Use of green coffee based compositions for improving insulin profile
12599643 ยท 2026-04-14
Assignee
Inventors
- Lucas Actis Goretta (Singapore, SG)
- Jacklyn Ruilin Chen (Singapore, SG)
- Rachid Bel-Rhlid (Savigny, CH)
- Robin Willows (Echandens, CH)
- MARINE KRAUS (Vuarrens, CH)
- Christian Chabert (Onex, CH)
Cpc classification
A23F3/166
HUMAN NECESSITIES
A61K31/192
HUMAN NECESSITIES
International classification
A23F3/16
HUMAN NECESSITIES
A61K31/192
HUMAN NECESSITIES
Abstract
The present invention relates to a green coffee-based composition comprising hydrolysed chlorogenic acid for use in the treatment or prevention of a disorder linked to an increase in plasma postprandial insulin in a subject. The invention relates also to the non-therapeutic use of a composition comprising an esterase treated decaffeinated green coffee extract with an amount of 40-200 mg administered to a subject per day to decrease plasma postprandial insulin concentration. A further aspect of the invention is a process for forming green coffee based compositions.
Claims
1. A method for treating an increase in a plasma postprandial insulin concentration in a subject in need thereof, the method comprising administering to the subject as part of or at the end of a regular meal an effective dose of esterase treated decaffeinated green coffee extract with an amount of 40-200 mg/day, wherein the effective dose of esterase treated decaffeinated green coffee extract decreases the plasma postprandial insulin concentration in the subject.
2. The method according to claim 1, wherein the method induces glucose uptake in skeletal muscle cells of the subject.
3. The method according to claim 1, wherein the method improves pancreatic beta cell sensitivity to glucose in the subject.
4. The method according to claim 1, wherein the subject has a disorder selected from the group consisting of diabetes; impairment of glucose metabolism; hyperinsulinemia; and insulin resistance.
5. The method according to claim 1, wherein the subject is a diabetic or pre-diabetic patient.
6. The method according to claim 1, wherein the esterase treated decaffeinated green coffee extract is administered in a composition selected from the group consisting of a liquid beverage composition, a powder, and a snack bar.
7. The method according to claim 1, wherein the dose of the esterase treated decaffeinated green coffee extract comprises a total content of caffeic acid and ferulic acid between 10 and 60 mg.
8. The method according to claim 1, wherein the esterase treated decaffeinated green coffee extract comprises a ratio of caffeic acid:ferulic acid greater than 2:1.
9. The method according to claim 1, wherein the esterase treated decaffeinated green coffee extract comprises a ratio of caffeic acid:ferulic acid between 3:1 to 10:1.
10. The method according to claim 1, wherein the method further comprises administering a meal of at least 200 kcal to the subject.
11. The method according to claim 1, wherein the subject is a human.
12. The method according to claim 1, wherein the subject is at risk of developing type-2 diabetes, insulin resistance, or glucose intolerance.
13. The method according to claim 10, wherein the method decreases insulin concentration in plasma of the subject by at least 20% in comparison to consumption of the meal without administration of the esterase treated decaffeinated green coffee extract.
14. The method according to claim 10, wherein the esterase treated decaffeinated green coffee extract is administered as part of the meal.
15. The method according to claim 10, wherein the esterase treated decaffeinated green coffee extract is administered at the end of the meal.
16. The method according to claim 1, wherein the amount of esterase treated decaffeinated green coffee extract administered to the subject is 200 mg/day.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5) ); FQAs (.square-solid.); and di-CQAs () from decaffeinated green coffee extract (200 g/L) by L. johnsonii esterase (16.5 U/ml) and formation of caffeic acid (.box-tangle-solidup.) and ferulic acid (.diamond-solid.) as function of time. Reaction volume was 1 ml. The reactions were performed in duplicate.
(6)
(7)
DETAILED DESCRIPTION OF THE INVENTION
(8) The present invention pertains to a composition comprising a green coffee-based composition comprising esterase treated decaffeinated green coffee extract (HDGCE) for use in the treatment or prevention of a disorder linked to an increase in plasma postprandial insulin in a subject wherein the subject is administered an effective dose of esterase treated decaffeinated green coffee extract with an amount of 40-200 mg/day.
(9) The present invention further pertains to a composition comprising a green coffee-based composition comprising esterase treated decaffeinated green coffee extract (HDGCE) for use in inducing glucose uptake in skeletal muscle cells in a subject wherein the subject is administered an effective dose of esterase treated decaffeinated green coffee extract with an amount of 40-200 mg/day.
(10) The present invention further pertains to a composition comprising a green coffee-based composition comprising esterase treated decaffeinated green coffee extract (HDGCE) for use in improving pancreatic beta cell sensitivity to glucose in a subject, wherein the subject is administered an effective dose of esterase treated decaffeinated green coffee extract with an amount of 40-200 mg/day.
(11) In one embodiment the composition is a liquid beverage composition.
(12) The term disorder is selected from the group consisting of diabetes, for example gestational diabetes; impairment of glucose metabolism; hyperinsulinemia or insulin resistance. In one embodiment, the subject is a diabetic or pre-diabetic patient.
(13) In one embodiment of the present invention, the HDGCE composition has a total content of caffeic acid and ferulic acid in a range between 10 and 60 mg. The composition may be a heat-treated composition. In another embodiment of the present invention, the HDGCE composition has ratio of caffeic acid:ferulic acid is at least greater than 2:1. In another embodiment of the present invention, the HDGCE composition has ratio of caffeic acid:ferulic acid ranges from 3:1 to 10:1.
(14) The term functional food product means a beverage or food composition comprising at least 40 to 200 mg of HDGCE. The food composition may be a powder form such as chocolate or malt based composition. The food composition may also be a snack such as a cereal bar comprising HDGCE.
(15) The term esterase treated refers to incubation of the decaffeinated green coffee extract with purified chlorogenate esterase or microorganism containing such an esterase. A chlorogenate esterase for example is described in U.S. Pat. No. 8,481,028 or for example in Bel-Rhlid et al.: Biotranformation of caffeoyl quinic acids from green coffee extracts by Lactobacillus johnsonii NCC 533 (2013): AMB express vol 3:28.
(16) An esterase is a hydrolase enzyme that splits esters into an acid and an alcohol in a chemical reaction with water called hydrolysis. The incubation time can be from 30 minutes to 6 hrs at temperatures ranging from 20 to 50 C. related to concentration of the enzyme such that hydrolysis of at least 80% of total chlorogenic acid present in the decaffeinated green coffee extract is reached. In one embodiment the esterase is from L. johnsonii.
(17) The term decaffeinated green coffee extract refers to green coffee beans decaffeinated by for instance hot water or extraction with organic solvents or supercritical CO.sub.2 well known to a skilled person in the art. The caffeine content is lower than 5%, may be 2 to 3% W/W.
(18) The term amount of 40-200 mg/day refers to the esterase treated decaffeinated green coffee extract of 40-200 mg dry weight, which may be dissolved, for instance in water or integrated to a consumable food product such as cereals, soluble coffee, chocolate or food complement such as capsules or tablets fit for consumption by the subject. In one embodiment the amount of esterase treated decaffeinated green coffee extract of 40-200 mg dry weight is dissolved in water.
(19) Typically, postprandial hyper-insulinemia may promote the development of insulin resistance, metabolic syndrome, glucose intolerance and type-2 diabetes [Kopp W., Metabolism. 2003, July; 52(7):840-844]. Lowering the insulin demand after a meal however, can on one hand reduce the deterioration of the glycemic control in type-2 diabetes and on the other hand reduce the risk of developing type-2 diabetes in predisposed subjects. Hence, advantageously, the green coffee based composition as described above are for use in the treatment or prevention of diabetes (for example type-2 diabetes or gestational diabetes), impairment of glucose metabolism, hyperinsulinemia or insulin resistance.
(20) In an embodiment of the invention, the green coffee based composition are for use in a diabetic or pre-diabetic patient. A pre-diabetic patient is a subject showing insulin resistance or impaired glucose metabolism and is predisposed, for instance family history, lifestyle or genetics, for developing diabetes later in life. Reducing insulin secretion reduces the risk of the pancreas becoming exhausted in the long term, and so is beneficial for management of the pancreas in pre-diabetes or patients with metabolic disorders. The use of a composition comprising of green coffee based component, in particular a composition comprising esterase treated decaffeinated green coffee extract with an amount of 40-200 mg/day would consequently reduce the risk and/or the development of diabetes, impaired glucose metabolism, hyperinsulinemia or insulin resistance in those subjects.
(21) Prevalence of diabetes, insulin resistance or glucose intolerance is mostly observed in adult humans. However, more and more children are affected, or predisposed or at risk of developing such a disorder later in life. Hence, advantageously, prevention and/or treatment of those disorders should start at a young age. Alternatively, and similarly as observed with humans; diabetes, hyperinsulinemia or insulin resistance are more and more widespread among animals, particularly with animals kept as pets. Hence, the invention also pertains to cats and dogs.
(22) The composition for use according to the invention may be in any suitable format, for example the composition may be in the form of a liquid composition, in the form of a beverage, for example a liquid drink, a shake drink, a nutritional composition or a liquid meal replacement.
(23) An important method of controlling food hygiene risks is to heat treat edible compositions, which may harbour food pathogens or spoilage organisms. Well-known examples of such heat treatments are pasteurization, for example heating an edible material to 70 C. for 2 minutes or 75 C. for 26 seconds or 80 C. for 5 seconds, and ultra-high temperature (UHT) treatment, for example heating an edible material to above 135 C. for at least 2 seconds.
(24) The composition for use according to the invention may be administered in a daily dose to provide HDGCE between 40 mg and 200 mg dry weight per subject per day. Those doses should assure a sufficient daily quantity for providing the desired effect to a subject in at least a mid-term period.
(25) The composition for use according to the invention may be provided as before, part or at the end of a regular meal. For example, the composition may be provided as before, part or at the end of a meal to confer its benefits by reducing the insulin postprandial response in combination with that meal. An improved effect can be expected by providing the composition directly at the end of the meal, for example as part of the dessert.
(26) A further aspect of the present invention is the non-therapeutic use of a green coffee based composition comprising esterase treated decaffeinated green coffee extract with an amount of 40-200 mg/day to decrease plasma postprandial insulin concentration, wherein the amount of caffeic acid and ferulic is in the ratio of caffeic:ferulic is at least more than 2:1, for example 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1 or 10:1.
(27) It is advantageous that a green coffee based composition comprising esterase treated decaffeinated green coffee extract with an amount of 40-200 mg/day can also be administered to subjects, for example healthy subjects, which may be at risk of developing diabetes type-2, insulin resistance or glucose intolerance at some later time. A composition comprising green coffee as disclosed herein, provides a reduced insulin level after consumption.
(28) Another aspect of the invention provides a process for forming HDGCE composition comprising the steps of; (i) Preparing a decaffeinated green coffee extract by contacting green coffee beans with water, steam, organic solvent, super critical CO.sub.2 and/or mixtures thereof; (ii) Optionally drying the decaffeinated green coffee extract; (iii) Contacting the obtained decaffeinated green coffee extract with esterase enzyme, at pH ranging from 4 to 7 and temperature ranging from 20 to 50 C. for incubation time ranging from 1 to 6 hours; (iv) Heating the above enzyme treated green coffee extract from temperature ranging from 80 to 120 C. for 1 to 30 minutes to deactivate the enzyme and to pasteurize the extract; and (v) Drying the extract to obtain the esterase treated decaffeinated green coffee extract (HDGCE). In one embodiment, the drying step (ii) is spray or freeze drying. In another embodiment the esterase enzyme is chlorogenate esterase in a concentration ranging from 1 to 20 U/200 mg of green coffee extract W/W dissolved in 1 ml of water or buffer.
(29) Those skilled in the art will understand that they can freely combine all features of the present invention disclosed herein. In particular, features described for the therapeutic use of the composition may be combined with the non-therapeutic use and vice versa. Further, features described for different embodiments of the present invention may be combined. Further advantages and features of the present invention are apparent from the figures and examples.
EXAMPLES
Example 1
(30) Purification, Characterization and Donning of Esterase from Lactobacillus johnsonii (NCC 533)
(31) The esterase activity was identified in Lactobacillus johnsonii whole cells. The enzyme was purified and characterized. The gene was annotated (LJ-1228, Gene=1158601 1159347 Reversed Product=alpha/beta hydrolase (see sequences below). The gene was then over-expressed in a food-grade E. coli and enzyme purified by HPLC (HIC column TSK gel Phenyl-5PW, Linear gradient of 1 to 0 mol (NH.sub.4).sub.2SO.sub.4/L in NaPO.sub.4 (50 mM) pH 7.0+1 mM EDTA. Flow 0.8 ml/min).
(32) DNA Sequence/Nucleotides Sequence
(33) TABLE-US-00001 Atggagactacaattaaacgtgatggtctaaacttacatggtttacttg aaggaaccgataagattgaaaatgatacgattgctattttaatgcatgg ttttaaaggtgatttgggttatgatgacagcaagattttgtatgctctc tctcactacttaaatgatcaaggcctcccaacaattcgttttgactttg atggatgcggaaaaagtgatggtaaatttgaagatatgactgtctatag cgaaatcctagatgggataaaaatattagattatgttcgtaatactgtt aaggcaaaacatatctatttagtgggacactcccaaggtggagtagtag cgtcaatgctggctggatattatcgagatgttattgaaaaattggcttt actctctcctgcagcaactcttaagtctgatgctttagatggagtttgt cagggtagtacttatgatccaacgcatatccctgaaactgtcaatgtta gtggctttgaagtaggaggagatactttagaacggctcaattattgcct atttatcaaacagcggaacattataatagggaaactttattgattcatg gatagcagataaagtcgtgtcacctaatgcttcaagaaaatttcataca cttttgcctaaaagtgagctccatttaattccagatgagggtcacatgt ttaacggaaaaaatagacctgaagtattaaaattagttggtgagttttt aataaaataa
Amino Acid Sequence
(34) TABLE-US-00002 1 mettikrdglnlhgllegtdkiendtiailmhgfkgdldyddskilyalshylndqglpt 61 irfdfdgcgksdgkfedmtvyseildgikildyvrntvkakhiylvghsqggvvasmlag 121 yyrdvieklallspaatlksdaldgvcqgstydpthipetvnvsgfevggayfrtaqllp 181 iyqtaehynretllihgladkvvspnasrkfhtllpkselhlipdeghmfngknrpevlk 241 lvgeflik
Identification of Optimal pH of L. johnsonii Esterase
(35) The optimum pH was determined by using glycine buffer, acetate buffer, Tris buffer, phosphate buffer and water. 5-CQA was used as substrate (50 mol/ml). As we can see in
(36) Identification of Optimal Temperature of L. johnsonii Esterase
(37) The optimum temperature was determined by using 5-CQA as substrate (50 mol/ml) at different temperatures from 10 C. to 90 C. As we can see in
(38) Substrate Specificity
(39) The substrate specificity of L. johnsonii esterase was studied using different 4-nitrophenyl derivatives. As we can see in
(40) Treatment of Decaffeinated Green Coffee Extract with L. johnsonii Esterase.
(41) Reaction Kinetics: Lab Scale Trials
(42) Kinetic studies were performed on decaffeinated green coffee extract (200 mg/ml) using L. johnsonii esterase at different concentrations (1.65, 3.3, 4.95, 8.25 and 16.25 U/ml). The reactions were performed in 1 ml volume, at pH 4.5 and 37 C. The results are summarized in the following tables. The concentrations of the different compounds are in mg/ml.
(43) TABLE-US-00003 Time (h) 0 1 2 3 4 Enzyme (U) 0 1.65 1.65 1.65 1.65 DGCE 200 200 200 200 200 (mg/ml) CQAs 52.11 21.51 18.05 16.18 15.14 FQAs 11.03 9.89 9.09 9.56 8.3 di-CQAs 13.22 3.34 2.88 2.65 2.44 CA 0.49 19.82 21.51 22.35 22.08 FA 0.21 3.76 4.11 4.45 4.36 Caffeine 3.20 3.13 3.09 3.10 3.00
(44) TABLE-US-00004 Time (h) 0 1 2 3 4 Enzyme (U) 0 3.3 3.3 3.3 3.3 DGCE 200 200 200 200 200 (mg/ml) CQAs 52.25 17.77 14.62 12.88 11.09 FQAs 11.1 1.65 1.46 1.28 1.11 di-CQAs 13.29 2.41 2.14 2.08 1.83 CA 0.48 25.63 27.23 27.56 26.27 FA 0.20 4.09 4.58 4.77 4.80 Caffeine 3.21 3.05 3.08 3.04 2.90
(45) TABLE-US-00005 Time (h) 0 1 2 3 4 Enzyme (U) 0 4.95 4.95 4.95 4.95 DGCE 200 200 200 200 200 (mg/ml) CQAs 50.85 15.88 12.86 10.93 10.04 FQAs 10.74 1.66 1.29 1.07 0.57 di-CQAs 11.75 1.83 1.72 1.44 1.37 CA 0.49 26.42 27.77 27.82 27.65 FA 0.21 4.30 4.79 4.94 5.19 Caffeine 3.12 3.03 3.04 2.94 2.98
(46) TABLE-US-00006 Time (h) 0 1 2 3 4 Enzyme (U) 0 8.25 8.25 8.25 8.25 DGCE 200 200 200 200 200 (mg/ml) CQAs 51.68 13.03 9.78 8.07 6.93 FQAs 10.92 1.32 0.56 0.50 0.49 di-CQAs 13.48 1.53 1.17 0.95 0.90 CA 0.48 27.13 28.52 29.22 29.40 FA 0.21 4.90 5.72 6.08 6.36 Caffeine 3.20 2.97 2.95 2.94 2.92
(47) TABLE-US-00007 Time (h) 0 1 2 3 4 Enzyme (U) 0 16.5 16.5 16.5 16.5 DGCE 200 200 200 200 200 (mg/ml) CQAs 51.46 8.90 6.34 4.87 3.91 FQAs 10.93 0.54 0.48 0.44 0.42 di-CQAs 13.19 1,29 1.02 0.58 0.30 CA 0.48 27.26 28.79 29.19 29.90 FA 0.21 4.90 5.72 6.08 6.36 Caffeine 3.18 2.80 2.83 2.79 2.82
Reaction Kinetics as Function of Time
(48) Kinetic studies were performed on decaffeinated green coffee extract (200 mg/ml) using L. johnsonii esterase at concentration of 16.25 U/ml. The reactions were performed in 1 ml reaction volume, at pH 4.5 and 37 C. The kinetics were carried out for 1, 2, 3 and 4 hours. The concentration of the different compounds are in mg/ml.
(49) Reaction Kinetics as Function of Enzyme Concentration
(50) Kinetic studies were performed on decaffeinated green coffee extract (200 mg/ml) using L. johnsonii esterase at different concentrations (5, 10, 15, 25 and 50 l/ml that correspond respectively to 1.65, 3.3, 4.95, 8.25 and 16.5 U/ml). The reactions were performed in 1 ml volume, at pH 4.5 and 37 C. (see
(51) Pilot Plant Trial
(52) Treatment of Decaffeinated Green Coffee Extract with L. johnsonii Esterase
(53) Decaffeinated green coffee extract (1.76 Kg) was dissolved in water (8.8 Kg) under stirring. The pH was then adjusted to pH 4.5 by addition of chlorhydric acid (HCl, 0.36 Kg). To this solution, 0.024 Kg of enzyme (Esterase from L. johnsonii) was added in two times: 0.016 Kg of enzyme was added at time T=0 h and 0.008 Kg of enzyme was added after 3 h of reaction. The reaction was performed at 37 C. for 6 hours. The mixture was then heated for 10 min at 98 C. to inactive the enzyme. After centrifugation (2 min at 5000 g) and filtration (0.45 m), the mixture was freeze-dried and the resulting powder was used for the preparation of beverages used for clinical study.
(54) UPLC Analysis
(55) The method used to analyze the samples allows the quantitative determination of caffeic acid, chlorogenic acid isomers (5-CQA, 4-CQA, 3-CQA, 4-FQA, 5-FQA, 3,4-diCQA, 3,5-diCQA and 4,5-diCQA) and caffeine in liquid coffee extract and pure soluble coffee, extracted either from roasted or green beans. The samples were centrifuged (5000 g) for 5 min at 15 C. 100 L of the resulting supernatant were added to 900 L of methanol/water (80:20) and filtered on 0.2 m before analysis. The analyses were performed on an UPLC equipped with a pump, a degassing system, a sample injector with injection loop more than 5 L, an photodiode array detector (325 and 275 nm wavelength) and an appropriate data software. The separation of molecules was carried on an ACQUITY UPLC BEH Shield RP 18, 1.7 m, 2.1100 mm, column (from Waters). Mobile phase A was 5% acetonitrile in water with 0.1% phosphoric acid and mobile phase B was 100% acetonitrile with 0.1% phosphoric acid. Flow rate was 0.4 mL/min, column temperature 35 C. and injection volume was 2 L.
(56) Clinical Trial
(57) HDGCE was be tested on the Glucose response (GR) and Insulin response (IR) in comparison to a placebo (crossover, randomized, single blind trial). A total of twelve (12) subjects participated in the study. Each subject went into the study site between 7:30 am to 3:00 pm on 2 separate days after 10-14 hour overnight fast.
(58) The following was done on both visits:
(59) Subjects remained seated quietly during the entire test session. Subjects did not smoke, consumed alcohol, coffee (in any form) or involved in any unusual vigorous physical activity for 24 hours prior to test. When volunteers arrived to the site, a cannula was inserted into a vein for blood sampling. 5 ml of whole blood was drawn during fasting state. Then, volunteers received a standardized food challenge. Similar to the Oral Glucose Tolerance test (OGTT), a mixed macronutrient challenge has been recently proposed as optimal nutritional stressor to be used in nutrition research by Stroeve et al (13). The food challenge was be prepared by the research staff from two commercially available products. Briefly, 237.5 ml of a nutritional drink plus 100 ml of whipping cream was stirred and served in a glass/bottle. The subjects were asked to consume the food challenge followed by the treatment within a 15 minutes time frame. Further venous blood samples (3 ml) were drawn at 15 min, 30 min, 45 min, 60 min(1 h), 90 min(1.5 h), 120 min(2 h), 180 min(3 h), 240 min(4 h), 300 min(5 h) and 360 min(6 h) after the food is consumed. A minimum of two days washout period was allowed between the administrations of the treatments.
(60) The collected blood samples at 0 min, 15 min, 30 min, 45 min, 60 min (1 h), 90 min (1.5 h), 120 min (2 h), 180 min (3 h), 240 min (4 h), 300 min (5 h) and 360 min (6 h) were analyzed for blood glucose and insulin. Blood glucose was analyzed using calibrated YSI 2300 Stat Plus Glucose and Lactate analyzer and insulin was determined by Insulin (human) AlphaLISA Detection Kit and read by EnSpire Alpha Plate Reader. The glucose and insulin values were plotted against time to determine the Incremental Area Under Curve (IAUC).
(61) Statistical Considerations
(62) All data were log-transformed to achieve normality of the residuals in the models. Hence, all the treatment effects are expressed as ratios of geometric means. Geometric mean is an estimate of the median. In Table 2, when a model-based treatment effect is below 1, the values estimated (AUC or Cmax) are higher in the placebo group. If the ratio is greater than 1, the estimation is higher in the coffee extract group. AUC and Cmax refer to incremental AUC and incremental Cmax, respectively.
(63) The treatment effect on tmax was estimated using the Wilcoxon signed-rank test, a non-parametric statistical test. The estimates presented in Table 2 for tmax are the Hodges-Lehmann estimates which are estimates of differences of medians between treatment groups.
(64) Insulin
(65) TABLE-US-00008 TABLE 1 Insulin: summary of statistics of AUC, C.sub.max and t.sub.max by treatment Insulin n mean sd geomean geosd median min max AUC (mU * min/L) Placebo 12 10796.19 5493.58 9354.14 1.80 10923.66 3235.21 17994.00 Coffee Extract 12 8758.97 3997.48 7815.34 1.70 7779.23 2485.87 16030.34 Cmax (mU/L) Placebo 12 78.04 32.36 71.15 1.60 78.09 30.40 121.10 Coffee Extract 12 63.28 34.45 55.65 1.70 57.30 21.00 143.40 tmax (min) Placebo 12 100.00 57.33 84.49 1.87 90.00 30.00 180.00 Coffee Extract 12 96.25 61.50 75.27 2.22 90.00 15.00 180.00
(66) TABLE-US-00009 TABLE 2 Model-based estimated treatment effects with 95% CI. For AUC and Cmax, the estimates reported are ratios of geometric means of Coffee Extract over Placebo. For tmax, the estimate of the difference of medians between Coffee Extract and placebo is Reported. Coffee Extract vs Placebo Estimate Lower Upper p-value AUC 0.830 0.676 1.020 0.071 Cmax 0.772 0.631 0.946 0.018 tmax 4.813 60.000 45.000 0.888
(67) TABLE-US-00010 TABLE 3 Insulin: Summary statistics by treatment and by timepoint Timepoint n mean sd geomean geosd median min max Placebo 15 min 12. 27.27 27.04 19.74 2.27 19.90 4.40 105.70 30 min 12 49.44 22.52 45.68, 1.49 41.35 29.20 102.30 45 min 12 56.70 32.77 48.41 1.82 49.20 21.60 117.40 60 min 12 57.94 33.89 48.27 1.97 50.55 14.40 123.20 90 min 12 55.94 35.11 46.25 1.94 46.05 16.10 122.80 120 min 12 60.36 36.01 49.45 2.01 52.55 12.90 112.90 300 min 12 53.21 39.93 39.07 2.36 42.30 12.00 118.50 240 min 12 19.26 20.74 11.37 2.91 8.45 3.50 60.70 300 min 12 6.33 4.55 4.80 2.23 3.95 1.40 13.90 360 min 12 4.16 3.21 3.18 2.18 2.45 0.70 11.10 Coffee Extract 15 min 12 25.44 17.91 20.04 2.12 21.00 5.40 64.80 30 min 12 48.43 37.19 38.55 1.98 34.25 14.40 133.80 45 min 12 52.37 42.51 38.88 2.35 41.95 5.80 151.90 60 min 12 49.27 27.83 43.80 1.62 40.05 24.10 105.30 90 min 12 42.11 16.81 39.30 1.47 38.75 23.50 74.00 120 min 12 45.93 26.70 38.71 1.89 42.60 13.40 103.20 180 min 12 39.57 23.44 31.74 2.14 40.15 8.10 81.30 240 min 12 19.47 21.30 10.35 3.57 8.65 1.00 66.00 300 min 12 6.19 6.00 4.40 2.32 3.90 1.20 22.50 360 min 12 4.75 5.02 3.06 2.61 2.25 0.70 16.30
(68) TABLE-US-00011 TABLE 4 Glucose: Summary statistics of AUC, Cmax and tmax by treatment Glucose n mean sd geomean geosd median min max AUC (mmol * min/L) Placebo 12 225.82 174.68 171.61 2.27 197.17 33.00 671.45 Coffe Extract 12 207.82 146.25 142.16 3.04 178.07 8.75 427.76 Cmax (mmol/L) Placebo 12 2.08 0.98 1.87 1.65 1.96 0.65 4.37 Coffee Extract 12 1.93 0.86 1.73 1.65 1.83 0.67 3.41 tmax (min) Placebo 12 110.00 95.80 80.53 2.28 90.00 30.00 360.00 Coffee Extract 12 67.50 58.79 50.24 2.17 45.00 15.00 180.00
(69) Our findings showed that a single ingestion of HDGCE significantly decreased insulin concentration in plasma by around 20% in 12 subjects after a nutritional food challenge (p=0.02) (see tables 1, 2 and 3). Glucose concentration in plasma did not shown any difference between a single ingestion of hydrolysed decaffeinated green coffee extract or placebo treatment (table 4). However, in vitro data shows that the metabolites increases the glucose uptake in the skeletal muscle cells. Therefore, we concluded that hydrolysed decaffeinated green coffee extract improve insulin sensitivity in humans. Results also showed an almost statistical significance difference in insulin AUC (mmol*min/L) (p=0.07) with the HDGCE compared to placebo (see
(70) In Vitro Test: Glucose Uptake
(71) Murine C2C12 myoblasts were grown in Dulbecco's Modified Eagle Medium (DMEM) 4.5 g/L glucose with GlutaMAX supplemented with 20% fetal bovine serum (vol/vol), 50 M palmitate, 0.3% bovine serum albumin with 100 U/ml penicillin G and 100 g/ml streptomycin and maintained at 37 C. with 5% carbon dioxide. Cells were plated and differentiated to form myotubes in DMEM 4.5 g/L glucose with GlutaMAX supplemented with 1% horse serum (vol/vol)), 50 M palmitate, 0.3% bovine serum albumin with 100 U/ml penicillin G and 100 g/ml streptomycin. Differentiated myotubes were treated with individual plasma metabolites at 10 M and 0.1% (vol/vol) dimethyl sulphoxide in serum free DMEM 4.5 g/L glucose with GlutaMAX, 50 M palmitate, 0.3% bovine serum albumin for 18 hours at 37 C. with 5% carbon dioxide. Cells were transferred to krebs-ringers-hepes buffer (140 mM sodium chloride, 4.7 mM potassium chloride, 2.5 mM calcium chloride, 1.25 mM magnesium sulphate, 1.2 mM potassium dihydrogen phosphate, 10 mM 4-(2-Hydroxyethyl)piperazine-1-ethanesulfonic acid pH 7.4) with 2 mM sodium pyruvate, 50 M palmitate, 0.3% bovine serum albumin and compounds at 10 M and 0.1% (vol/vol) dimethyl sulphoxide for four hours at 37 C. with 5% carbon dioxide. 50 M 2-deoxyglucose containing [3H]2-deoxyglucose was then added to the cells for 5 minutes at 37 C. with 5% carbon dioxide. The reaction was stopped with addition of 25 mM glucose. The myotubes were washed extensively with phosphate buffered saline, lysed in 0.1 M sodium hydroxide and the amount of radiolabel incorporated was detected by liquid scintillation counting. Changes in the amount of [3H]2-deoxyglucose incorporated was determined relative to control wells and presented as fold change. Positive control treatment with a well known AMPK activator (denoted herein as al) was performed at 5 M for the full treatment period and insulin was added for 4 hours in KRH buffer at 10 nM.
(72) In Vitro Test: Insulin Secretion
(73) 3D InSight Human Islet Microtissues were obtained from InSphero AG (Switzerland). Upon arrival the pseudo-islets were treated following manufacturer's instruction for measurement of glucose stimulated insulin secretion. Briefly, the isolated pseudo-islets were carefully washed twice and incubated for 1 h at low glucose in modified Krebs-Ringer buffer (KRB) containing (in mM): 131 NaCl, 4.8 KCl, 1.3 CaCl.sub.2, 1.2 KH.sub.2PO.sub.4, 1.2 MgSO.sub.4, 5 NaHCO.sub.3, 25 HEPES, 2.8 glucose and 0.5% BSA. This solution is referred to as LGS (low glucose solution, 2.8 mM). Then isolated islets were carefully washed with LGS and incubated for 2 h in fresh KRB containing 16.7 mM glucose, 0.5% BSA in presence of test substances at 1 m final concentrations. Measures of insulin levels in supernatants and cell extracts (extraction in acid ethanol (1.5% (v/v) HCl in 70% (v/v) ethanol) were performed using a sensitive chemiluminescence enzyme-linked immunosorbent assay (ELISA; ALPCO, Salem, NH 03079). All experiments with human islets were approved by the Ethical Commission of the Human Research Act (Switzerland).
(74) TABLE-US-00012 TABLE 5 tested compounds c1 CA Caffeic acid c2 CA3G Caffeic-3-O-glucuronide c3 CA3S Caffeic-3-O-sulfate c4 CA4G Caffeic-4-O-glucuronide c5 CA4S Caffeic-4-O-sulfate c6 DHCA Dihydrocaffeic acid c7 DHCA3G Dihydrocaffeic-3-O-glucuronide c8 DHCA3S Dihydrocaffeic-3-O-sulfate c9 DHCA4G Dihydrocaffeic-4-O-glucuronide c10 DHCA4S Dihydrocaffeic-4-O-sulfate c11 DHFA Dihydroferulic acid c12 DHFA4G Dihydroferulic-4-O-glucuronide c13 DHFA4S Dihydroferulic-4-O-sulfate c14 DHiFA Dihydroisoferulic acid c15 DHiFA3G Dihydroisoferulic-3-O- glucuronide c16 DHiFA3S Dihydroisoferulic-3-O-sulfate c17 FA Ferulic acid c18 FA4G Ferulic-4-O-glucuronide c19 FA4S Ferulic-4-O-sulfate c20 iFA Isoferulic acid c21 iFA3G Isoferulic-3-O-glucuronide c22 iFA3S Isoferulic-3-O-sulfate c23 mDHCoA 5-4-dihydro-m-coumaric acid c24 MeDHFA Methyl Dihydroferulic acid c25 MeFA Methyl Ferulic acid