective amount (e.g. a therapeutically effective amount). In embodiments, the TREK family protein agonist as provided herein is provided in an effective amount (e.g. a therapeutically effective amount).
[0534] In embodiments, the nucleic acid is within a viral particle. In embodiments, the viral particle is an inactivated or genetically modified human papillomavirus, rhinovirus, hepatitis B virus, or herpesvirus. In embodiments, the viral particle is an inactivated or genetically modified human papillomavirus. In embodiments, the viral particle is an inactivated or genetically modified rhinovirus. In embodiments, the viral particle is an inactivated or genetically modified hepatitis B virus. In embodiments, the viral particle is an inactivated or genetically modified herpesvirus. In embodiments, the viral protein encoding the nucleic acid encoding a TREK family protein as provided herein and a TREK family protein agonist is provided in an effective amount (e.g. a therapeutically effective amount).
[0535] In embodiments, the TREK family protein agonist is a short-hairpin RNA (shRNA), a small interference RNA (siRNA), a piwi-interacting RNA (piRNA), a microRNA (miRNA), an antisense oligonucleotide, such as a GapmeR or a morpholinooligonucleotide, a CRISPR Cas guide RNA (gRNA), a small molecule compound, or an antibody.
[0536] In embodiments, the TREK family protein agonist is a short-hairpin RNA (shRNA).
[0537] In embodiments, the TREK family protein agonist is a small interference RNA (siRNA).
[0538] In embodiments, the TREK family protein agonist is a piwi-interacting RNA (piRNA).
[0539] In embodiments, the TREK family protein agonist is a microRNA (miRNA).
[0540] In embodiments, the TREK family protein agonist is an antisense oligonucleotide.
[0541] In embodiments, the TREK family protein agonist is a GapmeR.
[0542] In embodiments, the TREK family protein agonist is a morpholinooligonucleotide.
[0543] In embodiments, the TREK family protein agonist is a CRISPR Cas guide RNA (gRNA). In embodiments, the CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA. In embodiments, the CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
[0544] In embodiments, the TREK family protein agonist is an antibody.
[0545] In embodiments, the TREK family protein agonist is a small molecule compound of the structural Formula (I), or a pharmaceutically acceptable salt thereof, as described herein.
[0546] In embodiments, the methods provided herein can be used to treat or prevent a disorder, disease, or condition, such as a disease, disorder or condition related to low TREK family protein activity, in a subject in need thereof. Exemplary diseases, disorders and conditions include, but are not limited to, chronic pain, nerve injury, insomnia, lack of sleep, high intraocular pressure, headache, depression, pulmonary hypertension, lung injury, and decompression sickness. In embodiments, the nerve injury is an injury of the dorsal ganglion nerve.
[0547] In embodiments, provided herein are methods of treating a disease or adverse condition related to low TREK family protein activity in a subject in need thereof The disclosed methods comprise administering to the subject a gene editing system capable of mutating a TREK family protein, by inserting a cysteine residue at an amino position corresponding to position 131 of TREK-1, and a TREK family protein agonist. In embodiments, the TREK family protein agonist comprises a cysteine binding moiety that is capable of covalently binding the TREK family protein at the modified cysteine residue.
[0548] In embodiments, the gene editing system is a CRISPR Cas guide RNA (gRNA), a transcription activator-like effector nuclease (TALEN), or a zinc-finger nuclease (ZFN). In embodiments, the gene editing system is a CRISPR Cas guide RNA (gRNA). In embodiments, the CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA. In embodiments, the CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA. In embodiments, the gene editing system is a transcription activator-like effector nuclease (TALEN). In embodiments, the gene editing system is a zinc-finger nuclease (ZFN).
[0549] In embodiments, the cysteine binding moiety is:
##STR00103##
[0550] Additionally provided herein are methods for increasing TREK family protein activity in a tissue, such as a mammal or human tissue. The disclosed methods comprise administering to the tissue a nucleic acid encoding a TREK family protein as provided herein and a TREK family protein agonist. In embodiments, the TREK family protein agonist comprises a cysteine binding moiety capable of covalently binding the TREK family protein at the modified cysteine residue.
[0551] In embodiments, the tissue is a brain, heart, smooth muscle, nerve, nerve ganglia, eye, endocrine, pancreas, prostate, or sensory organ tissue. In embodiments, the tissue is a brain. In embodiments, the tissue is a heart. In embodiments, the tissue is a smooth muscle. In embodiments, the tissue is a nerve. In embodiments, the tissue is a nerve ganglion. In embodiments, the tissue is a In embodiments, the tissue is an endocrine tissue. In embodiments, the tissue is is a pancreas. In embodiments, the tissue is an eye. In embodiments, the tissue is a prostate. In embodiments, the tissue is a sensory organ tissue.
[0552] In embodiments, the TREK family protein agonist is a short-hairpin RNA (shRNA), a small interference RNA (siRNA), a piwi-interacting RNA (piRNA), a microRNA (miRNA), an antisense oligonucleotide, such as a GapmeR or a morpholinooligonucleotide, a CRISPR Cas guide RNA (gRNA), a small molecule compound, or an antibody.
[0553] In embodiments, the TREK family protein agonist is a short-hairpin RNA (shRNA).
[0554] In embodiments, the TREK family protein agonist is a small interference RNA (siRNA).
[0555] In embodiments, the TREK family protein agonist is a piwi-interacting RNA (piRNA).
[0556] In embodiments, the TREK family protein agonist is a microRNA (miRNA).
[0557] In embodiments, the TREK family protein agonist is an antisense oligonucleotide.
[0558] In embodiments, the TREK family protein agonist is a GapmeR.
[0559] In embodiments, the TREK family protein agonist is a morpholinooligonucleotide.
[0560] In embodiments, the TREK family protein agonist is a CRISPR Cas guide RNA (gRNA). In embodiments, the CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA. In embodiments, the CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
[0561] In embodiments, the TREK family protein agonist is an antibody.
[0562] In embodiments, the TREK family protein agonist is a small molecule compound of the structural Formula (I), or a pharmaceutically acceptable salt thereof, as described herein.
[0563] The present invention contemplates the administration of the compounds described herein, and compositions (e.g., pharmaceutical salts, pharmaceutical composition) thereof, in any appropriate manner. Suitable routes of administration include oral, parenteral (e.g., intramuscular, intravenous, subcutaneous (e.g., injection or implant), intraperitoneal, intracisternal, intraarticular, intraperitoneal, intracerebral (intraparenchymal) and intracerebroventricular), nasal, vaginal, sublingual, intraocular, rectal, topical (e.g., transdermal), buccal and inhalation. Depot injections, which are generally administered subcutaneously or intramuscularly, may also be utilized to release the compounds disclosed herein over a defined period of time. In embodiments, the administration is oral, lingual, sublingual, parenteral, rectal, topical, transdermal or pulmonary administration.
[0564] The compounds of the present invention may be administered to a subject in an amount that is dependent upon, for example, the goal of administration (e.g., the degree of resolution desired); the age, weight, sex, and health and physical condition of the subject to which the formulation is being administered; the route of administration; and the nature of the disease, disorder, condition or symptom thereof. The dosing regimen may also take into consideration the existence, nature, and extent of any adverse effects associated with the agent(s) being administered. Effective dosage amounts and dosage regimens can readily be determined from, for example, safety and dose-escalation trials, in vivo studies (e.g., animal models), and other methods known to the skilled artisan.
[0565] In general, dosing parameters dictate that the dosage amount be less than an amount that could be irreversibly toxic to the subject (the maximum tolerated dose (MTD)) and not less than an amount required to produce a measurable effect on the subject. Such amounts are determined by, for example, the pharmacokinetic and pharmacodynamic parameters associated with ADME, taking into consideration the route of administration and other factors.
[0566] An effective dose (ED) is the dose or amount of an agent that produces a therapeutic response or desired effect in some fraction of the subjects taking it. The median effective dose or ED50 of an agent is the dose or amount of an agent that produces a therapeutic response or desired effect in 50% of the population to which it is administered. Although the ED50 is commonly used as a measure of reasonable expectance of an agent's effect, it is not necessarily the dose that a clinician might deem appropriate taking into consideration all relevant factors. Thus, in some situations the effective amount is more than the calculated ED50, in other situations the effective amount is less than the calculated ED50, and in still other situations the effective amount is the same as the calculated ED50.
[0567] In addition, an effective dose of the compounds of the present invention may be an amount that, when administered in one or more doses to a subject, produces a desired result relative to a healthy subject. For example, for a subject experiencing a particular disorder, an effective dose may be one that improves a diagnostic parameter, measure, marker and the like of that disorder by at least about 5%, at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or more than 90%, where 100% is defined as the diagnostic parameter, measure, marker and the like exhibited by a normal subject.
[0568] In embodiments, the compounds contemplated by the present invention may be administered at dosage levels of about 0.01 mg/kg to about 50 mg/kg, or about 1 mg/kg to about 25 mg/kg, of subject body weight per day, one, two, three, four or more times a day, to obtain the desired therapeutic effect. For administration of an oral agent, the compositions can be provided in the form of tablets, capsules and the like containing from 0.05 to 1000 milligrams of the active ingredient, particularly 0.05, 0.1, 0.25, 0.5, 0.75, 1.0, 1.25, 1.5, 1.75, 2.0, 2.5, 5.0, 7.5, 10.0, 15.0, 20.0, 25.0, 50.0, 75.0, 100.0, 125.0, 150.0, 175.0, 200.0, 250.0, 300.0, 400.0, 500.0, 600.0, 750.0, 800.0, 900.0, and 1000.0 milligrams of the active ingredient. A pharmaceutically acceptable carrier(s), diluent(s) and/or excipient(s) may be present in an amount of from about 0.1 g to about 2.0 g.
[0569] In embodiments, the dosage of the desired compound is contained in a unit dosage form. The phrase unit dosage form refers to physically discrete units, each unit including a predetermined amount of the compound, sufficient to produce the desired effect. It will be appreciated that the parameters of a unit dosage form will depend on the particular agent and the effect to be achieved.
[0570] In embodiments, the TREK family protein and the TREK family protein agonist are administered in a combined effective amount and/or in a combined therapeutically effective amount to perform the methods described herein.
V. Pharmaceutical Compositions
[0571] Additionally provided herein are pharmaceutical compositions for preventing or treating a disease or adverse condition related to low TREK family protein activity in a subject in need thereof. The disclosed pharmaceutical compositions comprise an effective amount of a nucleic acid encoding a TREK family protein as provided herein, a TREK family protein agonist, and one or more excipients or additives.
[0572] In embodiments, the TREK family protein agonist comprises a cysteine binding moiety capable of covalently binding the TREK family protein at the modified cysteine residue.
[0573] In embodiments, the cysteine binding moiety is:
##STR00104##
[0574] In embodiments, the nucleic acid is within a viral particle. In embodiments, the viral particle is an inactivated or genetically modified human papillomavirus, rhinovirus, hepatitis B virus, or herpesvirus. In embodiments, the viral particle is an inactivated or genetically modified human papillomavirus. In embodiments, the viral particle is an inactivated or genetically modified rhinovirus. In embodiments, the viral particle is an inactivated or genetically modified hepatitis B virus. In embodiments, the viral particle is an inactivated or genetically modified herpesvirus.
[0575] In embodiments, the TREK family protein agonist is a short-hairpin RNA (shRNA), a small interference RNA (siRNA), a piwi-interacting RNA (piRNA), a microRNA (miRNA), an antisense oligonucleotide, such as a GapmeR or a morpholinooligonucleotide, a CRISPR Cas guide RNA (gRNA), a small molecule compound, or an antibody.
[0576] In embodiments, the TREK family protein agonist is a short-hairpin RNA (shRNA).
[0577] In embodiments, the TREK family protein agonist is a small interference RNA (siRNA).
[0578] In embodiments, the TREK family protein agonist is a piwi-interacting RNA (piRNA).
[0579] In embodiments, the TREK family protein agonist is a microRNA (miRNA).
[0580] In embodiments, the TREK family protein agonist is an antisense oligonucleotide.
[0581] In embodiments, the TREK family protein agonist is a GapmeR.
[0582] In embodiments, the TREK family protein agonist is a morpholinooligonucleotide.
[0583] In embodiments, the TREK family protein agonist is a CRISPR Cas guide RNA (gRNA). In embodiments, the CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA. In embodiments, the CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
[0584] In embodiments, the TREK family protein agonist is a TREK family protein antibody.
[0585] In embodiments, the TREK family protein agonist is a small molecule compound of the structural Formula (I), or a pharmaceutically acceptable salt thereof, as described herein.
[0586] In embodiments, the pharmaceutical compositions provided herein can be used to treat or prevent a disorder, disease, or condition, such as a disease, disorder or condition related to low TREK family protein activity, in a subject in need thereof Exemplary diseases, disorders and conditions include, but are not limited to, chronic pain, nerve injury, insomnia, lack of sleep, high intraocular pressure, headache, depression, pulmonary hypertension, lung injury, and decompression sickness. In embodiments, the nerve injury is an injury of the dorsal ganglion nerve.
[0587] The pharmaceutical compositions may be used in the methods of the present disclosure; thus, for example, the pharmaceutical compositions can be administered ex vivo or in vivo to a subject in order to practice the therapeutic and prophylactic methods and uses described herein.
[0588] The pharmaceutical compositions of the present disclosure can be formulated to be compatible with the intended method or route of administration; exemplary routes of administration are set forth herein.
[0589] The disclosed pharmaceutical compositions may be in a form suitable for oral use, for example, as tablets, capsules, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsions, hard or soft capsules, or syrups, solutions, microbeads or elixirs. Pharmaceutical compositions intended for oral use may be prepared according to any method known to the art for the manufacture of pharmaceutical compositions, and such compositions may contain one or more agents such as, for example, sweetening agents, flavoring agents, coloring agents and preserving agents in order to provide pharmaceutically elegant and palatable preparations. Tablets, capsules and the like contain the active ingredient in admixture with non-toxic pharmaceutically acceptable excipients that are suitable for the manufacture thereof. These excipients may be, for example, diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents, for example, corn starch, or alginic acid; binding agents, for example starch, gelatin or acacia, and lubricating agents, for example magnesium stearate, stearic acid or talc.
[0590] The tablets, capsules and the like suitable for oral administration may be uncoated or coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action. For example, a time-delay material such as glyceryl monostearate or glyceryl distearate may be employed. They may also be coated by techniques known in the art to form osmotic therapeutic tablets for controlled release.
[0591] Additional agents include biodegradable or biocompatible particles or a polymeric substance such as polyesters, polyamine acids, hydrogel, polyvinyl pyrrolidone, polyanhydrides, polyglycolic acid, ethylene-vinylacetate, methylcellulose, carboxymethylcellulose, protamine sulfate, or lactide/glycolide copolymers, polylactide/glycolide copolymers, or ethylenevinylacetate copolymers in order to control delivery of an administered composition.
[0592] For example, the oral agent can be entrapped in microcapsules prepared by coacervation techniques or by interfacial polymerization, by the use of hydroxymethylcellulose or gelatin-microcapsules or poly(methylmethacrolate) microcapsules, respectively, or in a colloid drug delivery system. Colloidal dispersion systems include macromolecule complexes, nano-capsules, microspheres, microbeads, and lipid-based systems, including oil-in-water emulsions, micelles, mixed micelles, and liposomes. Methods for the preparation of the above-mentioned formulations will be apparent to those skilled in the art.
[0593] Formulations for oral use may also be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate, kaolin or microcrystalline cellulose, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example peanut oil, liquid paraffin, or olive oil.
[0594] Aqueous suspensions contain the active materials in admixture with excipients suitable for the manufacture thereof. Such excipients can be suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydroxy-propylmethylcellulose, sodium alginate, polyvinyl-pyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents, for example a naturally-occurring phosphatide (e.g., lecithin), or condensation products of an alkylene oxide with fatty acids (e.g., polyoxy-ethylene stearate), or condensation products of ethylene oxide with long chain aliphatic alcohols (e.g., for heptadecaethyleneoxycetanol), or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol (e.g., polyoxyethylene sorbitol monooleate), or condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides (e.g., polyethylene sorbitan monooleate). The aqueous suspensions may also contain one or more preservatives.
[0595] Oily suspensions may be formulated by suspending the active ingredient in a vegetable oil, for example arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as liquid paraffin. The oily suspensions may contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol. Sweetening agents, such as those set forth above, and flavoring agents may be added to provide a palatable oral preparation.
[0596] Dispersible powders and granules suitable for preparation of an aqueous suspension by the addition of water provide the active ingredient in admixture with a dispersing or wetting agent, and optionally one or more suspending agents and/or preservatives. Suitable dispersing or wetting agents and suspending agents are exemplified herein.
[0597] The pharmaceutical compositions of the present disclosure may also be in the form of oil-in-water emulsions. The oily phase may be a vegetable oil, for example olive oil or arachis oil, or a mineral oil, for example, liquid paraffin, or mixtures of these. Suitable emulsifying agents may be naturally occurring gums, for example, gum acacia or gum tragacanth; naturally occurring phosphatides, for example, soy bean, lecithin, and esters or partial esters derived from fatty acids; hexitol anhydrides, for example, sorbitan monooleate; and condensation products of partial esters with ethylene oxide, for example, polyoxyethylene sorbitan monooleate.
[0598] The pharmaceutical compositions typically comprise a therapeutically effective amount of a TREK protein family contemplated by the present disclosure, a therapeutically effective amount of a TREK family protein agonist described herein, and one or more pharmaceutically and physiologically acceptable formulation agents. Suitable pharmaceutically acceptable or physiologically acceptable diluents, carriers or excipients include, but are not limited to, antioxidants (e.g., ascorbic acid and sodium bisulfate), preservatives (e.g., benzyl alcohol, methyl parabens, ethyl or n-propyl, p-hydroxybenzoate), emulsifying agents, suspending agents, dispersing agents, solvents, fillers, bulking agents, detergents, buffers, vehicles, diluents, and/or adjuvants. For example, a suitable vehicle may be physiological saline solution or citrate-buffered saline, possibly supplemented with other materials common in pharmaceutical compositions for parenteral administration. Neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles. Those skilled in the art will readily recognize a variety of buffers that can be used in the pharmaceutical compositions and dosage forms contemplated herein. Typical buffers include, but are not limited to, pharmaceutically acceptable weak acids, weak bases, or mixtures thereof. As an example, the buffer components can be water soluble materials such as phosphoric acid, tartaric acids, lactic acid, succinic acid, citric acid, acetic acid, ascorbic acid, aspartic acid, glutamic acid, and salts thereof. Acceptable buffering agents include, for example, a Tris buffer; N-(2-Hydroxyethyl)piperazine-N-(2-ethanesulfonic acid) (HEPES); 2-(N-Morpholino)ethanesulfonic acid (MES); 2-(N-Morpholino)ethanesulfonic acid sodium salt (MES); 3-(N-Morpholino)propanesulfonic acid (MOPS); and N-tris[Hydroxymethyl]methyl-3-aminopropanesulfonic acid (TAPS).
[0599] After a pharmaceutical composition has been formulated, it may be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or dehydrated or lyophilized powder.
[0600] Such formulations may be stored either in a ready-to-use form, a lyophilized form requiring reconstitution prior to use, a liquid form requiring dilution prior to use, or other acceptable form. In some embodiments, the pharmaceutical composition is provided in a single-use container (e.g., a single-use vial, ampule, syringe, or autoinjector (similar to, e.g., an EpiPen)), whereas a multi-use container (e.g., a multi-use vial) is provided in other embodiments.
[0601] Formulations can also include carriers to protect the composition against rapid degradation or elimination from the body, such as a controlled release formulation, including liposomes, hydrogels, prodrugs and microencapsulated delivery systems. For example, a time-delay material such as glyceryl monostearate or glyceryl stearate alone, or in combination with a wax, may be employed. Any drug delivery apparatus may be used to deliver a Wnt/catenin signaling pathway inhibitor, including implants (e.g., implantable pumps) and catheter systems, slow injection pumps and devices, all of which are well known to the skilled artisan.
[0602] Depot injections, which are generally administered subcutaneously or intramuscularly, may also be utilized to release a compound disclosed herein over a defined period of time. Depot injections are usually either solid- or oil-based and generally comprise at least one of the formulation components set forth herein. One of ordinary skill in the art is familiar with possible formulations and uses of depot injections.
[0603] The pharmaceutical compositions may be in the form of a sterile injectable aqueous or oleagenous suspension. This suspension may be formulated according to the known art using those suitable dispersing or wetting agents and suspending agents mentioned herein.
[0604] The sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example, as a solution in 1,3-butane diol. Acceptable diluents, solvents and dispersion media that may be employed include water, Ringer's solution, isotonic sodium chloride solution, Cremophor EL (BASF, Parsippany, NJ) or phosphate buffered saline (PBS), ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol), and suitable mixtures thereof. In addition, sterile fixed oils are conventionally employed as a solvent or suspending medium; for this purpose, any bland fixed oil may be employed, including synthetic mono- or diglycerides. Moreover, fatty acids, such as oleic acid, find use in the preparation of injectables. Prolonged absorption of particular injectable formulations can be achieved by including an agent that delays absorption (e.g., aluminum monostearate or gelatin).
[0605] The present disclosure contemplates the administration of the compounds described herein in the form of suppositories for rectal administration. The suppositories can be prepared by mixing the drug with a suitable non-irritating excipient which is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug. Such materials include, but are not limited to, cocoa butter and polyethylene glycols.
[0606] In embodiments, the pharmaceutical compositions provided herein are suitable for oral, lingual, sublingual, parenteral, rectal, topical, transdermal or pulmonary administration.
[0607] In an aspect is provided a pharmaceutical composition including a compound described herein, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
[0608] In embodiments, the pharmaceutical composition includes an effective amount of the TREK family protein and an effective amount of a TREK agonist. In embodiments, the pharmaceutical composition includes a therapeutically effective amount of the TREK family protein and a therapeutically effective amount of a TREK agonist.
[0609] In embodiments, the TREK agonist is a compound of formula (I).
[0610] In embodiments, the pharmaceutical composition further includes a third agent. In embodiments, the third agent is an analgesic (for example, non-steroidal anti-inflammatory drugs, such as ibuprofen, naproxen, diclofenac, celecoxib, mefenamic acid, etoricoxib, indomethacin, and aspirin), opioid (e.g., morphine, fentanyl, hydrocodone, methadone, buprenorphine, oxycodone, codeine, tramadol, or tapendatol), antibiotic, or anticonvulsant, such as Gabapentin. In embodiments, the third agent is an anesthetic. In embodiments, the third agent is a local anesthetic (e.g., bupivacaine). In embodiments, the pharmaceutical composition includes a therapeutically effective amount of the third agent.
VI. Embodiments
[0611] Embodiment P1. A compound having the formula (I):
##STR00105##
wherein: [0612] L is a bond, substituted or unsubstituted alkylene or substituted or unsubstituted heteroalkylene; [0613] R.sup.1 is independently is hydrogen, halogen, CX.sup.1.sub.3, CHX.sup.1.sub.2, CH.sub.2X.sup.1, OCX.sup.1.sub.3, OCHX.sup.1.sub.2, OCH.sub.2X.sup.1, CN, N.sub.3, SO.sub.n1R.sup.1A, SO.sub.v1NR.sup.1BR.sup.1C, NHNR.sup.1BR.sup.1C, ONR.sup.1BR.sup.1C, NHC(O)NHNR.sup.1BR.sup.1C, NHC(O)NR.sup.1BR.sup.1C, N(O).sub.m1, NR.sup.1BR.sup.1C, C(O)R.sup.1D, C(O)OR.sup.1D, C(O)NR.sup.1BR.sup.1C, OR.sup.1A, NR.sup.1BSO.sub.2R.sup.1A, NR.sup.1BC(O)R.sup.1D, NR.sup.1BC(O)OR.sup.1D, NR.sup.1BOR.sup.1D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0614] R.sup.2 is independently hydrogen, halogen, CX.sup.2.sub.3, CHX.sup.2.sub.2, CH.sub.2X.sup.2, OCX.sup.2.sub.3, OCHX.sup.2.sub.2, OCH.sub.2X.sup.2, CN, N.sub.3, SO.sub.n2R.sup.2A, SO.sub.v2NR.sup.2BR.sup.2C, NHNR.sup.2BR.sup.2C, ONR.sup.2BR.sup.2C, NHC(O)NHNR.sup.2BR.sup.2C, NHC(O)NR.sup.2BR.sup.2C, N(O).sub.m2, NR.sup.2BR.sup.2C, C(O)R.sup.2D, C(O)OR.sup.2D, C(O)NR.sup.2BR.sup.2C, OR.sup.2A, NR.sup.2BSO.sub.2R.sup.2A, NR.sup.2BC(O)R.sup.2D, NR.sup.2BC(O)OR.sup.2D, NR.sup.2BOR.sup.2D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0615] R.sup.3 is independently hydrogen, halogen, CX.sup.3.sub.3, CHX.sup.3.sub.2, CH.sub.2X.sup.3, OCX.sup.3.sub.3, OCHX.sup.3.sub.2, OCH.sub.2X.sup.3, CN, N.sub.3, SO.sub.n3R.sup.3A, SO.sub.v3NR.sup.3BR.sup.3C, NHNR.sup.3BR.sup.3C, ONR.sup.3BR.sup.3C, NHC(O)NHNR.sup.3BR.sup.3C, NHC(O)NR.sup.3BR.sup.3C, N(O).sub.m3, NR.sup.3BR.sup.3C, C(O)R.sup.3D, C(O)OR.sup.3D, C(O)NR.sup.3BR.sup.3C, OR.sup.3A, NR.sup.3BSO.sub.2R.sup.3A, NR.sup.3BC(O)R.sup.3D NR.sup.3BC(O)OR.sup.3D NR.sup.3BOR.sup.3D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0616] R.sup.4 is independently hydrogen, halogen, CX.sup.4.sub.3, CHX.sup.4.sub.2, CH.sub.2X.sup.4, OCX.sup.4.sub.3, OCHX.sup.4.sub.2, OCH.sub.2X.sup.4, CN, N.sub.3, SO.sub.n4R.sup.4A, SO.sub.v4NR.sup.4BR.sup.4C, NHNR.sup.4BR.sup.4C, ONR.sup.4BR.sup.4C, NHC(O)NHNR.sup.4BR.sup.4C, NHC(O)NR.sup.4BR.sup.4C, N(O).sub.m4, NR.sup.4BR.sup.4C, C(O)R.sup.4D, C(O)OR.sup.4D, C(O)NR.sup.4BR.sup.4C, OR.sup.4A, NR.sup.4BSO.sub.2R.sup.4A, NR.sup.4BC(O)R.sup.4D, NR.sup.4BC(O)OR.sup.4D, NR.sup.4BOR.sup.4D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0617] R.sup.S is independently hydrogen, halogen, CX.sup.53, CHX.sup.5.sub.2, CH.sub.2X.sup.5, OCX.sup.5.sub.3, OCHX.sup.5.sub.2, OCH.sub.2X.sup.5, CN, N.sub.3, SO.sub.n5R.sup.5A, SO.sub.v5NR.sup.5BR.sup.5C, NHNR.sup.SBR.sup.5C, ONR.sup.5BR.sup.5C, NHC(O)NHNR.sup.5BR.sup.5C, NHC(O)NR.sup.5BR.sup.5C, N(O).sub.m5, NR.sup.5BR.sup.5C, C(O)R.sup.5D, C(O)OR.sup.5D, C(O)NR.sup.5BR.sup.5C, OR.sup.5A, NR.sup.5BSO.sub.2R.sup.5A, NR.sup.5BC(O)R.sup.5D, NR.sup.5BC(O)OR.sup.5D, NR.sup.5BOR.sup.5D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0618] R.sup.6 is independently a substituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl; wherein R.sup.6 is optionally joined with L.sup.1 to form a substituted or unsubstituted heterocycloalkyl; [0619] R.sup.7 is independently halogen, CX.sup.7.sub.3, CHX.sup.7.sub.2, CH.sub.2X.sup.7, OCX.sup.7.sub.3, OCHX.sup.7.sub.2, OCH.sub.2X.sup.7, CN, N.sub.3, SO.sub.n7R.sup.7A, SO.sub.v7NR.sup.7BR.sup.7C, NHNR.sup.7BR.sup.7C, ONR.sup.7BR.sup.7C, NHC(O)NHNR.sup.7BR.sup.7C, NHC(O)NR.sup.7BR.sup.7C, N(O).sub.m7, NR.sup.7BR.sup.7C, C(O)R.sup.7D, C(O)OR.sup.7D, C(O)NR.sup.7BR.sup.7C, OR.sup.7A, NR.sup.7BSO.sub.2R.sup.7A, NR.sup.7BC(O)R.sup.7D, NR.sup.7BC(O)OR.sup.7D, NR.sup.7BOR.sup.7D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0620] R.sup.1A, R.sup.1B, Ric, RID, R.sup.2A, R.sup.2B, R.sup.2C, R.sup.2D, R.sup.3A, R.sup.3B, R.sup.3C, R.sup.3D, R.sup.4A, R.sup.4B, R.sup.4C, R.sup.4D, R.sup.5A, R.sup.5B, R.sup.5C, R.sup.5D, R.sup.7A, R.sup.7B, R.sup.7C, and R.sup.7D are independently hydrogen, halogen, CF.sub.3, Cl.sub.3, CBr.sub.3, CI.sub.3, COOH, CONH.sub.2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0621] X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, and X.sup.7 are independently halogen; [0622] n is an integer from 0 to 3; [0623] n1, n2, n3, n4, n5, and n7 is independently an integer from 0 to 4; [0624] m1, m2, m3, m4, m5, m7, v1, v2, v3, v4, v5, and v7 are independently 1 or 2; and [0625] R.sup.8 is a cysteine binding moiety or a serine binding moiety.
[0626] Embodiment P2. The compound of embodiment P1, wherein the cysteine binding moiety is:
##STR00106## [0627] wherein: [0628] R.sup.15, R.sup.16, R.sup.16, and R.sup.18 are independently hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl or substituted or unsubstituted 2 to 4 membered heteroalkyl; and [0629] X.sup.17 is halogen.
[0630] Embodiment P3. The compound of embodiment P2, wherein R.sup.15, R.sup.16, R.sup.16, and R.sup.18 are independently hydrogen or unsubstituted C.sub.1-C.sub.2 alkyl and X.sup.17 is chlorine.
[0631] Embodiment P4. The compound of embodiments P2 or P3, wherein the cysteine binding moiety is:
##STR00107##
[0632] Embodiment P5. The compound of embodiment P1, wherein the serine binding moiety is:
##STR00108## [0633] wherein: [0634] R.sup.15, R.sup.16, R.sup.16, and R.sup.8 are independently hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl or substituted or unsubstituted 2 to 4 membered heteroalkyl; and [0635] X.sup.17 is halogen.
[0636] Embodiment P6. The compound of embodiment P5, wherein R.sup.15, R.sup.16, R.sup.16, and R.sup.18 are independently hydrogen or unsubstituted C.sub.1-C.sub.2 alkyl and X.sup.17 is chlorine.
[0637] Embodiment P7. The compound of embodiments P5 or P6, wherein the serine binding moiety is:
##STR00109##
[0638] Embodiment P8. The compound of embodiment P1, wherein R.sup.1 is hydrogen or halogen.
[0639] Embodiment P9. The compound of embodiment P8, wherein R.sup.1 is Cl.
[0640] Embodiment P10. The compound of embodiment P1, wherein R.sup.2 is hydrogen or halogen.
[0641] Embodiment P11. The compound of embodiment P10, wherein R.sup.2 is hydrogen.
[0642] Embodiment P12. The compound of embodiment P10, wherein R.sup.2 is F or Cl.
[0643] Embodiment P13. The compound of embodiment P1, wherein R.sup.3 is halogen or C.sub.1-C.sub.4 substituted or unsubstituted alkynyl.
[0644] Embodiment P14. The compound of embodiment P13, wherein R.sup.3 is halogen.
[0645] Embodiment P15. The compound of embodiment P14, wherein R.sup.3 is Cl, Br, or I.
[0646] Embodiment P16. The compound of embodiment P13, wherein R.sup.3 is unsubstituted 1.sup.3,2.sup.3-ethyne.
[0647] Embodiment P17. The compound of embodiment P1, wherein R.sup.4 and R.sup.5 are independently hydrogen.
[0648] Embodiment P18. The compound of embodiment P1, wherein R.sup.6 is hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl or R.sup.6 and L.sup.1 are joined together to form a substituted or unsubstituted 5 to 7 membered heterocycloalkyl.
[0649] Embodiment P19. The compound of embodiment P18, wherein R.sup.6 is hydrogen.
[0650] Embodiment P20. The compound of embodiment P18, wherein R.sup.6 is unsubstituted methyl.
[0651] Embodiment P21. The compound of embodiment P18, wherein R.sup.6 is 5 to 7 membered heterocycloalkyl.
[0652] Embodiment P22. The compound of embodiment P1, wherein R.sup.6 is 1.sup.2-azepan-2-one, 1,4.sup.2-oxazepan-5-one, or 1.sup.2-piperidin-2-one.
[0653] Embodiment P23. The compound of embodiment P1, wherein R.sup.7 is a substituted or unsubstituted C.sub.1-C.sub.4 alkyl, substituted or unsubstituted 2 to 4 membered heteroalkyl, substituted or unsubstituted C.sub.3-C.sub.8 cycloalkyl, substituted or unsubstituted 3 to 8 membered heterocycloalkyl, substituted or unsubstituted C.sub.6-C.sub.10 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl.
[0654] Embodiment P24. The compound of embodiment P23, wherein R.sup.7 is an unsubstituted C.sub.1-C.sub.4 alkyl, unsubstituted 2 to 4 membered heteroalkyl, unsubstituted C.sub.3-C.sub.8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C.sub.6-C.sub.10 aryl, or unsubstituted 5 to 10 membered heteroaryl.
[0655] Embodiment P25. A TREK family protein or homolog thereof comprising a cysteine residue at an amino position corresponding to position 131 of TREK-1.
[0656] Embodiment P26. The TREK family protein or homolog thereof of embodiment P25, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein or a TRAKK protein.
[0657] Embodiment P27. The TREK Family protein of embodiment P26, wherein the TREK family protein comprises any one of SEQ ID NOS: 1-12.
[0658] Embodiment P28. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 1.
[0659] Embodiment P29. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 2.
[0660] Embodiment P30. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 3.
[0661] Embodiment P31. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 4.
[0662] Embodiment P32. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 5.
[0663] Embodiment P33. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 6.
[0664] Embodiment P34. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 7.
[0665] Embodiment P35. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 8.
[0666] Embodiment P36. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 9.
[0667] Embodiment P37. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 10.
[0668] Embodiment P38. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 11.
[0669] Embodiment P39. The TREK Family protein of embodiment P27, wherein the TREK family protein comprises SEQ ID NO: 12.
[0670] Embodiment P40. A method of treating a disease or adverse condition related to low TREK family protein activity in a subject in need thereof, the method comprising administering to the subject an effective amount of a nucleic acid encoding the TREK family protein of embodiment P25 and a therapeutically effective amount of a TREK family protein agonist, wherein said TREK family protein agonist comprises a cysteine binding moiety capable of covalently binding said TREK family protein at said cysteine residue.
[0671] Embodiment P41. The method of embodiment P40, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein or a TRAAK protein.
[0672] Embodiment P42. The method of embodiment P40, wherein said nucleic acid is within a viral particle.
[0673] Embodiment P43. The method of embodiment P42, wherein the viral particle is an inactivated or genetically modified human papillomavirus, rhinovirus, hepatitis B virus, or herpesvirus.
[0674] Embodiment P44. The method of embodiment P40, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA), a small interference RNA (siRNA), a piwi-interacting RNA (piRNA), a microRNA (miRNA), an antisense oligonucleotide, a morpholinooligonucleotide, a CRISPR Cas guide RNA (gRNA), a small molecule compound, an antibody, or a nucleic acid.
[0675] Embodiment P45. The method of embodiment P44, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA).
[0676] Embodiment P46. The method of embodiment P44, wherein said TREK family protein agonist is a small interference RNA (siRNA).
[0677] Embodiment P47. The method of embodiment P44, wherein said TREK family protein agonist is a piwi-interacting RNA (piRNA).
[0678] Embodiment P48. The method of embodiment P44, wherein said TREK family protein agonist is a microRNA (miRNA).
[0679] Embodiment P49. The method of embodiment P44, wherein said TREK family protein agonist is an antisense oligonucleotide.
[0680] Embodiment P50. The method of embodiment P44, wherein said TREK family protein agonist is a GapmeR.
[0681] Embodiment P51. The method of embodiment P44, wherein said TREK family protein agonist is a morpholinooligonucleotide.
[0682] Embodiment P52. The method of embodiment P44, wherein said TREK family protein agonist is a CRISPR Cas guide RNA (gRNA).
[0683] Embodiment P53. The method of embodiment P52, wherein said CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA.
[0684] Embodiment P54. The method of embodiment P52, wherein said CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
[0685] Embodiment P55. The method of embodiment P44, wherein said TREK family protein agonist is aTREK family protein antibody.
[0686] Embodiment P56. The method of embodiment P44, wherein said TREK family protein agonist is a nucleic acid binding said cysteine residue.
[0687] Embodiment P57. The method of embodiment P44, wherein said TREK family protein agonist is the compound of any one of embodiments P1-P24.
[0688] Embodiment P58. The method of any one of embodiments P40-P57, wherein the cysteine residue is at an amino position corresponding to position 131 of TREK-1.
[0689] Embodiment P59. The method of any one of embodiments P40-P58, wherein said disease or adverse condition is chronic pain, nerve injury, lack of sleep, high intraocular pressure, headache, depression, pulmonary hypertension, lung injury, or decompression sickness.
[0690] Embodiment P60. The method of embodiment P59, wherein the nerve injury is an injury of the dorsal ganglion nerve.
[0691] Embodiment P61. A method of treating a disease or adverse condition related to low TREK family protein activity in a subject in need thereof, the method comprising administering to said subject a gene editing system capable of mutating a TREK family protein to comprise a cysteine residue at an amino position corresponding to position 131 of TREK-1, and a TREK family protein agonist, wherein said TREK family protein agonist comprises a cysteine binding moiety that is capable of covalently binding said TREK family protein at said cysteine residue.
[0692] Embodiment P62. The method of embodiment P61, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein or a TRAAK protein.
[0693] Embodiment P63. The method of embodiment P61, wherein said gene editing system is a CRISPR Cas guide RNA (gRNA), a transcription activator-like effector nuclease (TALEN), or a zinc-finger nuclease (ZFN).
[0694] Embodiment P64. The method of embodiment P63, wherein said CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA.
[0695] Embodiment P65. The method of embodiment P63, wherein said CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
[0696] Embodiment P66. A method of increasing TREK family protein activity in a tissue, said method comprising administering to said tissue a nucleic acid encoding the TREK family protein of embodiment P25 and a TREK family protein agonist, wherein said TREK family protein agonist comprises a cysteine binding moiety capable of covalently binding said TREK family protein at said cysteine residue.
[0697] Embodiment P67. The method of embodiment P66, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein or a TRAAK protein.
[0698] Embodiment P68. The method of embodiment P66, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA), a small interference RNA (siRNA), a piwi-interacting RNA (piRNA), a microRNA (miRNA), an antisense oligonucleotide, a morpholinooligonucleotide, a CRISPR Cas guide RNA (gRNA), a small molecule compound, an antibody, or a nucleic acid.
[0699] Embodiment P69. The method of embodiment P68, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA).
[0700] Embodiment P70. The method of embodiment P68, wherein said TREK family protein agonist is a small interference RNA (siRNA).
[0701] Embodiment P71. The method of embodiment P68, wherein said TREK family protein agonist is a piwi-interacting RNA (piRNA).
[0702] Embodiment P72. The method of embodiment P68, wherein said TREK family protein agonist is a microRNA (miRNA).
[0703] Embodiment P73. The method of embodiment P68, wherein said TREK family protein agonist is an antisense oligonucleotide.
[0704] Embodiment P74. The method of embodiment P68, wherein said TREK family protein agonist is a GapmeR.
[0705] Embodiment P75. The method of embodiment P68, wherein said TREK family protein agonist is a morpholinooligonucleotide.
[0706] Embodiment P76. The method of embodiment P68, wherein said TREK family protein agonist is a CRISPR Cas guide RNA (gRNA).
[0707] Embodiment P77. The method of embodiment P76, wherein said CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA.
[0708] Embodiment P78. The method of embodiment P76, wherein said CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
[0709] Embodiment P79. The method of embodiment P68, wherein said TREK family protein agonist is aTREK family protein antibody.
[0710] Embodiment P80. The method of embodiment P61, wherein said TREK family protein agonist is a nucleic acid binding said cysteine residue.
[0711] Embodiment P81. The method of embodiment P61, wherein said TREK family protein agonist is the compound of any one of embodiments P1-P24.
[0712] Embodiment P82. The method of any one of embodiments P61-P81, wherein the cysteine residue is at an amino position corresponding to position 131 of TREK-1.
[0713] Embodiment P83. The method of embodiment P61, wherein said tissue is a brain, heart, nerve, nerve ganglia, eye, smooth muscle, endocrine, pancreas, prostate, or sensory organ tissue.
VII. ADDITIONAL EMBODIMENTS
[0714] Embodiment 1. A compound, or a pharmaceutically acceptable salt thereof, having the formula (I):
##STR00110##
wherein: [0715] L.sup.1 is a bond, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene; [0716] R.sup.1 is hydrogen, halogen, CX.sup.1.sub.3, CHX.sup.1.sub.2, CH.sub.2X.sup.1, OCX.sup.1.sub.3, OCHX.sup.1.sub.2, OCH.sub.2X.sup.1, CN, N.sub.3, SO.sub.n1R.sup.1A, SO.sub.v1NR.sup.1BR.sup.1C, NHNR.sup.1BR.sup.1C, ONR.sup.1BR.sup.1C, NHC(O)NHNR.sup.1BR.sup.1C, NHC(O)NR.sup.1BR.sup.1C, N(O).sub.m1, NR.sup.1BR.sup.1C, C(O)R.sup.1D, C(O)OR.sup.1D, C(O)NR.sup.1BR.sup.1C, OR.sup.1A, NR.sup.1BSO.sub.2R.sup.1A, NR.sup.1BC(O)R.sup.1D, NR.sup.1BC(O)OR.sup.1D, NR.sup.1BOR.sup.1D substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0717] R.sup.2 is hydrogen, halogen, CX.sup.2.sub.3, CHX.sup.2.sub.2, CH.sub.2X.sup.2, OCX.sup.2.sub.3, OCHX.sup.2.sub.2, OCH.sub.2X.sup.2, CN, N.sub.3, SO.sub.n2R.sup.2A, SO.sub.v2NR.sup.2BR.sup.2C, NHNR.sup.2BR.sup.2C, ONR.sup.2BR.sup.2C, NHC(O)NHNR.sup.2BR.sup.2C, NHC(O)NR.sup.2BR.sup.2C, N(O).sub.m2, NR.sup.2BR.sup.2C, C(O)R.sup.2D, C(O)OR.sup.2D, C(O)NR.sup.2BR.sup.2C, OR.sup.2A, NR.sup.2BSO.sub.2R.sup.2A, NR.sup.2BC(O)R.sup.2D, NR.sup.2BC(O)OR.sup.2D, NR.sup.2BOR.sup.2D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0718] R.sup.3 is hydrogen, halogen, CX.sup.3.sub.3, CHX.sup.3.sub.2, CH.sub.2X.sup.3, OCX.sup.3.sub.3, OCHX.sup.3.sub.2, OCH.sub.2X.sup.3, CN, N.sub.3, SO.sub.n3R.sup.3A, SO.sub.v3NR.sup.3BR.sup.3C, NHR.sup.3BR.sup.3C, ONR.sup.3BR.sup.3C, NHC(O)NHNR.sup.3BR.sup.3C, NHC(O)NR.sup.3BR.sup.3C, N(O).sub.m3, NR.sup.3BR.sup.3C, C(O)R.sup.3D, C(O)OR.sup.3D, C(O)NR.sup.3BR.sup.3C, OR.sup.3A, NR.sup.3BSO.sub.2R.sup.3A, NR.sup.3BC(O)R.sup.3D, NR.sup.3BC(O)OR.sup.3D NR.sup.3BOR.sup.3D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0719] R.sup.4 is hydrogen, halogen, CX.sup.4.sub.3, CHX.sup.4.sub.2, CH.sub.2X.sup.4, OCX.sup.4.sub.3, OCHX.sup.4.sub.2, OCH.sub.2X.sup.4, CN, N.sub.3, SO.sub.n4R.sup.4A, SO.sub.v4NR.sup.4BR.sup.4C, NR.sup.4BR.sup.4C, ONR.sup.4BR.sup.4C, NHC(O)NHNR.sup.4BR.sup.4C, NHC(O)NR.sup.4BR.sup.4C, N(O).sub.m4, NR.sup.4BR.sup.4C, C(O)R.sup.4D, C(O)OR.sup.4D, C(O)NR.sup.4BR.sup.4C, OR.sup.4A, NR.sup.4BSO.sub.2R.sup.4A, NR.sup.4BC(O)R.sup.4D, NR.sup.4BC(O)OR.sup.4D, NR.sup.4BOR.sup.4D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0720] R.sup.S is hydrogen, halogen, CX.sup.5.sub.3, CHX.sup.52, CH.sub.2X.sup.5, OCX.sup.5.sub.3, OCHX.sup.5.sub.2, OCH.sub.2X.sup.5, CN, N.sub.3, SO.sub.n5R.sup.5A, SO.sub.v5NR.sup.5BR.sup.5C, NHNR.sup.5BR.sup.5C, ONR.sup.5BR.sup.5C, NHC(O)NHNR.sup.5BR.sup.5C, NHC(O)NR.sup.5BR.sup.5C, N(O).sub.m5, NR.sup.5BR.sup.5C, C(O)R.sup.5D, C(O)OR.sup.5D, C(O)NR.sup.5BR.sup.5C, OR.sup.5A, NR.sup.5BSO.sub.2R.sup.5A, NR.sup.5BC(O)R.sup.5D, NR.sup.5BC(O)OR.sup.5D, NR.sup.5BOR.sup.5D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0721] R.sup.6 is hydrogen, substituted or unsubstituted alkyl, or substituted or unsubstituted heteroalkyl; or R.sup.6 is optionally joined with L.sup.1 to form a substituted or unsubstituted heterocycloalkyl; [0722] R.sup.7 is independently halogen, CX.sup.7.sub.3, CHX.sup.7.sub.2, CH.sub.2X.sup.7, OCX.sup.7.sub.3, OCHX.sup.7.sub.2, OCH.sub.2X.sup.7, CN, N.sub.3, SO.sub.n7R.sup.7A, SO.sub.v7NR.sup.7BR.sup.7C, , NR.sup.7BR.sup.7C, ONR.sup.7BR.sup.7C, NHC(O)NHNR.sup.7BR.sup.7C, NHC(O)NR.sup.7BR.sup.7C, N(O).sub.m7, NR.sup.7BR.sup.7C, C(O)R.sup.7D, C(O)OR.sup.7D, C(O)NR.sup.7BR.sup.7C, OR.sup.7A, NR.sup.7BSO.sub.2R.sup.7A, NR.sup.7BC(O)R.sup.7D, NR.sup.7BC(O)OR.sup.7D, NR.sup.7BOR.sup.7D, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0723] R.sup.1A, R.sup.1B, Ric, RID, R.sup.2A, R.sup.2B, R.sup.2C, R.sup.2D, R.sup.3A, R.sup.3B, R.sup.3C, R.sup.3D, R.sup.4A, R.sup.4B, R.sup.4C, R.sup.4D, R.sup.5A, R.sup.5B, R.sup.5C, R.sup.5D, R.sup.7A, R.sup.7B, R.sup.7C, and R.sup.7D are independently hydrogen, halogen, CF.sub.3, Cl.sub.3, CBr.sub.3, CI.sub.3, COOH, CONH.sub.2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0724] each X.sup.1, X.sup.2, X.sup.3, X.sup.4, X.sup.5, and X.sup.7 is independently halogen; [0725] n is an integer from 0 to 3; [0726] n1, n2, n3, n4, n5, and n7 are independently an integer from 0 to 4; [0727] m1, m2, m3, m4, m5, m7, v1, v2, v3, v4, v5, and v7 are independently 1 or 2; and [0728] R.sup.8 is a cysteine binding moiety or a serine binding moiety.
[0729] Embodiment 2. The compound of embodiment 1, wherein the cysteine binding moiety is:
##STR00111## [0730] wherein: [0731] R.sup.15 is hydrogen, halogen, CX.sup.15.sub.3, CHX.sup.15.sub.2, CH.sub.2X.sup.15, CN, SO.sub.n15R.sup.15D, SO.sub.v15NR.sup.15AR.sup.15B, NHNR.sup.15AR.sup.15B, ONR.sup.15AR.sup.15B, NHC(O)NHNR.sup.15AR.sup.15B, NHC(O)NR.sup.15AR.sup.15B, N(O).sub.m15, NR.sup.15AR.sup.15B, C(O)R.sup.15C, C(O)OR.sup.15C, C(O)NR.sup.15AR.sup.15B, OR.sup.15D, NR.sup.15ASO.sub.2R.sup.15D, NR.sup.15AC(O)R.sup.15C, NR.sup.15AC(O)OR.sup.15C, NR.sup.15AOR.sup.15C, OCX.sup.15.sub.3, OCHX.sup.15.sub.2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0732] R.sup.16 is hydrogen, halogen, CX.sup.16.sub.3, CHX.sup.16.sub.2, CH.sub.2X.sup.16, CN, SO.sub.n16R.sup.16D, SO.sub.v16NR.sup.16AR.sup.16B, NHNR.sup.16AR.sup.16B, ONR.sup.16AR.sup.16B, NHC(O)NHNR.sup.16AR.sup.16B, NHC(O)NR.sup.16AR.sup.16B, N(O).sub.m16, NR.sup.16AR.sup.16B C(O)R.sup.16C, C(O)OR.sup.16C, C(O)NR.sup.16AR.sup.16B, OR.sup.16D, NR.sup.16ASO.sub.2R.sup.16D, NR.sup.16AC(O)R.sup.16C, NR.sup.16AC(O)OR.sup.16C, NR.sup.16AOR.sup.16C, OCX.sup.16.sub.3, OCHX.sup.16.sub.2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0733] R.sup.17 is hydrogen, halogen, CX.sup.17.sub.3, CHX.sup.17.sub.2, CH.sub.2X.sup.17, CN, SO.sub.n17R.sup.17D, SO.sub.v17NR.sup.17AR.sup.17B, NHNR.sup.17AR.sup.17B, ONR.sup.17AR.sup.17B, NHC(O)NHNR.sup.17AR.sup.17B, NHC(O)NR.sup.17AR.sup.17B, N(O).sub.m17, NR.sup.17AR.sup.17B, C(O)R.sup.17C, C(O)OR.sup.17C, C(O)NR.sup.17AR.sup.17B, OR.sup.17D, NR.sup.17ASO.sub.2R.sup.17D, NR.sup.17AC(O)R.sup.17C, NR.sup.17AC(O)OR.sup.17C, NR.sup.17AOR.sup.17C, OCX.sup.17.sub.3, OCHX.sup.17.sub.2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0734] R.sup.18 is hydrogen, CX.sup.18.sub.3, CHX.sup.18.sub.2, CH.sub.2X.sup.18, C(O)R.sup.18C, C(O)OR.sup.18C, C(O)NR.sup.18AR.sup.18B, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; [0735] R.sup.15A, R.sup.15B, R.sup.15C, R.sup.15D, R.sup.16A, R.sup.16B, R.sup.16C, R.sup.16D, R.sup.17A, R.sup.17B, R.sup.17C, R.sup.17D, R.sup.18A, R.sup.18B, and R.sup.18C are independently hydrogen, CX.sub.3, CN, COOH, CONH.sub.2, CHX.sub.2, CH.sub.2X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R.sup.15A and R.sup.15B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R.sup.16A and R.sup.16B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R.sup.17A and R.sup.17B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R.sup.18A and R.sup.18B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; [0736] X, X.sup.15, X.sup.16, X.sup.17, and X.sup.18 are independently F, Cl, Br, or I; [0737] n15, n16, and n17 are independently an integer from 0 to 4; and [0738] m15, m16, m17, v15, v16, and v17 are independently 1 or 2.
[0739] Embodiment 3. The compound of embodiment 2, wherein R.sup.15, R.sup.16, R.sup.17, and R.sup.18 are independently hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl, or substituted or unsubstituted 2 to 4 membered heteroalkyl.
[0740] Embodiment 4. The compound of embodiment 2, wherein R.sup.15, R.sup.16, R.sup.17, and R.sup.18 are independently hydrogen or unsubstituted C.sub.1-C.sub.2 alkyl and X.sup.17 is Cl.
[0741] Embodiment 5. The compound of one of embodiments 1 to 4, wherein the cysteine binding moiety is:
##STR00112##
[0742] Embodiment 6. The compound of embodiment 1, wherein the serine binding moiety is:
##STR00113##
wherein: [0743] R.sup.15, R.sup.16, R.sup.16, and R.sup.18 are independently hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl, or substituted or unsubstituted 2 to 4 membered heteroalkyl; and X.sup.17 is halogen.
[0744] Embodiment 7. The compound of embodiment 6, wherein R.sup.15, R.sup.16, R.sup.17, and R.sup.18 are independently hydrogen or unsubstituted C.sub.1-C.sub.2 alkyl and X.sup.17 is Cl.
[0745] Embodiment 8. The compound of embodiment 6 or embodiment 7, wherein the serine binding moiety is:
##STR00114##
[0746] Embodiment 9. The compound of one of embodiments 1 to 8, wherein R.sup.1 is hydrogen or halogen.
[0747] Embodiment 10. The compound of one of embodiments 1 to 8, wherein R.sup.1 is Cl.
[0748] Embodiment 11. The compound of one of embodiments 1 to 10, wherein R.sup.2 is hydrogen or halogen.
[0749] Embodiment 12. The compound of one of embodiments 1 to 10, wherein R.sup.2 is hydrogen.
[0750] Embodiment 13. The compound of one of embodiments 1 to 10, wherein R.sup.2 is F or Cl.
[0751] Embodiment 14. The compound of one of embodiments 1 to 13, wherein R.sup.3 is halogen or C.sub.1-C.sub.4 substituted or unsubstituted alkynyl.
[0752] Embodiment 15. The compound of one of embodiments 1 to 13, wherein R.sup.3 is halogen.
[0753] Embodiment 16. The compound of one of embodiments 1 to 13, wherein R.sup.3 is Cl, Br, or I.
[0754] Embodiment 17. The compound of one of embodiments 1 to 13, wherein R.sup.3 is unsubstituted 1.sup.3,2.sup.2-ethyne.
[0755] Embodiment 18. The compound of one of embodiments 1 to 17, wherein R.sup.4 and R.sup.5 are hydrogen.
[0756] Embodiment 19. The compound of one of embodiments 1 to 18, wherein R.sup.6 is hydrogen, substituted or unsubstituted C.sub.1-C.sub.4 alkyl; or R.sup.6 and L.sup.1 are joined together to form a substituted or unsubstituted 5 to 7 membered heterocycloalkyl.
[0757] Embodiment 20. The compound of one of embodiments 1 to 18, wherein R.sup.6 is hydrogen.
[0758] Embodiment 21. The compound of one of embodiments 1 to 18, wherein R.sup.6 is unsubstituted methyl.
[0759] Embodiment 22. The compound of one of embodiments 1 to 18, wherein R.sup.6 and L.sup.1 are joined together to form a substituted or unsubstituted 5 to 7 membered heterocycloalkyl.
[0760] Embodiment 23. The compound of one of embodiments 1 to 18, wherein R.sup.6 and L.sup.1 are joined together to form a substituted or unsubstituted 1.sup.2-azepan-2-one, substituted or unsubstituted 1,4.sup.2-oxazepan-5-one, or substituted or unsubstituted 1.sup.2-piperidin-2-one.
[0761] Embodiment 24. The compound of one of embodiments 1 to 23, wherein R.sup.7 is independently a substituted or unsubstituted C.sub.1-C.sub.4 alkyl, substituted or unsubstituted 2 to 4 membered heteroalkyl, substituted or unsubstituted C.sub.3-C.sub.8 cycloalkyl, substituted or unsubstituted 3 to 8 membered heterocycloalkyl, substituted or unsubstituted C.sub.6-C.sub.10 aryl, or substituted or unsubstituted 5 to 10 membered heteroaryl.
[0762] Embodiment 25. The compound of one of embodiments 1 to 23, wherein R.sup.7 is an unsubstituted C.sub.1-C.sub.4 alkyl, unsubstituted 2 to 4 membered heteroalkyl, unsubstituted C.sub.3-C.sub.8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C.sub.6-C.sub.10 aryl, or unsubstituted 5 to 10 membered heteroaryl.
[0763] Embodiment 26. A TREK family protein or homolog thereof comprising a cysteine residue at an amino position corresponding to position 131 of TREK-1.
[0764] Embodiment 27. The TREK family protein or homolog thereof of embodiment 26, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein, or a TRAKK protein.
[0765] Embodiment 28. The TREK family protein or homolog thereof of embodiment 26 or embodiment 27, wherein the TREK family protein comprises any one of SEQ ID NOS: 1-12.
[0766] Embodiment 29. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 1.
[0767] Embodiment 30. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 2.
[0768] Embodiment 31. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 3.
[0769] Embodiment 32. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 4.
[0770] Embodiment 33. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 5.
[0771] Embodiment 34. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 6.
[0772] Embodiment 35. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 7.
[0773] Embodiment 36. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 8.
[0774] Embodiment 37. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 9.
[0775] Embodiment 38. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 10.
[0776] Embodiment 39. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 11.
[0777] Embodiment 40. The TREK family protein or homolog thereof of one of embodiments 26 to 28, wherein the TREK family protein comprises SEQ ID NO: 12.
[0778] Embodiment 41. A nucleic acid encoding the TREK family protein or homolog thereof of one of embodiments 26 to 40.
[0779] Embodiment 42. A viral particle comprising the nucleic acid of embodiment 41.
[0780] Embodiment 43. A method of treating a disease or adverse condition related to low TREK family protein activity in a subject in need thereof, the method comprising administering to the subject an effective amount of a nucleic acid encoding the TREK family protein of one of embodiments 26 to 40 and a therapeutically effective amount of a TREK family protein agonist, wherein said TREK family protein agonist comprises a cysteine binding moiety capable of covalently binding said TREK family protein at said cysteine residue.
[0781] Embodiment 44. The method of embodiment 43, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein, or a TRAAK protein.
[0782] Embodiment 45. The method of embodiment 43, wherein said nucleic acid is within a viral particle.
[0783] Embodiment 46. The method of embodiment 45, wherein the viral particle is an inactivated or genetically modified human papillomavirus, rhinovirus, hepatitis B virus, or herpesvirus.
[0784] Embodiment 47. The method of embodiment 43, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA), a small interference RNA (siRNA), a piwi-interacting RNA (piRNA), a microRNA (miRNA), an antisense oligonucleotide, a morpholinooligonucleotide, a CRISPR Cas guide RNA (gRNA), a small molecule compound, an antibody, or a nucleic acid.
[0785] Embodiment 48. The method of embodiment 47, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA).
[0786] Embodiment 49. The method of embodiment 47, wherein said TREK family protein agonist is a small interference RNA (siRNA).
[0787] Embodiment 50. The method of embodiment 47, wherein said TREK family protein agonist is a piwi-interacting RNA (piRNA).
[0788] Embodiment 51. The method of embodiment 47, wherein said TREK family protein agonist is a microRNA (miRNA).
[0789] Embodiment 52. The method of embodiment 47, wherein said TREK family protein agonist is an antisense oligonucleotide.
[0790] Embodiment 53. The method of embodiment 47, wherein said TREK family protein agonist is a GapmeR.
[0791] Embodiment 54. The method of embodiment 47, wherein said TREK family protein agonist is a morpholinooligonucleotide.
[0792] Embodiment 55. The method of embodiment 47, wherein said TREK family protein agonist is a CRISPR Cas guide RNA (gRNA).
[0793] Embodiment 56. The method of embodiment 55, wherein said CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA.
[0794] Embodiment 57. The method of embodiment 55, wherein said CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
[0795] Embodiment 58. The method of embodiment 47, wherein said TREK family protein agonist is aTREK family protein antibody.
[0796] Embodiment 59. The method of embodiment 47, wherein said TREK family protein agonist is a nucleic acid binding said cysteine residue.
[0797] Embodiment 60. The method of embodiment 47, wherein said TREK family protein agonist is the compound of any one of embodiments 1 to 25.
[0798] Embodiment 61. The method of any one of embodiments 43 to 60, wherein the cysteine residue is at an amino position corresponding to position 131 of TREK-1.
[0799] Embodiment 62. The method of any one of embodiments 43 to 61, wherein said disease or adverse condition is chronic pain, nerve injury, lack of sleep, high intraocular pressure, headache, depression, pulmonary hypertension, lung injury, or decompression sickness.
[0800] Embodiment 63. The method of embodiment 62, wherein the nerve injury is an injury of the dorsal ganglion nerve.
[0801] Embodiment 64. A method of treating a disease or adverse condition related to low TREK family protein activity in a subject in need thereof, the method comprising administering to said subject a gene editing system capable of mutating a TREK family protein to comprise a cysteine residue at an amino position corresponding to position 131 of TREK-1, and a TREK family protein agonist, wherein said TREK family protein agonist comprises a cysteine binding moiety that is capable of covalently binding said TREK family protein at said cysteine residue.
[0802] Embodiment 65. The method of embodiment 64, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein, or a TRAAK protein.
[0803] Embodiment 66. The method of embodiment 64, wherein said gene editing system is a CRISPR Cas guide RNA (gRNA), a transcription activator-like effector nuclease (TALEN), or a zinc-finger nuclease (ZFN).
[0804] Embodiment 67. The method of embodiment 66, wherein said CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA.
[0805] Embodiment 68. The method of embodiment 66, wherein said CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
[0806] Embodiment 69. A method of increasing TREK family protein activity in a tissue, said method comprising administering to said tissue a nucleic acid encoding the TREK family protein of one of embodiments 26 to 40 and a TREK family protein agonist, wherein said TREK family protein agonist comprises a cysteine binding moiety capable of covalently binding said TREK family protein at said cysteine residue.
[0807] Embodiment 70. The method of embodiment 69, wherein the TREK family protein is a TREK-1 protein, a TREK-2 protein, or a TRAAK protein.
[0808] Embodiment 71. The method of embodiment 69, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA), a small interference RNA (siRNA), a piwi-interacting RNA (piRNA), a microRNA (miRNA), an antisense oligonucleotide, a morpholinooligonucleotide, a CRISPR Cas guide RNA (gRNA), a small molecule compound, an antibody, or a nucleic acid.
[0809] Embodiment 72. The method of embodiment 71, wherein said TREK family protein agonist is a short-hairpin RNA (shRNA).
[0810] Embodiment 73. The method of embodiment 71, wherein said TREK family protein agonist is a small interference RNA (siRNA).
[0811] Embodiment 74. The method of embodiment 71, wherein said TREK family protein agonist is a piwi-interacting RNA (piRNA).
[0812] Embodiment 75. The method of embodiment 71, wherein said TREK family protein agonist is a microRNA (miRNA).
[0813] Embodiment 76. The method of embodiment 71, wherein said TREK family protein agonist is an antisense oligonucleotide.
[0814] Embodiment 77. The method of embodiment 71, wherein said TREK family protein agonist is a GapmeR.
[0815] Embodiment 78. The method of embodiment 71, wherein said TREK family protein agonist is a morpholinooligonucleotide.
[0816] Embodiment 79. The method of embodiment 71, wherein said TREK family protein agonist is a CRISPR Cas guide RNA (gRNA).
[0817] Embodiment 80. The method of embodiment 79, wherein said CRISPR Cas guide RNA is CRISPR Cas 12 guide RNA.
[0818] Embodiment 81. The method of embodiment 79, wherein said CRISPR Cas guide RNA is CRISPR Cas 9 guide RNA.
[0819] Embodiment 82. The method of embodiment 71, wherein said TREK family protein agonist is aTREK family protein antibody.
[0820] Embodiment 83. The method of embodiment 64 or embodiment 69, wherein said TREK family protein agonist is a nucleic acid binding said cysteine residue.
[0821] Embodiment 84. The method of embodiment 64 or embodiment 69, wherein said TREK family protein agonist is the compound of any one of embodiments 1 to 25.
[0822] Embodiment 85. The method of any one of embodiments 64 to 84, wherein the cysteine residue is at an amino position corresponding to position 131 of TREK-1.
[0823] Embodiment 86. The method of any one of embodiments 69 to 85, wherein said tissue is a brain, heart, nerve, nerve ganglia, eye, smooth muscle, endocrine, pancreas, prostate, or sensory organ tissue.
[0824] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.
EXAMPLES
Introduction
[0825] Described herein is the development of a covalent, chemogenetic activator for the TREK subfamily of K.sub.2Ps. Unlike traditional chemogenetic systems that rely on steric interactions to provide selectivity, we targeted genetically-defined K.sub.2Ps through covalent engagement using electrophilic ligands. Guided by x-ray crystallography and functional studies, we identified Ser131 of K.sub.2P2.1 (TREK-1) as a favorable residue for covalent ligand engagement, due to its proximity to a known K.sub.2P modulatory binding site (37). It was found that an acrylamide-functionalized K.sub.2P agonist (ML336,
[0826] An optimal chemogenetic system comprises a protein of interest engineered to respond to a cognate ligand, where the same ligand does not modulate endogenous protein function (28). Chemogenetic tools can thus offer precise chemical control of protein function that is orthogonal to native protein-ligand interactions (28).
Example 1: Covalent modification of the k.SUB.2p.2.1 (trek-1) modulator pocket
[0827] In the course of characterizing electrophilic moiety-bearing derivatives of the TREK subfamily activator ML335, we determined the co-crystal structure of a previously characterized K.sub.2P2.1 (TREK-1) construct, K.sub.2P2.1 (TREK-1).sub.cryst complexed with an ML335 acrylamide derivative, ML336 (
Example 2: Development of a Chemogenetic K.SUB.2p.2.1 (Trek-1) Pair
[0828] To develop a modulator:channel pair capable of rapid, irreversible activation, we modified the ML336 scaffold to replace the acrylamide group with the more reactive maleimide to afford CAT335 (Covalent Activator of TREK,
[0829] K.sub.2P2.1 (TREK-1).sup.CG* and wt possess similar responses to K.sub.2P2.1 (TREK-1).sup.CG* response to extracellular pH was altered, likely due to the proximity of Cys131 to His126, a key residue for TREK-1 extracellular pH sensing (
[0830] We noticed a small degree of activation of K.sub.2P2.1 (TREK-1) by 20 M CAT335 following compound washout (I.sub.CAT335/I.sub.control=4.0+0.6 after washout) (
[0831] To explore the potential of the maleimide reactive functionality further, we synthesized a set of CAT335 derivatives that included two functionalized maleimides (CAT335a and CAT335b) and a succinimide (CAT335c). Methyl-substituted maleimide CAT335a was able to irreversibly activate TREK-1.sup.CG*, however the magnitude of the response was slightly reduced relative to CAT335 for the equivalent amount of time (I.sub.CAT335a/I.sub.control=7.40.7 at 20 M) (
Structures of CATKLAMP Pairs
[0832] To understand the interactions of the CATKLAMP pairs, we determined the structures of complexes of TREK-1.sup.CG* with CAT335, CAT335a, and the non-covalent activator ML335 at resolutions of 3.O each. These structures showed no major global deviations from the previously reported K.sub.2P2.1 (TREK-1):ML335 complex (
Example 3: Concatenated Tandem Channels to Study Activation of Single Subunits
[0833] Given the ability of CAT335 to activate TREK-1.sup.CG* selectively relative to unmodified K.sub.2P2.1(TREK-1) (
[0834] Heterodimeric channels WT-CG* and CG*-WT were activated by CAT335 to a similar degree (I.sub.CAT335/I.sub.control=11.5+1.1 and 8.9+1.1, respectively), and the fold-activation was 60-80% of the activation of the CG*-CG* homodimer (
TABLE-US-00001 TABLE 1 Response of K.sub.2P channels to activators ML335 CAT335 BL-1249 ML336 CAT335a CAT335b K.sub.2P2.1(TREK-1) Wild-type 6.5 2.0 0.2 10.0 (FIG. 1) (FIG. 1) (FIG. 2) S131A 6.8 16.1 (FIG. 1) (FIG. 1) TREK-1.sup.CG* 22 2 7.4 0.7 4.9 0.6 (FIG. 2) (FIG. 2) (FIG. 2) TREK-1.sup.CG* A286F TREK-1.sup.CG* G171F TREK-1 Tandems WT-WT 6.8 0.5 1.37 0.07 CG*-WT 5.0 0.5 8.9 1.1 WT-CG* 5.6 0.4 11.5 1.1 CG*-CG* 4.5 0.3 14.7 0.9 K.sub.2P10.1(TREK-2) Wild-type TREK-2.sup.CG* K.sub.2P4.1(TRAAK) Wild-type TRAAK.sup.CG*
[0835] K.sub.2P2.1 (TREK-1) tandem channels were further investigated by single channel recordings from HEK293 cells in cell attached mode. Application of 20 M CAT335 to WT-WT had no impact on open probability (P.sub.o), but resulted in large increases in P.sub.o when applied to CG*-WT (P.sub.o CAT335/P.sub.o control=6.3) and CG*-CG* (P.sub.o CAT335/P.sub.o control=7.8) tandems (
Example 4: Attenuated TREK-1.SUP.CG.* Double Mutants Increase Dynamic Response to CAT335
[0836] To exploit the orthogonal pharmacology of TREK-1.sup.CG* and wild-type K.sub.2P2.1 (TREK-1) in response to CAT335, we hypothesized TREK-1.sup.CG* could serve as a useful tool for modulating membrane potential and intracellular [K.sup.+ ]. Chemogenetic ion channels based on modified nicotinic acetylcholine receptor (nAChR) ligand binding domains (LBDs) coupled with ion pore domains from GlyR (Cl.sup.) and 5HT3 (Na.sup.+/K.sup.+/Ca.sup.2+) channels have been reported (36,42). While advantageous due to their modular design and potent ligands (low nanomolar), changes in membrane potential result from the influx of ions into the cell: Cl.sup. to electrically shunt or Na.sup.+/K.sup.+ to depolarize the plasma membrane. In contrast, TREK-1.sup.CG* hyperpolarizes cells by the outflux of K.sup.+ and the decrease of input resistance. One limitation of TREK-1.sup.CG* is that the high basal K.sup.+ leak causes significant depolarization of cells when exogenously expressed, even in the absence of activator CAT335 (
[0837] We next explored the potential of TREK-1.sup.CG* and A286F TREK-1.sup.CG* channels to modulate resting membrane potential (RMP) in HEK293 cells. Similar to what was observed in oocytes, expression of TREK-1.sup.CG* resulted in large HEK293 basal currents (660110 pA at 0 mV), while A286F TREK-1.sup.CG* currents (90 i 10 pA at 0 mV) were similar to control cells (7020 pA at 0 mV) (
Example 5: K.SUB.2P.10.1 (TREK-2).SUP.CG.* and K.SUB.2P.4.1 (TRAAK).SUP.CG.*
[0838] Having shown that CAT335 can be used to selectively and irreversibly activate K.sub.2P2.1 (TREK-1).sup.CG*, we wondered if the strategy could be extended to the other members of the TREK subfamily. Sequence alignment of K.sub.2P2.1(TREK-1), K.sub.2P10.1(TREK-2) and K.sub.2P4.1 (TRAAK) shows the channels are highly conserved at the P1 face of the modulator pocket near the CG* mutation (
DISCUSSION
[0839] We report the development of chemogenetic tools capable of selectively activating TREK channels through the selective engagement of an engineered cysteine residue at the K.sub.2P modulator pocket. The efficacy of this system was measured functionally by TEVC, whole-cell and single channel patch clamp electrophysiology, and demonstrated that CAT335 can activate K.sub.2P2.1 (TREK-1).sup.CG* channels up to 22-fold. X-ray crystallography, confirming CAT335 activates K.sub.2P2.1 (TREK-1) through a similar molecular wedging mechanism as ML335, and that this binding places the maleimide in proximity to the nucleophilic Cys131 of K.sub.2P2.1 (TREK-1).sup.CG*. Unlike typical chemogenetic systems which rely on bump-hole strategies to achieve selectivity, we believe our system relies on the chemoselectivity of maleimide-cysteine labeling to irreversibly activate channels. This strategy has the advantage of improving target engagement over non-covalent ligands, which was especially important for low-affinity interactions like those found in K.sub.2P4.1(TRAAK).sup.CG*.
[0840] We also showed that chemogenetic tools can be used in ways not possible with ligands targeting wt channels. We demonstrated that concatenated tandems bearing 0, 1 or 2 CG* mutations possess non-linear activation profiles, implying that the activation of a single subunit of a K.sub.2P dimer is sufficient for activation of the C-type gate. Further, activation of a single subunit seemed to provide >50% activation, implying cooperativity between the two monomers. This was supported by single channel experiments, which showed that fold-changes in P.sub.o were >50% for channels possessing a single CG* site. We hypothesize similar systems can be engineered to better understand the behavior of heterodimeric K.sub.2P channels.
[0841] We hypothesize the utility of chemogenetic K.sub.2P channels could expand beyond studying the mechanisms of K.sub.2P activation. By combining inactivating K.sub.2P2.1(TREK-1) mutations G171F or A286F mutations with the CG* mutation, we generated an off-on K.sub.2P2.1(TREK-1) that possessed greatly reduced leak currents while still being sensitive to activation by CAT335. Currently, a limited number of optogenetic and chemogenetic tools are available for modulating [K.sup.+], and those that exist possess limitations such as poor temporal control and small amplitudes of depolarization (35, 43, 44, 45). Chemogenetic K2P channels can thus provide a novel method by which excitable cells membrane potential can be hyperpolarized in a complementary way to the favored channelrhodopsins and chloride-channel targeting PSAM/PSEM and DREADD systems.
[0842] Finally, we showed the our covalent, chemogenetic targeting system can activate other K2P channels such as K2P10.1 (TREK-2) and K2P4.1 (TRAAK). The activation of K2P4.1 (TRAAK) is of particular interest, as previous studies revealed K2P4.1 (TRAAK) was insensitive to K2P modulator pocket ligands ML335 and ML402 due to the lack of a key cation- interaction in the modulator pocket. The fact that ML337 can activate K2P4.1 (TRAAK)CG* alludes to the fact that the powerful covalent engagement can improve target engagement of weak interactions. We hypothesize that this system can therefore be employed to explore the broader pharmacology of the K2P modulator pocket across other K2P channels and be utilized in cysteine-tethering screening to identify novel motifs capable of binding this cryptic binding pocket.
Experimental
Molecular Biololgy
[0843] K2P2.1.sub.cyst and S131C K2P2.1.sub.cryst bearing C-terminal green fluorescent protein (GFP) and His.sub.10 tag were expressed from a previously described Pichia pastoris pPICZ vector (44). Plasmids were linearized with PmeI and transformed into.
[0844] Mouse K.sub.2P2.1 (TREK-1) (Genbank accession number: NP_034737.2), mouse K.sub.2P10.1 (TREK-2) (NM_001316665.1), mouse K.sub.2P4.1 (TRAAK) (NM_008431.3), human K.sub.2P4.1 (TRAAK) (NM_033310.2) and mouse K2P18.1(TRESK) (NM_207261.3) were used for this study. Point mutations were introduced by site-directed mutagenesis using custom primers and confirmed by sequencing before use. For studies using Xenopus oocytes, K.sub.2P channels were subcloned into a previously reported pGEMHE/pMO vector (46). For expression in HEK293 cells, mouse K.sub.2P2.1 (TREK-1) and mutants were expressed from a previously described pIRES2-EGFP vector in HEK293 cells (46,47). K.sub.2P2.1 (TREK-1) tandems were constructed by connecting the open reading frames for the individual subunits with a linker encoding the AAAGSGGSGGSGGSSGSSGS (SEQ ID NO: 19) sequence. Tandems used for HEK293 cells included an N-terminal HA tag (YPYDVPDYA (SEQ ID NO: 20)) on the first subunit.
[0845] mRNA for oocyte injections was prepared from linearized plasmid DNA (linearized with AflII) using mMessage Machine T7 Transcription Kit (Thermo Fisher Scientific). RNA was purified using RNEasy kit (Qiagen) and stored as stocks and dilutions in RNAse-free water at 80 C.
Protein Expression
[0846] K.sub.2P2.1.sub.cryst and S131C K2P2.1.sub.cryst bearing C-terminal green fluorescent protein (GFP) and His.sub.10 tag were expressed from a previously described Pichia pastoris pPICZ vector (44). Plasmids were linearized with PmeI and transformed into P. pastoris SMD 1163H by electroporation. Multi-integration recombinants were selected by plating transformants onto yeast extract peptone dextrose sorbitol (YPDS) plates having increasing concentrations of zeocin (1-4 mg ml.sup.1). Expression levels of individual transformants were evaluated by FSEC as previously described (45).
[0847] Large-scale expression was carried out in a 7L Bioreactor (Labfors5, Infors HT). First, a 250 ml starting culture was grown in buffered minimal medium (2YNB, 1% glycerol, 0.4 mg l.sup.1 biotin, 100 mM potassium phosphate, pH 6.0) in shaker flasks for two days at 29 C. Cells were pelleted by centrifugation (3,000g, 10 minutes, 20 C.) and used to inoculate the bioreactor. Cells were grown in minimal medium (4% glycerol, 0.93 g l.sup.1 CaSO.sub.4.Math.2H.sub.2O, 18.2 g l.sup.1 K.sub.2SO.sub.4, 14.9 g l.sup.1 MgSO.sub.4.Math.7H.sub.2O, 9 g l.sup.1 (NH.sub.4).sub.2SO.sub.4, 25 g l.sup.1 Na.sup.+ hexametaphosphate, 4.25 ml l.sup.1 PTM.sub.1 trace metals stock solution prepared accordingly to standard Invitrogen protocol) until the glycerol in the fermenter was completely metabolized marked by a spike in pO.sub.2 (around 24 h). Fed-batch phase was then initiated by adding a solution of 50% glycerol and 12 ml l.sup.1 of trace metals at 15-30% of full pump speed until the wet cell mass reached approximately 250 g l.sup.1 (around 24 h). pO.sub.2 was measured continuously and kept at a minimum of 30%. Feed rate was automatically regulated accordingly. pH was maintained at 5.0 by the addition of a 30% ammonium hydroxide solution.
[0848] After the fed-batch phase was completed, cells were then starved to deplete glycerol by stopping the feeder pump until a pO.sub.2 spike appeared. After starvation, the temperature was set to 27 C., and the induction was initiated with addition of methanol in three steps: (1) initially, the methanol concentration was kept at 0.1% for 2 h in order to adapt the cells; (2) methanol concentration was then increased to 0.3% for 3 h; and (3) methanol was then increased to 0.5% and expression continued for 48-60 h. Cells were then pelleted by centrifugation (6,000g, 1 h, 4 C.), snap frozen in liquid nitrogen, and stored at 80 C.
Protein Purification
[0849] In a typical preparation, 10 g of cells were broken by cryo-milling (Retsch model MM400) in liquid nitrogen (53 min, 25 Hz). All subsequent purification was carried out at 4 C. Cell powder was added at a ratio of 1 g cell powder to 3 ml lysis buffer (200 mM KCl, 21 mM OGNG (octyl glucose neopentyl glycol, Anatrace), 30 mM HTG (n-heptyl-P-D-thioglucopyranoside, Anatrace), 0.1% CHS, 0.1 mg ml.sup.1 DNase 1 mM PMSF, 100 mM Tris-Cl, pH 8.2). Membranes were extracted for 3 h with gentle stirring followed by centrifugation (100,000g, 45 minutes at 4 C.).
[0850] Solubilized proteins were purified by affinity chromatography using batch purification. Anti-GFP nanobodies were conjugated with CNBr Sepharose beads (GE Healthcare, #17-0430-02). The resin was added to the cleared supernatant at a ratio of 1 ml of resin per 10 g of cell powder and incubated at 4 C. for 3 h with gentle shaking. Resin was collected into a column and washed with ten column volumes (CV) of buffer A (200 mM KCl, 10 mM OGNG, 15 mM HTG, 0.018% CHS, 50 mM Tris-Cl, pH 8.0) followed by a second wash step using 10 CV of buffer B containing (200 mM KCl, 5 mM OGNG, 15 mM HTG, 0.018% CHS, 50 mM Tris-Cl, pH 8.0). The resin was then washed with additional ten CV of buffer C (200 mM KCl, 3.85 mM OGNG, 15 mM HTG, 0.0156% CHS, 50 mM Tris-Cl, pH 8.0). On column cleavage of the affinity tag was achieved by incubating the resin with buffer C supplemented to contain 350 mM KCl, 1 mM EDTA, and 3C protease at ratio of 50:1 resin volume:protease volume (46). The resin was incubated overnight at 4 C. Cleaved sample was collected and the resin washed with two CV of SEC buffer (200 mM KCl, 2.1 mM OGNG, 15 mM HTG, 0.012% CHS, 20 mM Tris-Cl, pH 8.0). Purified sample was concentrated and applied to a Superdex 200 column pre-equilibrated with SEC buffer. Peak fractions were evaluated by SDS-PAGE (15% acrylamide) for purity, pooled and concentrated.
Crystallization and Refinement
[0851] Purified K.sub.2P2.1.sub.cryst was concentrated to 6 mg ml.sup.1 by centrifugation (Amicon Ultra-15, 50 kDa molecular mass cut-off, Millipore) and crystallized by hanging-drop vapor diffusion at 4 C. using a mixture of 0.2 l of protein and 0.1 l of precipitant over 100 l of reservoir containing 20-25% PEG400, 200 mM KCl, 100 mM HEPES pH 8.0, 1 mM CdCl.sub.2. Crystals appeared in 12 h and grew to full size (200-300 M) in about a week. Crystals were cryoprotected with buffer D (200 mM KCl, 0.2% OGNG, 15 mM HTG, 0.02% CHS, 100 mM HEPES pH 8.0.1 mM CdCl.sub.2) with 5% step increase of PEG400 up to a final concentration of 38% and flash-frozen in liquid nitrogen.
[0852] K.sub.2P2.1.sub.cryst ML335 and ML402 complex crystals grew in the same conditions as K.sub.2P2.1.sub.cyst, but the protein was incubated for at least 1 h with 2.5 mM of activator before setting the crystal plates. ML335 and ML402 are insoluble in aqueous solutions, so they were dissolved in 100% DMSO at a concentration of 500 mM. Then each compound was diluted 1:100 in SEC buffer to 5 mM concentration, giving a milky solution. This solution was mixed 1:1 to K.sub.2P2.1.sub.cryst previously concentrated to 12 mg ml.sup.1. The K.sub.2P2.1.sub.crys/ML402 mixture resulted in a clear solution, while the mixture with ML335 was slightly milky. The samples were briefly centrifuged in a table-top centrifuge (10,000 g) to remove any insoluble material before setting the crystal plates.
[0853] Datasets for K.sub.2P2.1, K.sub.2P2.1-ML335, and K.sub.2P2.1-ML402 were collected at 100 K using synchrotron radiation at ALS Beamline 8.3.1 Berkeley, California and APS GM/CAT beamline 23-IDB/D Chicago, Illinois using wavelengths of 1.1159 and 1.0332 , respectively, processed with XDS39, scaled and merged with Aimless40. Final resolution cut-off was 3.1 , 3.0 and 2.8 for K.sub.2P2.1.sub.cryst, K.sub.2P2.1.sub.cryst-ML335 and K.sub.2P2.1.sub.cryst-ML402, respectively, using the CC.sub.1/2 criterion.sup.41,42. Structures were solved by molecular replacement using the K.sub.2P4.1(G124I) structure (PDB: 4RUE).sup.15 as search model. Several cycles of manual rebuilding, using COOT.sup.43, and refinement using REFMAC5.sup.44 and PHENIX.sup.45 were carried out to improve the electron density map. Twofold local medium NCS restraints were employed during refinement for residues 28-103, 110-158 and 194-260. K.sub.2P2.1, K.sub.2P2.1-ML335 and K.sub.2P2.1-ML402 structures have, respectively, 95.2%/0.4%, 92.0%/0.5% and 95.7%/0.4% residues in favoured regions/outliers of the Ramachandran plot as assessed by Molprobity.sup.46.
Patch-Clamp Electrophysiology
[0854] 50% confluent cells were co-transfected (in 35-mm diameter wells) with 10-100 ng of the K.sub.2P2.1 plasmid and 400 ng of an eGFP plasmid (for visualization) using LipofectAMINE 2000 (Invitrogen) for 24 h, after which the cells were either plated onto coverslips or the media exchanged with fresh media. Cells were plated onto Matrigel coated coverslips (BD Biosciences) 1-2 hours before experiments.
[0855] Whole-cell patch-clamp experiments with K.sub.2P2.1(TREK-1) and mutants were carried out 24-48 h after transfection. Acquisition and analysis for voltage-clamp experiments were performed using pCLAMP10 and an Axopatch 200B amplifier (Molecular Devices). Current-clamp experiments were acquired using an Axopatch 700B amplifier (Molecular Devices). Pipettes were pulled using a Flaming/Brown micropipette puller (P-97, Sutter Instruments) and flame-polished using a MF-830 microforge (Narishige). Electrode resistance after filling with pipette internal solution ranged from 2 to 5 M. Currents were low-pass filtered at 2 kHz and sampled at 10 kHz. Pipette solution contained the following: 145 mM KCl, 3 mM MgCl.sub.2, 5 mM EGTA and 20 mM HEPES (pH 7.2 with KOH). Bath solution contained the following: 145 mM NaCl, 5 mM KCl, 1 mM CaCl.sub.2, 3 mM MgCl.sub.2 and 20 mM HEPES (pH 7.4 with NaOH). K.sub.2P2.1 currents were elicited by a 1 s ramp from 100 to +50 mV from a 80 mV holding potential. Current-clamp recordings were taken with no holding current (I=0). Only K.sub.2P2.1(TREK-1).sup.CG* whole-cell patches with basal currents between 500-2000 nA at 0 mV were used Criteria for A286F K.sub.2P2.1(TREK-1).sup.CG*. ML335 or CAT335 were applied at 20 M in bath solution and were perfused at 3 ml min.sup.1 until potentiation stabilized (1-3 min). Data were analyzed using Clampfit 11 and GraphPad Prism 9.
[0856] Single-channel recordings of K.sub.2P2.1 (TREK-1) tandem mutants were recorded in cell-attached mode using HEK293 cells 48 h after transfection. Acquisition and analysis was preformed using pCLAMP9 and an Axopatch 200B amplifier. Pipettes were pulled using a laser-based micropipette puller (P-2000, Sutter Instruments). Electrode resistance after filling with pipette internal solution ranged from 6 to 10 M. Pipette solution contained the following: 150 mM KCl, 3.6 mM CaCl.sub.2, 10 mM HEPES (pH 7.4 with KOH). The bath solution was identical to the pipette solution. P.sub.o was measured from 30-120 s recordings of K.sub.2P2.1 (TREK-1) activity holding at 100 mV. Channel conductance of K.sub.2P2.1 (TREK-1) tandems were measured from 30-60s recordings at either 100 mV or +50 mV holding potential. Recordings of CAT335 activated channels were obtained by bath applying 20 M CAT335 for 2 min to the coverslip before transferring to the recording chamber. This was necessary as application of CAT335 via perfusion or through the pipette solution activated slowly (>5 min), making it difficult to measure P.sub.o from fully activated channels. BL-1249 was applied at 20 M in the bath solution via perfusion at 3 mL min.sup.1 (2-4 min). Data were analyzed using Clampfit 11 and GraphPad Prism 9.
Two-Electrode Voltage-Clamp (tevc) Electrophysiology
[0857] Xenopus laevis oocytes were harvested according to UCSF IACUC Protocol AN129690 and digested using collagenase (Worthington Biochemical Corporation, #LS004183, 0.8-1.0 mg/mL) in Ca.sup.21-free ND96 (96 mM NaCl, 2 mM KCl, 3.8 mM MgCl.sub.2, 5 mM HEPES pH 7.4) immediately post-harvest, as previously reported (31,33). Oocytes were maintained at 18 C. in ND96 (96 mM NaCl, 2 mM KCl, 1.8 mM CaCl.sub.2, 2 mM MgCl.sub.2, 5 mM HEPES pH 7.4) supplemented with antibiotics (100 units mL.sup.1 penicillin, 100 g mL.sup.1 streptomycin, 50 g mL.sup.1 gentimycin) and used for experiments within one week of harvest.
[0858] Defolliculated stage V-VI oocytes were microinjected with 0.5-36 ng mRNA and currents were recorded within 16-48 h hours of injection.
[0859] For recordings, oocytes were impaled with borosilicate recording microelectrodes (0.4-2.0 M resistance) backfilled with 3 M KCl and were subjected to constant perfusion of ND96 at a rate of 3 ml min.sup.1. Recording solutions containing K.sub.2P activators were prepared immediately prior to use from DMSO stocks (20-100 mM), with final DMSO concentrations of 0.1%. Currents were evoked from a 80 mV holding potential followed by a 300 ms ramp from 150 mV to +50 mV. Data were recorded using a GeneClamp 500B amplifier (MDS Analytical Technologies) controlled by pCLAMP8 software (Molecular Devices), and digitized at 1 kHz using Digidata 1332 digitizer (MDS Analytical Technologies). For each recording, control solution (ND96) was perfused over a single oocyte until current was stable before switching to solutions containing the test compounds at various concentrations. Representative traces and dose response plots were generated in GraphPad Prism 9.
Chemical SynthesisMaterials and Instrumentation
[0860] Chemical reagents and solvents (dry) were purchased from commercial suppliers and used without further purification. Synthesis of ML335 was carried out as previously reported (31). Thin layer chromatography (TLC) (Silicycle, F254, 250 m) was performed on glass backed plates pre-coated with silica gel and were visualized by fluorescence quenching under UV light. Column chromatography was performed on Silicycle Sili-prep cartridges using a Biotage Isolera Four automated flash chromatography system. NMR spectra were measured using a Varian INOVA 400 MHz spectrometer (with 5 mm QuadNuclear Z-Grad probe). Chemical shifts are expressed in parts per million (ppm) and are referenced to CDCl.sub.3 (7.26 ppm, 77.0 ppm) or DMSO (2.50 ppm, 40 ppm). Coupling constants are reported as Hertz (Hz). Splitting patterns are indicated as follows: s, singlet; d, doublet; t, triplet; q, quartet, dd, doublet of doublet; m, multiplet. LC-MS was carried out using a Waters Micromass ZQTM, equipped with Waters 2795 Separation Module and Waters 2996 Photodiode Array Detector and an XTerra MS C18, 5 m, 4.650 mm column at ambient temperature. The mobile phases were MQ-H.sub.2O with 0.1% formic acid (eluent A) and HPLC grade methanol with 0.1% formic acid (eluent B). Signals were monitored at 254 over 15 min with a gradient of 10-100% eluent B.
Chemical Syntheses
##STR00115##
Synthesis of N-[(2,4-dichlorophenyl)methyl]-4-nitrobenzamide, 1
[0861] A round-bottom flask was charged with 4-nitrobenzoic acid (2.00 g, 12.0 mmol), 2,4-dichlorobenzylamine (1.77 mL, 13.2 mmol), and HATU (5.00 g, 13.2 mmol). Anhydrous DMF (20 mL) and anhydrous diisopropylethylamine (4.17 mL, 24.0 mmol, 2.0 equiv.) were added and the flask was flushed with nitrogen, sealed, and stirred at 22 C. for 18 h. The reaction was diluted with ethyl acetate (150 mL) and washed with saturated sodium bicarbonate (2100 mL), 10% citric acid in water (2100 mL) and brine (1100 mL).
[0862] The combined organics were dried with anhydrous magnesium sulfate, filtered and the solvent removed in vacuo. The crude solid was recrystallized from ethanol affording N-[(2,4-dichlorophenyl)methyl]-4-nitrobenzamide (1) as pale yellow needles (3.72 g, 11.4 mmol, 95.6%). 1H NMR (400 MHz, DMSO-d.sub.6) 9.39 (t, J=5.7 Hz, 1H), 8.37-8.31 (m, 2H), 8.17-8.11 (m, 2H), 7.64 (t, J=1.2 Hz, 1H), 7.43 (d, J=1.3 Hz, 2H), 4.55 (d, J=5.7 Hz, 2H). .sup.13C NMR (100 MHz, DMSO-d.sub.6) 165.32, 149.62, 140.00, 135.57, 133.51, 132.83, 130.83, 129.33, 129.11, 127.84, 124.06, 40.96. LC/MS (ESI) exact mass for C.sub.14H.sub.9.sup.35Cl.sub.2N.sub.2O.sub.3.sup. [MH].sup. calc. 323.00, found 323.02.
##STR00116##
Synthesis of 4-amino-N-(2,4-dichlorobenzyl)benzamide, 2
[0863] A round-bottom flask was charged with 1 (2.11 g, 6.49 mmol), iron powder (1.09 g, 19.5 mmol) and ammonium chloride (3.21 g, 64.9 mmol). Ethanol (100 mL) and water (15 mL) were added and the reaction was sealed and heated to 90 C. for 18 h. The crude reaction was filtered through diatomaceous earth, washing with ethyl acetate (25 mL). The combined filtrate was diluted with ethyl acetate (75 mL) and washed with dilute sodium hydroxide (2100 mL) and brine (1100 mL). The combined organics were dried with anhydrous magnesium sulfate, filtered and the solvent removed in vacuo. The crude solid was triturated with 25% ethyl acetate in hexanes and the remaining solid collected by vacuum filtration affording 2 as a pale tan solid (1.66 g, 5.61 mmol, 86.5% yield). 1H NMR (400 MHz, DMSO-d.sub.6) 8.60 (t, J=5.9 Hz, 1H), 7.68-7.53 (m, 3H), 7.49-7.24 (m, 2H), 6.57 (d, J=8.6 Hz, 2H), 5.67 (s, 2H), 4.45 (d, J=5.8 Hz, 2H). .sup.13C NMR (100 MHz, DMSO) 166.90, 152.36, 136.74, 133.13, 132.35, 130.31, 129.34, 128.89, 127.71, 120.96, 113.01. LCMS (ESI) exact mass for C.sub.14H.sub.13.sup.35Cl.sub.2N.sub.2O.sub.1.sup.+ [M+H].sup.+ calcd: 295.04, found 294.91.
##STR00117##
Synthesis of ML336
[0864] A round-bottom flask was charged with 2 (295 mg, 999 mol, 1.00 equiv.), dichloromethane (5 mL) and diisopropylethylamine (348 L, 2.00 mmol, 2.00 equiv.). The reaction was cooled to 0 C. and acryloyl chloride (109 mg, 1.20 mmol, 1.20 equiv) was added dropwise and the reaction allowed to warm to rt overnight. The crude reaction was concentrated in vacuo, then purified by column chromatography (0-100% EOAc in hexanes) affording ML336 as a white solid (201 mg, 576 mol, 57.6%). .sup.1H NMR (400 MHz, DMSO-d.sub.6) ppm 10.38 (s, 1H), 8.97 (t, J=5.8 Hz, 1H), 7.91 (d, J=8.8 Hz, 2H), 7.78 (d, J=8.8 Hz, 2H), 7.62 (d, J=2.1 Hz, 1H), 7.43 (dd, J=8.4, 2.1 Hz, 1H), 7.37 (d, J=8.4 Hz, 1H), 6.47 (m, 1H), 6.31 (dd, J=16.9, 2.0 Hz, 1H), 5.81 (dd, J=10.0, 2.0 Hz, 1H), 4.51 (d, J=5.7 Hz, 2H). .sup.13C NMR (100 MHz, DMSO) ppm 166.39, 163.90, 142.30, 136.23, 133.32, 132.58, 132.12, 130.53, 129.15, 129.01, 128.74, 127.98, 127.80, 119.08, 40.65, 40.44, 40.23, 40.02, 39.81, 39.60, 39.39. LCMS (ESI) exact mass for C.sub.17H.sub.15.sup.35Cl.sub.2N.sub.2O.sub.2.sup.+ [M+H].sup.+ calcd: 349.05, found 348.99.
##STR00118##
Synthesis of CAT335
[0865] A vial was charged with 2 (200 mg, 678 mol, 1.00 equiv.), maleic anhydride (66.44 mg, 678 mol, 1.00 equiv.) and anhydrous THF (1.5 mL). The reaction was flushed with nitrogen, sealed, and stirred at 22 C. After 2 h, acetic anhydride (1.5 mL) and sodium acetate (167 mg, 2.03 mmol, 3.00 equiv.) were added and the reaction heated to 90 C. for 2 h. The reaction was cooled to rt, then diluted with water (10 mL). The resulting white precipitate was collected by vacuum filtration and washed with water (35 mL) and diethyl ether (35 mL), affording CAT335 as a white solid (200 mg, 533 mol, 78.7%). .sup.1H NMR (400 MHz, CDCl.sub.3): ppm 7.90 (d, J=7.7 Hz, 2H), 7.48-7.54 (m, 2H), 7.42-7.47 (m, 2H), 7.25-7.28 (m, 1H), 6.91 (s, 2H), 6.62 (br s, 1H), 4.72 ppm (d, J=6.1 Hz, 2H). .sup.13C NMR (100 MHz, CDCl.sub.3) ppm 168.99, 134.41, 134.37, 134.33 (br s, 1 C) 134.27, 134.08, 133.10, 131.36, 129.46, 127.87, 127.50, 125.61, 41.65. LCMS (ESI) exact mass for C.sub.14H.sub.9.sup.35Cl.sub.2N.sub.2O.sub.3.sup. [MH].sup. calcd: 375.03, found 374.92.
##STR00119##
Synthesis of CAT335a
[0866] A vial was charged with 2 (30 mg, 102 mol, 1.0 equiv.) and anhydrous THF (0.2 mL). Itaconic anhydride (13 mg, 116 mol, 1.1 equiv.) was added and the reaction stirred for 30 min, after which a yellow precipitate formed. 0.2 mL acetic anhydride and sodium acetate (25 mg. The reaction was flushed with nitrogen, sealed, and stirred at 22 C. After 2 h, acetic anhydride (1.5 mL) and sodium acetate (25 mg, 3.0 mmol, 3.0 equiv.) were added and the reaction heated to 80 C. for 3 h. The reaction was cooled to rt, then quenched with sat. aq. NaHCO.sub.3 and extracted with EtOAc. The combined organics were dried with anhydrous sodium sulfate, filtered and the solvent removed in vacuo. The crude product was purified by column chromatography (0-100% EtOAc in hexanes) affording CAT335a as a white solid (18 mg, 46 mol, 46%). 1H NMR (400 MHz, CDCl.sub.3) ppm 7.87 (d, J=8.64 Hz, 2H) 7.48 (d, J=8.64 Hz, 2H) 7.37-7.43 (m, 2H) 7.23 (dd, J=8.28, 2.07 Hz, 1H) 6.81 (br t, J=5.72 Hz, 1H) 6.51 (q, J=1.70 Hz, 1H) 4.68 (d, J=6.09 Hz, 2H) 2.19 (d, J=1.70 Hz, 3H). .sup.13C NMR (100 MHz, CDCl.sub.3) ppm 170.18, 169.05, 166.58, 146.09, 134.77, 134.24, 134.16, 134.13, 132.76, 131.12, 129.39, 127.83, 127.68, 127.43, 125.36, 41.54, 11.20. LCMS (ESI) exact mass for C.sub.19H.sub.15.sup.35Cl.sub.2N.sub.2O.sub.3+[M+H].sup.+ calcd: 389.05, found 389.14.
##STR00120##
Synthesis of CAT335b
[0867] A vial was charged with 2 (59 mg, 200 mol, 1.0 equiv.) and toluene (0.4 mL). 2,3-dimethyl maleic anhydride (25 mg, 200 mol, 1.0 equiv.) and sodium acetate (49 mg, 600 mol, 3.0 equiv.) were added and the reaction sealed, heated to 100 C. and stirred for 18 h. Acetic anhydride (0.4 mL) and THF (0.4 mL) were added and the reaction stirred for an additional 2 h. The reaction was cooled to rt, then quenched with sat. aq. NaHCO.sub.3 and extracted with EtOAc. The combined organics were dried with anhydrous sodium sulfate, filtered and the solvent removed in vacuo. The crude product was purified by column chromatography (0-100% EtOAc in hexanes) affording CAT335b as a white solid (25 mg, 62 mol, 31%). 1H NMR (400 MHz, CDCl.sub.3) ppm 7.84-7.89 (m, 2H) 7.49-7.53 (m, 2H) 7.38-7.44 (m, 2H) 7.24 (dd, J=8.28, 2.07 Hz, 1H) 6.71 (br t, J=5.66 Hz, 1H) 4.69 (d, J=5.97 Hz, 2H) 2.08 (s, 6H). .sup.13C NMR (100 MHz, CDCl.sub.3) ppm 170.34, 166.10, 137.51, 135.73, 135.39, 133.53, 132.86, 132.78, 132.52, 132.63, 130.50, 128.71 127.77, 127.22, 125.31, 40.64, 7.87. LCMS (ESI) exact mass for C.sub.20H.sub.17.sup.35Cl.sub.2N.sub.2O.sub.3.sup.+ [M+H].sup.+ calcd: 403.06, found 403.17.
##STR00121##
Synthesis of CAT335c
[0868] A vial equipped with a magnetic stirbar was charged with 2 (148 mg, 500 mol, 1 equiv.), succinic anhydride (50 mg, 500 mol, 1 equiv.) and anhydrous THF (2 mL) and heated to 45 C. for 8 h. Acetic anhydride (2 mL) and sodium acetate (123 mg, 1.50 mmol, 3 equiv.) were then added and the reaction heated to 80 C. for 16 h. The reaction was cooled to rt and diluted with water (5 mL). The resulting white solid was collected by vacuum filtration, then recrystallized from 3:1 Ethyl acetate:hexanes to afford CAT335c as a white solid (82.0 mg, 217 mol, 43.5%). 1H NMR (400 MHz, DMSO-d.sub.6) =9.16 (br t, J=5.7 Hz, 1H), 8.02 (d, J=8.0 Hz, 2H), 7.64 (s, 1H), 7.47-7.36 (m, 4H), 4.54 (d, J=5.6 Hz, 2H), 2.81 (s, 4H). .sup.13C NMR (100 MHz, DMSO-d.sub.6) =177.2, 166.3, 136.0, 135.8, 134.0, 133.4, 132.7, 130.6, 129.1, 128.4, 127.8, 127.4, 40.8, 29.0. LCMS (ESI) exact mass for C.sub.18H.sub.15.sup.35Cl.sub.2N.sub.2O.sub.3.sup.+ [M+H].sup.+ calcd: 377.05, found 376.91.
General Method for Synthesis of Sultam Analogs
[0869] Most of chemicals were purchased from Sinopharm Chemical Reagent Co. (SCRC), Sigma-Aldrich, or Alfa. .sup.1H NMR or .sup.19F NMR spectra were recorded on Bruker AVIII 400 or Bruker AVIII 500. LCMS measurement was run on Agilent 1200 HPLC/6100 SQ System using the follow conditions:
[0870] Method A: Mobile Phase: A: Water (10 mmol NH.sub.4HCO.sub.3) B: ACN; Gradient Phase: 5% B increase to 95% B within 1.4 min, 95% B with 1.6 min (total runtime:3 min); Flow Rate: 1.8 mL/min; Column: Xbridge C18, 3.0*30 mm, 2.5 m; Column Temperature: 50 C. Detectors: UV (214, 4 nm) and MS (ESI, POS mode, 110 to 1000 amu), ES-API.
[0871] Method B: Mobile Phase: A: Water (10 mM NH.sub.4HCO.sub.3) B: Acetonitrile; Gradient Phase: 5% to 95% B within 1.4 min, 95% B with 1.4 min, back to 5% B within 0.01 min; Flow Rate: 1.8 mL/min; Column: XBridge C18, 4.6*50 mm, 3.5 um; Column Temperature: 50 C. Detectors: ADC ELSD, DAD (214 nm and 254 nm), MSD (ES-API).
[0872] Method C: Mobile Phase: A: Water (0.05% TFA) B: ACN (0.05% TFA); Gradient Phase: 5% B increase to 100% B within 1.3 min, 100% B with 1.7 min (total runtime: 3 min); Flow Rate: 2.0 mL/min; Column: SunFire C18, 4.6*50 mm, 3.5 m; Column Temperature: 50 C. Detectors: UV (214 nm and 254 nm) and MS (ESI, Pos mode, 110 to 1000 amu), ES-API.
##STR00122##
Step 1: (4-((2,4-Dichlorobenzyl)carbamoyl)phenyl)boronic acid
##STR00123##
[0873] A mixture of 4-boronobenzoic acid (500 mg, 3.01 mmol), (2,4-dichlorophenyl) methanamine (637 mg, 3.62 mmol), benzotriazole-1-yl-oxytripyrrolidino phosphonium hexafluorophosphate (1.90 g, 3.62 mmol), triethylamine (913 mg, 9.04 mmol) in dichloromethane (10.0 mL) was stirred at room temperature overnight. The reaction was quenched with water and extracted with dichloromethane. The organic layer was separated, washed with brine, dried over sodium sulfate and concentrated under reduced pressure. The crude product was purified by flash chromatography (methanol/dichloromethane=0-5%) to obtain (4-((2,4-dichlorobenzyl)carbamoyl) phenyl)boronic acid (800 mg, 81.9% yield) as a colorless oil. LC-MS: m/z=324.0 (M+H).sup.+, retention time: 1.66 min (Method B).
Step 2: N-(2,4-dichlorobenzyl)-4-(1,1-dioxido-1,2-thiazetidin-2-yl)benzamide
##STR00124##
[0874] A mixture of (4-((2,4-dichlorobenzyl)carbamoyl)phenyl)boronic acid (500 mg, 1.54 mmol), 1,2-thiazetidine 1,1-dioxide (165 mg, 1.54 mmol), cupric acetate (841 mg, 4.63 mmol) and triethylamine (574 mg, 4.63 mmol) in dichloromethane (10.0 mL) was stirred at room temperature under oxygen overnight. The reaction was concentrated under reduced pressure. The crude product was purified by flash chromatography (methanol/dichloromethane=0-5%) to obtain N-(2,4-dichlorobenzyl)-4-(1,1-dioxido-1,2-thiazetidin-2-yl)benzamide (160 mg, 26.9% yield) as a white solid. LC-MS: m/z=384.9 (M+H).sup.+, retention time: 4.70 min (Method C).
##STR00125##
Step 1: Methyl 4-((2,4-dichlorobenzyl)carbamoyl)benzoate
##STR00126##
[0875] A mixture of (2,4-dichlorophenyl)methanamine (2.4 g, 13.9 mmol), 4-(methoxycarbonyl)benzoic acid (2.5 g, 13.9 mmol), 2-(7-azabenzotriazol-1-yl)-N,N,N,N-tetramethyluronium hexafluorophosphate (6.3 g, 16.7 mmol) and N,N-diisopropylethylamine (3.6 g, 27.8 mmol) in N,N-dimethylformamide (20 mL) was stirred at room temperature for 2 hours. The reaction was quenched with water (150 mL) and extracted with ethyl acetate (100 mL*3). The combined organic phases were washed with brine, dried over sodium sulfate, filtered, concentrated and purified by column chromatography (25% ethyl acetate in petroleum ether) to give methyl 4-((2,4-dichlorobenzyl)carbamoyl)benzoate (4.0 g, 11.8 mmol, 85.4%) as white solid. LC-MS: m/z=338.1 (M+H).sup.+, retention time: 2.09 min (Method C).
Step 2: 4-((2,4-Dichlorobenzyl)carbamoyl)benzoic acid
##STR00127##
[0876] A mixture of 4-((2,4-dichlorobenzyl)carbamoyl)benzoate (4.0 g, 11.8 mmol) and sodium hydroxide (944 mg, 23.6 mmol) in tetrohydrofuran (25 mL) and water (2.5 mol) was stirred at room temperature for 5 hours. The reaction mixture was concentrated and dissolved in water (30 mL). The solution was acidified with hydrochloric acid till pH=5. Then the mixture was filtered, and the residue was washed with water and dried to give 4-((2,4-dichlorobenzyl)carbamoyl) benzoic acid (3.0 g, 9.3 mol, 78.7%) as white solid. LC-MS: m/z=323.9 (M+H).sup.+, retention time: 1.83 min (Method C).
Step 3: N-(2,4-dichlorobenzyl)-4-(1,1-dioxido-1,2-thiazetidine-2-carbonyl)benzamide
##STR00128##
[0877] To a mixture of 4-((2,4-dichlorobenzyl)carbamoyl)benzoic acid (200 mg, 0.62 mmol) in dichloromethane was added oxalyl chloride (313 mg, 2.47 mmol) and N,N-dimethylformamide (1 drop) at 0 C. The mixture was stirred at 0 C. for 2 h and the resulting mixture was concentrated under reduced pressure to give 4-((2,4-dichlorobenzyl)carbamoyl)benzoyl chloride as a white solid. Then the aroyl chloride was added to a solution of 1,2-thiazetidine-1,1-dioxide (99 mg, 0.93 mmol) and 4-(dimethyl amino)pyri dine (5 mg, 0.04 mmol) in anhydrous dichloromethane (10 mL) at 78 C. The reaction mixture was stirred for 30 min before triethylamine (62 mg, 0.62 mmol) was added dropwise over 10 min at 78 C. forming a white precipitate. The mixture was then allowed to stir at room temperature for 12 h. The reaction mixture was filtered and the filtrate was concentrated under reduced pressure at 30 C. The pale-yellow oil was purified by prep-HPLC to give N-(2,4-dichlorobenzyl)-4-(1,1-dioxido-1,2-thiazetidine-2-carbon-yl)benzamide (33 mg, 1300 yield) as a white solid. LC-MS: m/z=412.9 (M+H)+, retention time: 1.95 min (Method C).
TABLE-US-00002 TABLE 2 Structures of the compounds and their TREK activity. TREK-1 TREK- TREK-2 Entry Structure TREK-1 GC 2 GC 1
[0878] Fold-activation at 20 uM in oocytes expressing TREK1 (or in select cases other channels). [0879] +++>5 fold [0880] ++2.5-5 fold [0881] +1.5-2.5 fold
[0882] General procedure for synthesis of cyanoacrylamide examples RLA-5769, 5770, 5771, 5798.
[0883] To a solution of 4-amino-N-(2,4-dichlorobenzyl)benzamide (50 mg, 0.17 mmol) in CH.sub.2Cl.sub.2 (2 mL), was added the corresponding cyanoacrylic acid (2 eq, 0.34 mmol), DMAP (1.33 eq, 0.23 mmol), and EDCI.Math.HCl (2.66 eq, 0.45 mmol). The reaction mixture was then stirred at 70 C. until conversion was judged to be complete by UPLC/MS analysis. After cooling, water was added to the reaction mixture and the crude product collected as a solid by filtration, washed with CHCl.sub.3 and dried in vacuo.
##STR00177##
(E)-4-(3-(benzo[d][1,3]dioxol-5-yl)-2-cyanoacrylamido)-N-(2,4-dichlorobenzyl)benzamide (37 mg, 44%) was obtained as a white solid following the general procedure. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ppm 10.57 (s, 1H), 9.04 (t, 1H), 8.24 (s, 1H), 7.95 (d, 2H), 7.79 (d, 2H), 7.66 (d, 2H), 7.57 (d, 1H), 7.44-7.33 (dd, 2H), 7.19 (d, 1H), 6.21 (s, 1H), 4.51 (d, 2H). LCMS (ESI) exact mass for C.sub.25H.sub.17Cl.sub.2N.sub.3O.sub.4 [M+H].sup.+ calcd: 493.06, found 494.27.
##STR00178##
[0884] (E)-4-(2-cyano-3-(pyridin-3-yl)acrylamido)-N-(2,4-dichlorobenzyl)benzamide (34 mg, 44%), was obtained as a white solid following the general procedure. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ppm 10.73 (s, 1H), 9.05 (t, 1H), 8.77 (s, 1H), 8.45 (d, 1H), 8.40 (s, 1H), 7.95 (d, 2H), 7.80 (m, 2H), 7.69-7.64 (m, 2H), 7.43-7.38 (dd, 2H), 4.52 (d, 2H). LCMS (ESI) exact mass for C.sub.23H.sub.16Cl.sub.2N.sub.4O.sub.2 [M+H].sup.+ calcd: 450.06, found 451.29.
##STR00179##
[0885] (E)-4-(2-cyano-3-(furan-3-yl)acrylamido)-N-(2,4-dichlorobenzyl)benzamide (12 mg, 16%) was obtained as a white solid following the general procedure. 1H NMR (400 MHz, DMSO-d.sub.6) ppm 10.54 (s, 1H), 9.03 (t, 1H), 8.52 (s, 1H), 8.28 (s, 1H), 7.99 (s, 1H), 7.93 (d, 2H), 7.82 (d, 2H), 7.64 (s, 1H), 7.45-7.33 (dd, 2H), 7.22 (s, 1H), 4.51 (d, 2H). LCMS (ESI) exact mass for C.sub.22H.sub.15Cl.sub.2N.sub.3O.sub.3 [M+H].sup.+ calcd: 439.04, found 440.29.
##STR00180##
[0886] (E)-4-(2-cyano-3-(thiophen-3-yl)acrylamido)-N-(2,4-dichlorobenzyl)benzamide (40 mg, 52%) was obtained as a yellow solid following the general procedure. .sup.1H NMR (400 MHz, DMSO-d.sub.6) ppm 10.55 (s, 1H), 9.02 (t, 1H), 8.48 (s, 1H), 8.35 (s, 1H), 7.95-7.78 (m, 5H), 7.63 (d, J=2.1 Hz, 1H), 7.43-7.33 (m, 3H), 4.51 (d, 2H). LCMS (ESI) exact mass for C.sub.22H.sub.15Cl.sub.2N.sub.3O.sub.2S [M+H].sup.+ calcd: 455.02, found 456.34.
Synthesis of (E)-4-(2-cyano-3-cyclopropylacrylamido)-N-(2,4-dichlorobenzyl)benzamide (RLA-5797)
##STR00181##
[0887] To a solution of 4-amino-N-(2,4-dichlorobenzyl)benzamide (50 mg, 0.17 mmol) in CH.sub.2Cl.sub.2 (2 mL), was added (E)-2-cyano-3-cyclopropylacrylic acid (2 eq, 0.34 mmol), DMAP (1.33 eq, 0.23 mmol), and EDCI.Math.HCl (2.66 eq, 0.45 mmol). The reaction mixture was then stirred at 70 C. until conversion was judged to be complete by UPLC/MS analysis. After cooling, water was added to the reaction mixture. The solution was extracted with EtOAc three times. The combined organic phase was then washed with NH.sub.4Cl sat. aq. and brine, dried over MgSO.sub.4, filtered, and concentrated to afford the crude product. Purification was performed by automated flash chromatography on a Silicycle 25g silica gel cartridge, eluting over 15 column volumes with a gradient of 0 to 100% EtOAc in n-hexane (35 mL/min) to obtain the desired compound as a white solid (18 mg, 26%). .sup.1H NMR (400 MHz, (CD.sub.3).sub.2CO) 6 ppm 9.32 (s, 1H), 8.25 (t, 1H), 7.96 (d, 2H), 7.82 (d, 2H), 7.52 (d, 2H), 7.37 (d, 1H), 7.14 (d, 1H), 4.68 (d, 2H), 2.10 (m, 1H) 1.36 (m, 2H), 1.07 (m, 2H). LCMS (ESI) exact mass for C.sub.21H.sub.17Cl.sub.2N.sub.3O.sub.2 [M+H].sup.+ calcd: 413.07, found 414.37.
INFORMAL SEQUENCE LISTING
Chemogenetic Sequences Modified to Include a Cysteine Residue at an Amino Position Corresponding to Position 131 of TREK-1
TABLE-US-00003 SEQIDNO:1: ModifiedTREK-1fromMusmusculus MAAPDLLDPKSAAQNSKPRLSFSSKPTVLASRVESDSAINVMKWK TVSTIFLVVVLYLIIGATVFKALEQPQEISQRTTIVIQKQTFIAQ HACVNSTELDELIQQIVAAINAGIIPLGNSSNQVSHWDLGCSFFF AGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQ LGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL PAVIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFY KPVVWFWILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAA EWTANVTAEFKETRRRLSVEIYDKFQRATSVKRKLSAELAGNHNQ ELTPCRRTLSVNHLTSEREVLPPLLKAESIYLNGLTPHCAGEDIA VIENMK*131 SEQIDNO:2: ModifiedTREK-1fromMusmusculus SFSSKPTVLASRVESDSAINVMKWKTVSTIFLVVVLYLIIGATVF KALEQPQEISQRTTIVIQKQTFIAQHACVNSTELDELIQQIVAAI NAGIIPLGNSSNQVSHWDLGCSFFFAGTVITTIGFGNISPRTEGG KIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWN VSQTKIRIISTIIFILFGCVLFVALPAVIFKHIEGWSALDAIYFV VITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVLS MIGDWLRVISKKTKEEVGEFRAHAAEWTANVT111 SEQIDNO:3: ModifiedTREK-1fromMusmusculus VSTIFLVVVLYLIIGATVFKALEQPQEISQRTTIVIQKQTFIAQH ACVNSTELDELIQQIVAAINAGIIPLGNSSNQVSHWDLGCSFFFA GTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQL GTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALP AVIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYK PVVWFWILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRA85 SEQIDNO:4: ModifiedTREK-1fromHomosapiens MMNPRAKRDFYLAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVE SDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTT IVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQI SHWDLGCSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPL FGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIF ILFGCVLFVALPAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVA GGSDIEYLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVISKKTK EEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSIKRK LSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNG LTPHCAGEEIAVIENIK*142 SEQIDNO:5: ModifiedTREK-2fromMusmusculus MKFPIETPRKQVNWDPKVAVPAAAPPVCQPKSATNGHHPVPRLSI SSRATVVARMEGASQGGLQTVMKWKTVVAIFVVVVVYLVTGGLVF RALEQPFESSQKNTIALEKAEFLRDHICVSPQELETLIQHALDAD NAGVSPVGNSSNSSSHWDLGCAFFFAGTVITTIGYGNIAPSTEGG KIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQ VSQTKIRVISTILFILAGCIVFVTIPAVIFKYIEGWTALESIYFV VVTLTTVGFGDFVAGGNAGINYREWYKPLVWFWILVGLAYFAAVL SMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSV EIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDT GRFKASSQESINNRPNNLRLKGPEQLTKHGQGASEDNIINKFGST SKLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEDETEKMCN SDNSSTAMLTECIQQQAEMENGMVPTDTKDQGLENNSLLEDR N*156 SEQIDNO:6: ModifiedTREK-2fromMusmusculus QGGLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNT IALEKAEFLRDHICVSPQELETLIQHALDADNAGVSPVGNSSNSS SHWDLGCAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPL FGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILF ILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVA GGNAGINYREWYKPLVWFWILVGLAYFAAVLSMIGDWLRVLSKKT KE97 SEQIDNO:7: ModifiedTREK-2fromHomosapiens MKFPIETPRKQVNWDPKVAVPAAAPVCQPKSATNGQPPAPAPTPT PRLSISSRATVVARMEGTSQGGLQTVMKWKTVVAIFVVVVVYLVT GGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSPQELETLIQH ALDADNAGVSPIGNSSNNSSHWDLGCAFFFAGTVITTIGYGNIAP STEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKV FRKKQVSQTKIRVISTILFILAGCIVFVTIPAVIFKYIEGWTALE SIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLVWFWILVGLAY FAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETR RRLSVEIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVF AALDTGRFKASSQESINNRPNNLRLKGPEQLNKHGQGASEDNIIN KFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEET EKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLE DRN*161 SEQIDNO:8: ModifiedTREK-2fromHomosapiens GLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIA LEKAEFLRDHVCVSPQELETLIQHALDADNAGVSPIGNSSNNSSH WDLGCAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFG FLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFIL AGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGG NAGINYREWYKPLVWFWILVGLAYFAAVLSMIGDWLRVLSKKTKE EVGE95 SEQIDNO:9: ModifiedTRAAKfromMusmusculus MRSTTLLALLALVLLYLVSGALVFQALEQPHEQQAQKKMDHGRDQ FLRDHPCVSQKSLEDFIKLLVEALGGGANPETSWTNSSNHSSAWN LGCAFFFSGTIITTIGYGNIVLHTDAGRLFCIFYALVGIPLFGML LAGVGDRLGSSLRRGIGHIEAIFLKWHVPPGLVRSLSAVLFLLIG CLLFVLTPTFVFSYMESWSKLEAIYFVIVTLTTVGFGDYVPGDGT GQNSPAYQPLVWFWILFGLAYFASVLTTIGNWLRAVSRRTRAEMG GLTAQAASWTGTVTARVTQRTGPSAPPPEKEQPLLPSSLPAPPAV VEPAGRPGSPAPAEKVETPSPPTASALDYPSENLAFIDESSDTQS ERGCALPRAPRGRRRPNPSKKPSRPRGPGRLRDKAVPV*93 SEQIDNO:10: ModifiedTRAAKfromMusmusculus MRSTTLLALLALVLLYLVSGALVFQALEQPHEQQAQKKMDHGRDQ FLRDHPCVSQKSLEDFIKLLVEALGGGANPETSWTNSSNHSSAWN LGCAFFFSGTIITTIGYGNIVLHTDAGRLFCIFYALVGIPLFGML LAGVGDRLGSSLRRGIGHIEAIFLKWHVPPGLVRSLSAVLFLLIG CLLFVLTPTFVFSYMESWSKLEAIYFVIVTLTTVGFGDYVPGDGT GQNSPAYQPLVWFWILFGLAYFASVLTTIGNWLRAVSRRTRAEMG GLTAQ93 SEQIDNO:11: ModifiedTRAAKfromHomosapiens MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREK FLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSAWDL GCAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILL AGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGC LLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPR QDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTRAEMGG LTAQAASWTGTVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLG RPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCP LPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV*92 SEQIDNO:12: ModifiedTRAAKfromHomosapiens MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREK FLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSAWDL GCAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILL AGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGC LLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPR QDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTRAEMGG LTAQAASWTGTVTARVTQRAGPAAPPPEKEQ92
REFERENCES
[0888] 1. Enyedi, P. & Czirjak, G. Molecular background of leak K.sup.+ currents: two-pore domain potassium channels. Physiol Rev 90, 559-605 (2010). [0889] 2. Feliciangeli, S., Chatelain, F.C., Bichet, D. & Lesage, F. The family of K2P channels: salient structural and functional properties. J Physiol (2014). [0890] 3. Lesage, F. & Barhanin, J. Molecular physiology of pH-sensitive background K(2P) channels. Physiology (Bethesda) 26, 424-37 (2011). [0891] 4. Kanda, H. et al. TREK-1 and TRAAK Are Principal K(+) Channels at the Nodes of Ranvier for Rapid Action Potential Conduction on Mammalian Myelinated Afferent Nerves. Neuron (2019). [0892] 5. Brohawn, S. G. et al. The mechanosensitive ion channel TRAAK is localized to the mammalian node of Ranvier. Elife 8(2019). [0893] 6. Alloui, A. et al. TREK-1, a K.sup.+ channel involved in polymodal pain perception. Embo J 25, 2368-76 (2006). [0894] 7. Devilliers, M. et al. Activation of TREK-1 by morphine results in analgesia without adverse side effects. Nat Commun 4, 2941 (2013). [0895] 8. Vivier, D. et al. Development of the first Two-Pore Domain Potassium Channel TREK-1 (TWIK-Related K+ Channel 1)-selective agonist possessing in vivo anti-nociceptive activity. J Med Chem (2017). [0896] 9. Yoshida, K. et al. Leak potassium channels regulate sleep duration. Proc Natl Acad Sci USA 115, E9459-E9468 (2018). [0897] 10. Steinberg, E. A., Wafford, K. A., Brickley, S. G., Franks, N. P. & Wisden, W. The role of K2p channels in anaesthesia and sleep. Pflugers Arch 467, 907-16 (2015). [0898] 11. Yarishkin, O. et al. TREK-1 channels regulate pressure sensitivity and calcium signaling in trabecular meshwork cells. J Gen Physiol 150, 1660-1675 (2018). [0899] 12. Royal, P. et al. Migraine-Associated TRESK Mutations Increase Neuronal Excitability through Alternative Translation Initiation and Inhibition of TREK. Neuron 101, 232-245 e6 (2019). [0900] 13. Heurteaux, C. et al. Deletion of the background potassium channel TREK-1 results in a depression-resistant phenotype. Nat Neurosci 9, 1134-41 (2006). [0901] 14. Lambert, M. et al. Loss of KCNK3 is a hallmark of RV hypertrophy/dysfunction associated with pulmonary hypertension. Cardiovasc Res 114, 880-893 (2018). [0902] 15. Zyrianova, T. et al. K2P2.1 (TREK-1) potassium channel activation protects against hyperoxia-induced lung injury. Sci Rep 10, 22011 (2020). [0903] 16. Honore, E., Maingret, F., Lazdunski, M. & Patel, A.J. An intracellular proton sensor commands lipid- and mechano-gating of the K(+) channel TREK-1. EMBO J 21, 2968-76 (2002). [0904] 17. Sandoz, G., Douguet, D., Chatelain, F., Lazdunski, M. & Lesage, F. Extracellular acidification exerts opposite actions on TREK1 and TREK2 potassium channels via a single conserved histidine residue. Proc Natl Acad Sci USA 106, 14628-33 (2009). [0905] 18. Brohawn, S. G., Campbell, E. B. & MacKinnon, R. Physical mechanism for gating and mechanosensitivity of the human TRAAK K.sup.+ channel. Nature 516, 126-30 (2014). [0906] 19. Maingret, F. et al. TREK-1 is a heat-activated background K(+) channel. Embo J 19, 2483-91 (2000). [0907] 20. Natale, A. M., Deal, P. E. & Minor, D. L. Structural Insights into the Mechanisms and Pharmacology of K. J Mol Biol 433, 166995 (2021). [0908] 21. Mathie, A., Veale, E. L., Cunningham, K. P., Holden, R. G. & Wright, P. D. Two-Pore Domain Potassium Channels as Drug Targets: Anesthesia and Beyond. Annu Rev Pharmacol Toxicol (2020). [0909] 22. Decher, N., Rinn, S., Bedoya, M., Gonzalez, W. & Kiper, A. K. Molecular Pharmacology of K 2P Potassium Channels. Cell Physiol Biochem 55, 87-107 (2021). [0910] 23. Sterbuleac, D. Molecular determinants of chemical modulation of two-pore domain potassium channels. Chem Biol Drug Des 94, 1596-1614 (2019). [0911] 24. Levitz, J. et al. Heterodimerization within the TREK channel subfamily produces a diverse family of highly regulated potassium channels. Proc Natl Acad Sci USA 113, 4194-9 (2016). [0912] 25. Hwang, E. M. et al. A disulphide-linked heterodimer of TWIK-1 and TREK-1 mediates passive conductance in astrocytes. Nat Commun 5, 3227 (2014). [0913] 26. Czirjak, G. & Enyedi, P. Formation of functional heterodimers between the TASK-1 and TASK-3 two-pore domain potassium channel subunits. J Biol Chem 277, 5426-32 (2002). [0914] 27. Lengyel, M., Czirjk, G., Jacobson, D. A. & Enyedi, P. TRESK and TREK-2 two-pore-domain potassium channel subunits form functional heterodimers in primary somatosensory neurons. J Biol Chem 295, 12408-12425 (2020). [0915] 28. Sternson, S. M. & Roth, B. L. Chemogenetic tools to interrogate brain functions. Annu Rev Neurosci 37, 387-407 (2014). [0916] 29. Atasoy, D. & Sternson, S. M. Chemogenetic Tools for Causal Cellular and Neuronal Biology. Physiol Rev 98, 391-418 (2018). [0917] 30. Hertz, N. T. et al. Chemical genetic approach for kinase-substrate mapping by covalent capture of thiophosphopeptides and analysis by mass spectrometry. Curr Protoc Chem Biol 2, 15-36 (2010). [0918] 31. Shah, K., Liu, Y., Deirmengian, C. & Shokat, K. M. Engineering unnatural nucleotide specificity for Rous sarcoma virus tyrosine kinase to uniquely label its direct substrates. Proc Natl Acad Sci USA 94, 3565-70 (1997). [0919] 32. Runcie, A. C., Chan, K. H., Zengerle, M. & Ciulli, A. Chemical genetics approaches for selective intervention in epigenetics. Curr Opin Chem Biol 33, 186-94 (2016). [0920] 33. Baud, M. G. J. et al. Chemical biology. A bump-and-hole approach to engineer controlled selectivity of BET bromodomain chemical probes. Science 346, 638-641 (2014). [0921] 34. Alexander, G. M. et al. Remote control of neuronal activity in transgenic mice expressing evolved G protein-coupled receptors. Neuron 63, 27-39 (2009). [0922] 35. Armbruster, B.N., Li, X., Pausch, M.H., Herlitze, S. & Roth, B.L. Evolving the lock to fit the key to create a family of G protein-coupled receptors potently activated by an inert ligand. Proc Natl Acad Sci USA 104, 5163-8 (2007). [0923] 36. Magnus, C. J. et al. Ultrapotent chemogenetics for research and potential clinical applications. Science 364(2019). [0924] 37. Lolicato, M. et al. K2P2.1 (TREK-1)-activator complexes reveal a cryptic selectivity filter binding site. Nature 547, 364-368 (2017). [0925] 38. Al-Moubarak, E., Veale, E. L. & Mathie, A. Pharmacologically reversible, loss of function mutations in the TM2 and TM4 inner pore helices of TREK-1 K2P channels. Sci Rep 9, 12394 (2019). [0926] 39. Bagriantsev, S. N., Clark, K. A. & Minor, D. L., Jr. Metabolic and thermal stimuli control K(2P)2.1 (TREK-1) through modular sensory and gating domains. EMBO J 31, 3297-308 (2012). [0927] 40. Pope, L. et al. Protein and Chemical Determinants of BL-1249 Action and Selectivity for K2P Channels. ACS Chem Neurosci 9, 3153-3165 (2018). [0928] 41. Schewe, M. et al. A pharmacological master key mechanism that unlocks the selectivity filter gate in K(+) channels. Science 363, 875-880 (2019). [0929] 42. Magnus, C. J. et al. Chemical and genetic engineering of selective ion channel-ligand interactions. Science 333, 1292-6 (2011). [0930] 43. Auffenberg, E. et al. Remote and reversible inhibition of neurons and circuits by small molecule induced potassium channel stabilization. Sci Rep 6, 19293 (2016). [0931] 44. Fortin, D. L. et al. Optogenetic photochemical control of designer K+ channels in mammalian neurons. J Neurophysiol 106, 488-96 (2011). [0932] 45. Sandoz, G., Levitz, J., Kramer, R. H. & Isacoff, E. Y. Optical control of endogenous proteins with a photoswitchable conditional subunit reveals a role for TREK1 in GABA(B) signaling. Neuron 74, 1005-14 (2012). [0933] 46. Bagriantsev, S. N., Peyronnet, R., Clark, K. A., Honore, E. & Minor, D. L., Jr. Multiple modalities converge on a common gate to control K2P channel function. EMBO J 30, 3594-606 (2011). [0934] 47. Bagriantsev, S. N. et al. A high-throughput functional screen identifies small molecule regulators of temperature- and mechano-sensitive K2P channels. ACS Chem Biol 8, 1841-51 (2013).