COMPOSITIONS AND METHODS UTILIZING A NOVEL HUMAN FOXO3 ISOFORM
20260102465 ยท 2026-04-16
Inventors
Cpc classification
International classification
Abstract
Provided herein is a method of suppressing osteoclast differentiation or function and/or bone resorption or destruction in a subject in need thereof and compositions therefore. In one embodiment, the method includes increasing the amount, expression, or activity of Foxo3 isoform 2 in the subject.
Claims
1. A method of suppressing osteoclast differentiation or function and/or bone resorption or destruction in a subject in need thereof, comprising increasing the amount, expression, or activity of Foxo3 isoform 2 in the subject.
2. A method of treating a skeletal disease in a subject in need thereof, the method comprising increasing the amount, expression, or activity of Foxo3 isoform 2 in the subject.
3. The method according to claim 1, wherein Foxo3 isoform 2 has the sequence of SEQ ID NO: 1 or a sequence sharing at least 90% identity therewith.
4. The method according to claim 1, comprising administering an agonist of Foxo3 isoform 2, or a functional fragment thereof.
5. The method according to claim 1, comprising administering a nucleic acid which comprises a sequence encoding Foxo3 isoform 2 having the sequence of SEQ ID NO: 1 or a sequence sharing at least 90% identity therewith, or a functional fragment of Foxo3 isoform 2, having a N-terminal truncation and sharing at least 90% identity with SEQ ID NO: 1.
6. The method according to claim 5, wherein the viral vector is an adenoviral vector or adeno-associated virus (AAV) vector.
7. The method according to claim 5, wherein the nucleic acid comprises SEQ ID NO: 2, or a sequence comprising at least 99% identity therewith.
8. The method according to claim 5, wherein the Foxo3 isoform 2 polypeptide has the sequence of SEQ ID NO: 1.
9. The method according to claim 1, comprising administering a polypeptide having the sequence of SEQ ID NO: 1 or a sequence sharing at least 90% identity therewith, or a functional fragment of Foxo3 isoform 2, having a N-terminal truncation and sharing at least 90% identity with SEQ ID NO: 1.
10. The method according to claim 9, wherein the Foxo3 isoform 2 polypeptide has the sequence of SEQ ID NO: 1.
11. A method of assessing the efficacy of a treatment comprising measuring the level of Foxo3 isoform 2 in the blood of a subject receiving treatment, wherein an increase in the level of Foxo3 isoform 2 indicates effectiveness of the treatment for treating a skeletal disease.
12. A method of diagnosing an increased risk of developing a skeletal disease in a subject, the method comprising measuring the level of Foxo3 isoform 2 in the blood of a subject receiving treatment, wherein a decrease in the level of Foxo3 isoform 2 as compared to a control level indicates a greater risk of developing a skeletal disease.
13. The method according to claim 12, wherein a level of 100 ng/ml or lower is indicative of an increased risk of a skeletal disease in the subject, as compared to a control.
14. A method of diagnosing a skeletal disease in a subject, the method comprising measuring the level of Foxo3 isoform 2 in the blood of a subject receiving treatment, wherein a decrease in the level of Foxo3 isoform 2 as compared to a control level indicates the presence of a skeletal disease.
15. The method according to claim 12, wherein a level of 1 ng/ml or lower is indicative of a skeletal disease in the subject, as compared to a control.
16. The method according to claim 11, wherein the skeletal disease is osteoporosis.
Description
DESCRIPTION OF THE FIGURES
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
DETAILED DESCRIPTION OF THE INVENTION
[0022] Foxo3 acts as an important central regulator that integrates signaling pathways and coordinates cellular responses to environmental changes. Recent studies show the involvement of Foxo3 in osteoclastogenesis and rheumatoid arthritis, which prompted further investigation of the FOXO3 locus. Several databases document a putative FOXO3 isoform2, an N-terminal truncated mutation of the full-length FOXO3. However, the biological function of FOXO3 isoform2 was previously unknown. As disclosed herein, a conditional allele of Foxo3 in mice was established that deletes the full-length Foxo3 except isoform2, a close ortholog of the human FOXO3 isoform2. Expression of Foxo3 isoform2 specifically in macrophage/osteoclast lineage suppresses osteoclastogenesis and leads to the osteopetrotic phenotype in mice. As described herein, mechanistically, Foxo3 isoform2 enhances the expression of type I IFN response genes to RANKL stimulation and thus inhibits osteoclastogenesis via endogenous IFN--mediated feedback inhibition. These findings identify the first known biological function of Foxo3 isoform2 that acts as a novel osteoclastic inhibitor in bone remodeling.
[0023] It is to be noted that the term a or an refers to one or more. As such, the terms a (or an), one or more, and at least one are used interchangeably herein.
[0024] While various embodiments in the specification are presented using comprising language, under other circumstances, a related embodiment is also intended to be interpreted and described using consisting of or consisting essentially of language. The words comprise, comprises, and comprising are to be interpreted inclusively rather than exclusively. The words consist, consisting, and its variants, are to be interpreted exclusively, rather than inclusively.
[0025] As used herein, the term about means a variability of 10% from the reference given, unless otherwise specified.
[0026] Upregulate and upregulation, as used herein, refer to an elevation in the level of expression of a product of one or more genes in a cell or the cells of a tissue or organ.
[0027] As used herein, the term agonist refers to a compound that in combination with a receptor can produce a cellular response. An agonist may be a ligand that directly binds to the receptor. Alternatively an agonist may combine with a receptor indirectly by for example (a) forming a complex with another molecule that directly binds to the receptor, or (b) otherwise resulting in the modification of another compound so that the other compound directly binds to the receptor. The term Foxo3 isoform 2 agonist in particular includes any entity which agonizes Foxo3 isoform 2. This includes Foxo3 isoform 2 agonistic antibodies and fragments thereof, as well as small molecule agonists. The term also includes agonists of Foxo3 isoform 1.
[0028] A subject is a mammal, e.g., a human, mouse, rat, guinea pig, dog, cat, horse, cow, pig, or non-human primate, such as a monkey, chimpanzee, baboon or gorilla. The term patient may be used interchangeably with the term subject. In one embodiment, the subject is a human. The subject may be of any age, as determined by the health care provider. In certain embodiments described herein, the patient is a subject who has or is at risk of developing a skeletal disease. The subject may have been treated for a skeletal disease previously, or is currently being treated for the skeletal disease.
[0029] As used herein, the term skeletal disease or skeletal disorder refers to any condition associated with the bone or joints, including those associated with bone loss, bone fragility, or softening, or aberrant skeletal growth. Skeletal diseases include, without limitation, osteoporosis and osteopenia, rheumatoid arthritis, osteoarthritis, psoriatic arthritis, periodontitis, periprosthetic loosening, osteomalacia, hyperparathyroidism, Paget disease of bone, spondyloarthritis, and lupus.
[0030] Sample as used herein means any biological fluid or tissue that contains cells or tissue, including blood cells, fibroblasts, and skeletal muscle. In one embodiment, the sample is whole blood. In another embodiment, the sample is peripheral blood mononuclear cells (PBMC). Other useful biological samples include, without limitation, peripheral blood mononuclear cells, plasma, saliva, urine, synovial fluid, bone marrow, cerebrospinal fluid, vaginal mucus, cervical mucus, nasal secretions, sputum, semen, amniotic fluid, bronchoscopy sample, bronchoalveolar lavage fluid, and other cellular exudates from a patient having cancer. Such samples may further be diluted with saline, buffer or a physiologically acceptable diluent. Alternatively, such samples are concentrated by conventional means.
[0031] By fragment is intended a molecule consisting of only a part of the intact full-length polypeptide sequence and structure. The fragment can include a C terminal deletion, an N terminal deletion, and/or an internal deletion of the native polypeptide. In one embodiment, the fragment includes an N-terminal deletion of up to 5, 10, 15, 20, 25, 30, 35, 40 or 45 amino acids. A fragment will generally include at least about 5-10 contiguous amino acid residues of the full length molecule, preferably at least about 15-25 contiguous amino acid residues of the full length molecule, and most preferably at least about 20 50 or more contiguous amino acid residues of the full length molecule, or any integer between 5 amino acids and the full length sequence, provided that the fragment in question retains the ability to elicit the desired biological response, although not necessarily at the same level.
[0032] The terms percent (%) identity, sequence identity, percent sequence identity, or percent identical in the context of nucleic acid sequences refers to the bases in the two sequences which are the same when aligned for correspondence. The length of sequence identity comparison may be over the full-length of the full-length of a gene coding sequence, or a fragment of at least about 100 to 150 nucleotides, or as desired. However, identity among smaller fragments, e.g. of at least about nine nucleotides, usually at least about 20 to 24 nucleotides, at least about 28 to 32 nucleotides, at least about 36 or more nucleotides, may also be desired. Multiple sequence alignment programs are also available for nucleic acid sequences. Examples of such programs include, Clustal W, CAP Sequence Assembly, BLAST, MAP, and MEME, which are accessible through Web Servers on the internet. Other sources for such programs are known to those of skill in the art. Alternatively, Vector NTI utilities are also used. There are also a number of algorithms known in the art that can be used to measure nucleotide sequence identity, including those contained in the programs described above. As another example, polynucleotide sequences can be compared using Fasta, a program in GCG Version 6.1. Fasta provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences. For instance, percent sequence identity between nucleic acid sequences can be determined using Fasta with its default parameters (a word size of 6 and the NOPAM factor for the scoring matrix) as provided in GCG Version 6.1, herein incorporated by reference.
[0033] The terms percent (%) identity, sequence identity, percent sequence identity, or percent identical in the context of amino acid sequences refers to the residues in the two sequences which are the same when aligned for correspondence. Percent identity may be readily determined for amino acid sequences over the full-length of a protein, polypeptide, about 70 amino acids to about 100 amino acids, or a peptide fragment thereof or the corresponding nucleic acid sequence coding sequencers. A suitable amino acid fragment may be at least about 8 amino acids in length, and may be up to about 450 amino acids. Generally, when referring to identity, homology, or similarity between two different sequences, identity, homology or similarity is determined in reference to aligned sequences. Aligned sequences or alignments refer to multiple nucleic acid sequences or protein (amino acids) sequences, often containing corrections for missing or additional bases or amino acids as compared to a reference sequence. Alignments are performed using any of a variety of publicly or commercially available Multiple Sequence Alignment Programs. Sequence alignment programs are available for amino acid sequences, e.g., the Clustal X, MAP, PIMA, MSA, BLOCKMAKER, MEME, and Match-Box programs. Generally, any of these programs are used at default settings, although one of skill in the art can alter these settings as needed. Alternatively, one of skill in the art can utilize another algorithm or computer program which provides at least the level of identity or alignment as that provided by the referenced algorithms and programs. See, e.g., J. D. Thomson et al, Nucl. Acids. Res., A comprehensive comparison of multiple sequence alignments, 27 (13): 2682-2690 (1999).
[0034] The term derived from is used to identify the original source of a molecule (e.g., murine or human) but is not meant to limit the method by which the molecule is made which can be, for example, by chemical synthesis or recombinant means.
[0035] As used herein, the term a therapeutically effective amount refers an amount sufficient to achieve the intended purpose. For example, an effective amount of an Foxo3 isoform 2 agonist is sufficient to decrease osteoclastogenesis or osteoclast function, bone resorption or destruction in a subject. An effective amount for treating or ameliorating a disorder, disease, or medical condition is an amount sufficient to result in a reduction or complete removal of the symptoms of the disorder, disease, or medical condition. The effective amount of a given therapeutic agent will vary with factors such as the nature of the agent, the route of administration, the size and species of the animal to receive the therapeutic agent, and the purpose of the administration. The effective amount in each individual case may be determined by a skilled artisan according to established methods in the art.
[0036] As used herein, disease, disorder and condition are used interchangeably, to indicate an abnormal state in a subject.
[0037] Provided herein, in one aspect, are methods of suppressing osteoclast differentiation or function and/or bone resorption or destruction in a subject. As described herein, expression of Foxo3 isoform 2 in macrophage/osteoclast lineage suppresses osteoclastogenesis. Thus, provided herein, are methods of treating skeletal diseases associated with osteoclastic bone remodeling.
[0038] Over 90% of human genes are alternatively spliced to produce mRNA and protein isoforms, which may have shared, related, distinct, or even antagonistic functions. Alternative splicing is an essential biological process driving evolution and development. The isoforms resulting from alternative splicing contribute to transcriptomic and proteomic diversity and complexity in physiological conditions (Vacik, T., and I. Raska. 2017. Alternative intronic promoters in development and disease. Protoplasma 254:1201-1206; Kim, H. K., M. H. C. Pham, K. S. Ko, B. D. Rhee, and J. Han. 2018. Alternative splicing isoforms in health and disease. Pflugers Arch. 470:995-1016, both incorporated herein by reference). Aberrant splicing or deregulated isoform expression/function can lead to diseases, such as cancer and cardiovascular and metabolic diseases (Dlamini, Z., F. Mokoena, and R. Hull. 2017. Abnormalities in alternative splicing in diabetes: therapeutic targets. J. Mol. Endocrinol. 59: R93-R107, incorporated herein by reference). Recent efforts have been made to investigate deregulated alternative splicing that could be used as diagnostic markers or therapeutic targets for diseases.
[0039] Described herein is a novel short isoform of human FOXO3, which has been termed Isoform2, in contrast to the full-length isoform1. While available databases support the presence of a putative FOXO3 isoform2 in human cells and tissues, such as fibroblasts and skeletal muscles, in physiological conditions (found at gtexportal.org/home/transcriptPage), to the inventors knowledge, this isoform has never been cloned or characterized. Further, the biological function of this FOXO3 isoform2 was previously unknown.
[0040] When the inventors investigated the human FOXO3 locus, annotations for a short isoform of FOXO3 (
TABLE-US-00001 MRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKY TKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDD APLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLND GLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS SMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAV AQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQT QGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSM QTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSL ECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFT GAKQASSQSWVPG
[0041] The coding sequence is set forth in SEQ ID NO: 2:
TABLE-US-00002 atgcgggtccagaatgagggaactggcaagagctcttggtggatcatcaaccctgatggg 60 gggaagagcggaaaagccccccggcggcgggctgtctccatggacaatagcaacaagtat 120 accaagagccgtggccgcgcagccaagaagaaggcagccctgcagacagcccccgaatca 180 gctgacgacagtccctcccagctctccaagtggcctggcagccccacgtcacgcagcagt 240 gatgagctggatgcgtggacggacttccgttcacgcaccaattctaacgccagcacagtc 300 agtggccgcctgtcgcccatcatggcaagcacagagttggatgaagtccaggacgatgat 360 gcgcctctctcgcccatgctctacagcagctcagccagcctgtcaccttcagtaagcaag 420 ccgtgcacggtggaactgccacggctgactgatatggcaggcaccatgaatctgaatgat 480 gggctgactgaaaacctcatggacgacctgctggataacatcacgctcccgccatcccag 540 ccatcgcccactgggggactcatgcagcggagctctagcttcccgtataccaccaagggc 600 tcgggcctgggctccccaaccagctcctttaacagcacggtgttcggaccttcatctctg 660 aactccctacgccagtctcccatgcagaccatccaagagaacaagccagctaccttctct 720 tccatgtcacactatggtaaccagacactccaggacctgctcacttcggactcacttagc 780 cacagcgatgtcatgatgacacagtcggaccccttgatgtctcaggccagcaccgctgtg 840 tctgcccagaattcccgccggaacgtgatgcttcgcaatgatccgatgatgtcctttgct 900 gcccagcctaaccagggaagtttggtcaatcagaacttgctccaccaccagcaccaaacc 960 cagggcgctcttggtggcagccgtgccttgtcgaattctgtcagcaacatgggcttgagt 1020 gagtccagcagccttgggtcagccaaacaccagcagcagtctcctgtcagccagtctatg 1080 caaaccctctcggactctctctcaggctcctccttgtactcaactagtgcaaacctgccc 1140 gtcatgggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttg 1200 gaatgtgacatggagtccattatccgtagtgaactcatggatgctgatgggttggatttt 1260 aactttgattccctcatctccacacagaatgttgttggtttgaacgtggggaacttcact 1320 ggtgctaagcaggcctcatctcagagctgggtgccaggctga 1362
[0042] The coding sequences of the mouse and human FOXO3 are highly conserved. demonstrating about 95% identical amino acids (
[0043] Provided herein are compositions and methods for suppressing osteoclast differentiation or function and/or bone resorption or destruction in a subject in need thereof. In one embodiment, the method includes increasing the amount, expression, or activity of Foxo3 isoform 2 in the subject. Compositions for doing so are provided.
[0044] In one embodiment, Foxo2 isoform 2 is increased in the subject by administering a nucleic acid which comprises a sequence encoding Foxo3 isoform 2. Thus, in one aspect, a nucleic acid which comprises a sequence encoding Foxo3 isoform 2, or functional fragment thereof, is provided, as well as expression cassettes and vectors containing same. In one embodiment, the nucleic acid encodes the polypeptide sequence of SEQ ID NO: 1, or a sequence sharing at least 90% identity with SEQ ID NO: 1. In another embodiment, the sequence encodes a sequence sharing at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 1. In another embodiment, the nucleic acid encodes a functional fragment of Foxo3 isoform 2, such as the sequence of SEQ ID NO: 1, but having a N-terminal truncation. In one embodiment, the Foxo3 isoform 2 polypeptide has a N-terminal truncation of up to 5, 10, 15, 20, 25, 30, 35, or 40 amino acids. In one embodiment, the functional fragment shares at least 90% identity with the portion of SEQ ID NO: 1 for which corresponding residues are present. For clarity, it is meant that Foxo3 isoform 2 truncations which have been substituted in up to about 10% of the residues present as compared to SEQ ID NO: 1 are encompassed herein.
[0045] In one embodiment, the coding sequence is the sequence of SEQ ID NO: 2, or a sequence sharing at least 70% identity therewith. In another embodiment, the coding sequence shares at least 75%, 80%, or 90% with SEQ ID NO: 2. In another embodiment, the coding sequence shares at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% with SEQ ID NO: 2.
[0046] In one embodiment, the nucleic acid which comprises the Foxo3 isoform 2 coding sequence is contained within an expression cassette, which further includes additional sequences, such as regulatory sequences which permit expression of the Foxo3 isoform 2. These control sequences or the regulatory sequences are operably linked to the Foxo3 isoform 2 coding sequence. As used herein, an expression cassette refers to a nucleic acid molecule which comprises coding sequences, promoter, and may include other regulatory sequences therefor, which cassette may be engineered into a genetic element and/or packaged into the capsid of a viral vector (e.g., a viral particle). Typically, such an expression cassette for generating a viral vector contains the sequences described herein flanked by packaging signals of the viral genome and other expression control sequences such as those described herein.
[0047] The expression cassette typically contains a promoter sequence as part of the expression control sequences or the regulatory sequences. Promoters such as tissue-specific promoters, viral promoters, constitutive promoters, regulatable promoters [see. e.g., WO 2011/126808 and WO 2013/049493], or a promoter responsive to physiologic cues may be utilized in the vectors described herein.
[0048] In addition to a promoter, an expression cassette and/or a vector may contain other appropriate regulatory elements or regulatory sequences, which comprise but are not limited to enhancers: transcription factors: transcription terminators: efficient RNA processing signals such as splicing and polyadenylation signals (polyA): sequences that stabilize cytoplasmic mRNA, for example Woodchuck Hepatitis Virus (WHP) Posttranscriptional Regulatory Element (WPRE): sequences that enhance translation efficiency (i.e., Kozak consensus sequence): sequences that enhance protein stability; and when desired, sequences that enhance secretion of the encoded product. Examples of suitable poly A sequences include, e.g., SV40, bovine growth hormone (bGH), and TK poly A. Examples of suitable enhancers include, e.g., the alpha fetoprotein enhancer, the TTR minimal promoter/enhancer, LSP (TH-binding globulin promoter/alpha1-microglobulin/bikunin enhancer), amongst others.
[0049] In one embodiment, the viral vector is an adenoviral vector. Adenoviruses are medium-sized (90-100 nm), nonenveloped (naked) icosahedral viruses composed of a nucleocapsid and a double-stranded linear DNA genome. There are over 51 different serotypes in humans, which are responsible for 5-10% of upper respiratory infections in children, and many infections in adults as well. In one embodiment, the vector is a replication defective adenovirus, in which the E1A and E1B genes are deleted and replaced with an expression cassette comprising the Foxo3 isoform 2 coding sequence. Various adenoviral vectors are known in the art and include, without limitation, Ad5 based vectors. See, e.g., Wold and Toth, Adenovirus Vectors for Gene Therapy, Vaccination and Cancer Gene Therapy, Curr Gene Ther. 2013 December: 13 (6): 421-433, which is incorporated herein by reference.
[0050] In another embodiment, the viral vector is an adeno-associated virus (AAV) vector. AAV is composed of an icosahedral protein capsid of 26 nm in diameter and a single-stranded DNA genome of 4.7 kb that can either be the plus (sense) or minus (anti-sense) strand. The capsid comprises three types of subunit, VP1, VP2 and VP3, totaling 60 copies in a ratio of about 1:1:10 (VP1: VP2: VP3). The genome is flanked by two T-shaped inverted terminal repeats (ITRs) at the ends that largely serve as the viral origins of replication and the packaging signal. Various AAV vectors are known in the art and include, without limitation, AAV1, AAV2, AAV3B, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.8, AAVrh.10 and AAVrh.43 based vectors. See, e.g., Wang et al, Adeno-associated virus vector as a platform for gene therapy delivery, Nature Reviews Drug Discovery, 18:358-378 (February 2019), which is incorporated herein by reference.
[0051] In another embodiment of the methods provided herein, Foxo2 isoform 2 is increased in the subject by administering an effective amount of Foxo3 isoform 2 polypeptide. Thus, in one embodiment, a composition comprising a Foxo3 isoform 2 polypeptide is provided. In one embodiment, the polypeptide has the sequence of SEQ ID NO: 1, or a sequence sharing at least 90% identity with SEQ ID NO: 1. In another embodiment, the sequence encodes a sequence sharing at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 1. In another embodiment, the polypeptide is a functional fragment of Foxo3 isoform 2. In one embodiment, the Foxo3 isoform 2 fragment polypeptide has a N-terminal truncation of up to 5, 10, 15, 20, 25, 30, 35, or 40 amino acids. In one embodiment, the functional fragment shares at least 90% identity with the portion of SEQ ID NO: 1 for which corresponding residues are present. For clarity, it is meant that Foxo3 isoform 2 truncations which have been substituted in up to about 10% of the residues present are encompassed herein.
[0052] The effective amount for of a Foxo3 isoform 2 polypeptide can be about 0.01 to 25 mg peptide per application. In one embodiment, the effective amount is 0.01 to 10 mg. In another embodiment, the effective amount is 0.01 to 1 mg. In another embodiment, the effective amount is 0.01 to 0.10. In another embodiment, the effective amount is 0.2, 0.5, 0.8, 1.0, 1.2, 1.4, 1.6, 1.8, 2.0, 2.2, 2.4, 2.6, 2.8, 3.0 mg or more.
[0053] In another embodiment, Foxo3 isoform 2 is increased in the subject by administering an effective amount of a Foxo3 isoform 2 agonist. In one embodiment, the effective amount of the Foxo3 isoform 2 agonist is an amount ranging from about 0.01 mg/ml to about 10 mg/ml, including all amounts therebetween and end points. In one embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 0.1 mg/ml to about 5 mg/ml, including all amounts therebetween and end points. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 0.3 mg/ml to about 1.0 mg/ml, including all amounts therebetween and end points. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 0.3 mg/ml. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 0.4 mg/ml. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 0.5 mg/ml. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 0.6 mg/ml. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 0.7 mg/ml. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 0.8 mg/ml. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 0.9 mg/ml. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 1.0 mg/ml.
[0054] In one embodiment, the effective amount of the Foxo3 isoform 2 agonist is an amount ranging from about 1 M to about 2 mM, including all amounts therebetween and end points. In one embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 10 M to about 100 M, including all amounts therebetween and end points. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 5 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 10 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 20 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 50 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 100 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 200 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 300 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 400 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 500 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 600 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 700 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 800 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 900 M. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 1 mM. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 1.25 mM. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist about 1.5 mM. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 1.75 mM. In another embodiment, the effective amount of the Foxo3 isoform 2 agonist is about 2 mM.
[0055] As shown in
[0056] For each of the nucleic acids, polypeptide, and agonist compositions described herein, a further embodiment is provided which additionally includes a pharmaceutically acceptable carrier. The term carrier refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations, and the like. The composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences, 18th Ed., Gennaro, ed. (Mack Publishing Co., 1990). The formulation should suit the mode of administration.
[0057] Routes of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes. The agent may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local.
[0058] In some embodiments, the methods of treatment include combination with another therapy. Such additional therapies include without limitation, nonsteroidal anti-inflammatory drugs (NSAIDs), steroids such as prednisone, methotrexate (TREXALL, OTREXUP, others), leflunomide (ARAVA), hydroxychloroquine (PLAQUENIL) and sulfasalazine (AZULFIDINE), abatacept (ORENCIA), adalimumab (HUMIRA), anakinra (KINERET), baricitinib (OLUMIANT), certolizumab (CIMZIA), etanercept (ENBREL), golimumab (SIMPONI), infliximab (REMICADE), rituximab (RITUXAN), sarilumab (KEVZARA), tocilizumab (ACTEMRA) and tofacitinib (XELJANZ). Other additional therapies include Bisphosphonates including Alendronate (FOSAMAX), Risedronate (ACTONEL), Ibandronate (BONIVA), and Zoledronic acid (RECLAST). Other therapies include hormone like medications including raloxifene (EVISTA), Denosumab (PROLIA, XGEVA), Teriparatide (FORTEO), Abaloparatide (TYMLOS).
[0059] As described herein, it has been shown that expression of Foxo3 isoform 2 suppresses osteoclastogenesis. Thus, in one method is provided a method of suppressing osteoclastogenesis or osteoclast differentiation or function in a subject in need thereof. The method includes increasing the expression, amount or activity of Foxo3 isoform 2, as further described herein. In another embodiment, a method of suppressing or decreasing bone resorption or destruction in a subject in need thereof is provided. The method includes increasing the expression, amount or activity of Foxo3 isoform 2, as further described herein. In yet another embodiment, a method of treating a skeletal disease is provided. The method includes increasing the expression, amount or activity of Foxo3 isoform 2, as further described herein.
[0060] In any of the methods described herein, the subject may have, or be suspected of having or developing, a skeletal disease, as described hereinabove. In one embodiment, the subject has, or is suspected of having or developing, rheumatoid arthritis. In another embodiment, the subject has, or is suspected of having or developing, psoriatic arthritis. In another embodiment, the subject has, or is suspected of having or developing, periodontitis. In another embodiment, the subject has, or is suspected of having or developing, periprosthetic loosening. In another embodiment, the subject has, or is suspected of having or developing, osteoporosis.
[0061] In another aspect, a method of diagnosing an increased risk of developing a skeletal disease is provided. The method includes measuring the level of Foxo3 isoform 2 in a sample from a subject. In one embodiment, the sample is whole blood. In another embodiment, the sample is PBMC. In some embodiments, the level of Foxo3 isoform 2 is detected in a sample obtained from a subject. This level may be compared to the level of a control. In one embodiment, a decrease in the level of Foxo3 isoform 2 as compared to a control indicates a greater risk of developing a skeletal disease. In one embodiment, a level of 100 ng/ml or lower is indicative of an increased risk of a skeletal disease in the subject, as compared to a control. Control or control level as used herein refers to the source of the reference value for Foxo3 isoform 2 levels. In some embodiments, the control subject is a healthy subject with no disease. In yet other embodiments, the control or reference is the same subject from an earlier time point. Selection of the particular class of controls depends upon the use to which the diagnostic/monitoring methods and compositions are to be put by the care provider. The control may be a single subject or population, or the value derived therefrom.
[0062] In another aspect, a method of diagnosing a skeletal disease in a subject is provided. The method includes measuring the level of Foxo3 isoform 2 a sample from a subject. In one embodiment, the sample is whole blood. In another embodiment, the sample is PBMC. This level may be compared to the level of a control. In one embodiment, a decrease in the level of Foxo3 isoform 2 as compared to a control indicates the presence of a skeletal disease. In one embodiment, a level of 1 ng/ml or lower is indicative of the presence of a skeletal disease in the subject. Control or control level as used herein refers to the source of the reference value for Foxo3 isoform 2 levels. In some embodiments, the control subject is a healthy subject with no disease. In yet other embodiments, the control or reference is the same subject from an earlier time point. Selection of the particular class of controls depends upon the use to which the diagnostic/monitoring methods and compositions are to be put by the care provider. The control may be a single subject or population, or the value derived therefrom. In one embodiment, the method further includes treating the subject for the skeletal disease. In one embodiment, the treatment is selected from a nonsteroidal anti-inflammatory drug (NSAID), a steroid such as prednisone, methotrexate (TREXALL, OTREXUP, others), leflunomide (ARAVA), hydroxy chloroquine (PLAQUENIL) and sulfasalazine (AZULFIDINE), abatacept (ORENCIA), adalimumab (HUMIRA), anakinra (KINERET), baricitinib (OLUMIANT), certolizumab (CIMZIA), etanercept (ENBREL), golimumab (SIMPONI), infliximab (REMICADE), rituximab (RITUXAN), sarilumab (KEVZARA), tocilizumab (ACTEMRA) and tofacitinib (XELJANZ). In one embodiment, the treatment is a Bisphosphonate selected from Alendronate (FOSAMAX), Risedronate (ACTONEL), Ibandronate (BONIVA), and Zoledronic acid (RECLAST). In another embodiment, the treatment is raloxifene (EVISTA), Denosumab (PROLIA, XGEVA), Teriparatide (FORTEO), or Abaloparatide (TYMLOS). In one embodiment, the subject is treated by increasing the Foxo3 isoform 2, as described herein.
[0063] In another aspect, a method of assessing the efficacy of a treatment for a skeletal disease is provided. In one embodiment, a baseline level of Foxo3 isoform 2 is obtained from the subject prior to, or at the beginning of treatment for a skeletal disease. After a desirable time period, the level of Foxo3 isoform 2 in the subject is measured again. An increase in the level of Foxo3 isoform 2 as compared to the earlier time point indicates that the treatment for the skeletal disease is, at least partially, efficacious. The treatment may be any of those described herein, or other treatments deemed suitable by the health care provider.
[0064] In another aspect, a method of screening for a compound useful for treating a skeletal disease is provided. In one embodiment, the compound is administered to a Foxo3.sup.f/f; LysMcre (Foxo3.sup.isoform2) mouse. In one embodiment, a baseline level of Foxo3 isoform 2 is obtained from the mouse prior to, or at the beginning of testing. After a desirable time period, the level of Foxo3 isoform 2 in the mouse is measured again. An increase in the level of Foxo3 isoform 2 as compared to the earlier time point indicates that the compound is, at least partially, efficacious for treatment of a skeletal disease.
[0065] Unless defined otherwise in this specification, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art and by reference to published texts, which provide one skilled in the art with a general guide to many of the terms used in the present application.
[0066] The following examples are illustrative only and are not intended to limit the present invention.
EXAMPLES
Example 1: Materials and Methods
Plasmids, Cloning, and Sequencing
[0067] cDNA fragments encoding mouse full-length Foxo3 protein or exon 2 fused with FLAG tag at the C terminus was amplified by PCR using the cDNA templates from WT BMMs and then subcloned into the XbalI/BamHI sites of pcDNA3.1+ vector to construct the pcDNA3.1+ full-length Foxo3-Flag plasmid or pcDNA3.1+-Foxo3 exon 2-Flag plasmid, respectively. Furthermore, cDNA fragment encoding mouse Foxo3 isoform2 fused with FLAG tag at the C terminus was amplified by PCR using the cDNA templates from Foxo3.sup.isoform2 BMMs, followed by subcloning into the XbalI/BamHI sites of pcDNA3.1.sup.+ vector to construct the pcDNA3.1.sup.+-Foxo3 isoform2-Flag plasmid. The following primers were used for cloning:
TABLE-US-00003 forFoxo3full-lengthfragment, forward (SEQIDNO:9) 5-ATTCTAGAGCCACCATGGCAGAGGCACCAGCC-3, reverse (SEQIDNO:10) 5-ATGGATCCTCACTTGTCGTCATCGTCTTTGTAGTCGCCTGGTACCCAG CTTTGA-3; forexon2ofFoxo3fragment, forward (SEQIDNO:11) 5-ATTCTAGAGCCACCATGGCAGAGGCACCAGCC-3, reverse (SEQIDNO:12) 5-ATGGATCCTCACTTGTCGTCATCGTCTTTGTAGTCCTTCCAGCCCGCA GAGCT-3; and forFoxo3isoform2fragment, forward (SEQIDNO:13) 5-ATTCTAGAGCCACCATGCGCGTTCAGAATGAAGG-3, reverse (SEQIDNO:14) 5-ATGGATCCTCACTTGTCGTCATCGTCTTTGTAGTCGCCTGGTACCCAG CTTTGA-3.
The sequence integrity of the inserted fragments in each expression plasmid was verified by restriction enzyme digestion and DNA sequencing at Cornell University Genomics Facility.
[0068] Transfection of human embryonic kidney 293 cells and RAW264.7 cells Lipofectamine 3000 reagent (L3000015; Thermo Fisher Scientific) was used for the transfection of the human embryonic kidney (HEK) 293 cells or RAW264.7 cells. Briefly, the cells were seeded (2.510.sup.5 HEK cells/well and 1.210.sup.5 RAW264.7 cells/well) and cultured with DMEM for HEK293 cells or a-MEM for RAW264.7 cells supplemented with 10% FBS and 1% penicillin/streptomycin in a 24-well plate at 37 C. in a humidified atmosphere containing 5% CO2 overnight. The cells were then transfected with 500 ng plasmid DNAs using Lipofectamine 3000 reagent, according to the manufacturer's instructions. After 24 h, the medium was replaced with fresh completed DMEM for HEK293 cells or a-MEM for RAW264.7 cells. The protein lysates from cell cultures were collected after 48 h to assess plasmid expression.
In Vitro Gene Silencing by Small Interfering RNAs
[0069] In vitro gene silencing by small interfering RNAs (siRNAs) was performed as previously described (Miller, C. H., S. M. Smith, M. Elguindy, T. Zhang, J. Z. Xiang, X. Hu, L. B. Ivashkiv, and B. Zhao. 2016. RBP-J-Regulated miR-182 Promotes TNF-alpha-Induced Osteoclastogenesis. Journal of immunology 196:4977-4986.). Briefly, siRNAs targeting Foxo3 or their corresponding control oligos (80 nM) were transfected into murine BMMs using TransIT-TKO transfection reagent (Mirus Bio), in accordance with the manufacturer's instructions.
RNA Sequencing and Bioinformatics Analysis
[0070] RNA sequencing (RNA-seq) and bioinformatics analysis were performed as previously described (Inoue, K., Z. Deng, Y. Chen, E. Giannopoulou, R. Xu, S. Gong, M. B. Greenblatt, L. S. Mangala, G. Lopez-Berestein, D. G. Kirsch, et al. 2018. Bone protection by inhibition of microRNA-182. Nat. Commun. 9:4108.). Briefly, total RNA was extracted using RNeasy Mini Kit (QIAGEN) following the manufacturer's instructions. TruSeq RNA Library preparation kits (Illumina) were used to purify poly-A+ transcripts and generate libraries with multiplexed barcode adaptors, following the manufacturer's instructions. All samples passed quality control analysis using a Bioanalyzer 2100 (Agilent Technologies). RNA-seq libraries were constructed per the Illumina TruSeq RNA sample preparation kit. High throughput sequencing was performed using the Illumina HiSeq 4000 in the Weill Cornell Medical College Genomics Resources Core Facility. RNAseq reads were aligned to the mouse genome (mm10) using TopHat (Trapnell, C., L. Pachter, and S. L. Salzberg. 2009. TopHat: discovering splice junctions with RNA-Seq. Bioinformatics 25:1105-1111.). Cufflinks (Trapnell, C., B. A. Williams, G. Pertea, A. Mortazavi, G. Kwan, M. J. van Baren, S. L. Salzberg, B. J. Wold, and L. Pachter. 2010. Transcript assembly and quantification by RNA-Seq reveals unannotated transcripts and isoform switching during cell differentiation. Nat. Biotechnol. 28:511-515.) was subsequently used to assemble the aligned reads into transcripts and then estimate the transcript abundances as reads per kilo base per million values. HTseq (Anders, S., P. T. Pyl, and W. Huber. 2015. HTSeqa Python framework to work with high-throughput sequencing data. Bioinformatics 31:166-169.) was used to calculate raw reads counts, and edgeR (Robinson, M. D., D. J. McCarthy, and G. K. Smyth. 2010. edgeR: a Bioconductor package for differential expression analysis of digital gene expression data. Bioinformatics 26:139-140.) was used to calculate normalized counts as counts per million.
[0071] Heatmaps were generated by pheatmap package in R. RNA-seq data (accession no. GSE 135479) have been deposited in National Center for Biotechnology Information's Gene Expression Omnibus (http://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE 135479).
Reverse Transcription and Real-Time PCR
[0072] Reverse transcription and real-time PCR were performed as previously described (Inoue, K., Z. Deng, Y. Chen, E. Giannopoulou, R. Xu, S. Gong, M. B. Greenblatt, L. S. Mangala, G. Lopez-Berestein, D. G. Kirsch, et al. 2018. Bone protection by inhibition of microRNA-182. Nat. Commun. 9:4108.). DNA-free RNA was obtained with the RNeasy Mini Kit (no. 74106; QIAGEN, Valencia, CA) with DNase treatment, and 1 mg of total RNAwas reverse transcribed using a First Strand cDNA Synthesis Kit (Thermo Fisher Scientific, Waltham, MA), according to the manufacturer's instructions. Real-time PCR was done in triplicate with the QuantStudio 5 Real-time PCR System and Fast SYBR Green Master Mix (Thermo Fisher Scientific). Gene expression was normalized relative to GAPDH. The primers for real-time PCR were as follows:
TABLE-US-00004 Acp5: SEQIDNO:15 5-ACGGCTACTTGCGGTTTC-3 and SEQIDNO:16 5-TCCTTGGGAGGCTGGTC-3; Dcstamp: SEQIDNO:17 5-TTTGCCGCTGTGGACTATCTGC-3 and SEQIDNO:18 5-AGACGTGGTTTAGGAATGCAGCTC-3; Ctsk: SEQIDNO:19 5-AAGATATTGGTGGCTTTGG-3 and SEQIDNO:20 5-ATCGCTGCGTCCCTCT-3; Itgb3: SEQIDNO:21 5-CCGGGGGACTTAATGAGACCACTT-3 and SEQIDNO:22 5-ACGCCCCAAATCCCACCCATACA-3; Calcr: SEQIDNO:23 5-ACATGATCCAGTTCACCAGGCAGA-3 and SEQIDNO:24 5-AGGTTCTTGGTGACCTCCCAACTT-3; Foxo3-F3R3: SEQIDNO:25 5-CTGTCCTATGCCGACCTGAT-3 and SEQIDNO:26 5-CTGTCGCCCTTATCCTTGAA-3; Foxo3-F4R4: SEQIDNO:27 5-ATGGGAGCTTGGAATGTGAC-3 and SEQIDNO:28 5-TTAAAATCCAACCCGTCAGC-3; Foxo3-F5R5: SEQIDNO:29 5-AGGAGGAGGAATGTGGAAGG-3 and SEQIDNO:30 5-CCGTGCCTTCATTCTGAAC-3; Ifnb1: SEQIDNO:31 5-TTACACTGCCTTTGCCATCC-3 and SEQIDNO:32 5-AGAAACACTGTCTGCTGGTG-3; Mx1: SEQIDNO:33 5-GGCAGACACCACATACAACC-3 and SEQIDNO:34 5-CCTCAGGCTAGATGGCAAG-3; Ifit1: SEQIDNO:35 5-CTCCACTTTCAGAGCCTTCG-3 and SEQIDNO:36 5-TGCTGAGATGGACTGTGAGG-3; Irf7: SEQIDNO:37 5-GTCTCGGCTTGTGCTTGTCT-3 and SEQIDNO:38 5-CCAGGTCCATGAGGAAGTGT-3; Ifit2: SEQIDNO:39 5-AAATGTCATGGGTACTGGAGTT-3 and SEQIDNO:40 5-ATGGCAATTATCAAGTTTGTGG-3; Stat1: SEQIDNO:41 5-CAGATATTATTCGCAACTACAA-3 and SEQIDNO:42 5-TGGGGTACAGATACTTCAGG-3; and Gapdh: SEQIDNO:43 5-ATCAAGAAGGTGGTGAAGCA-3 and SEQIDNO:44 5-AGACAACCTGGTCCTCAGTGT-3.
Immunoblot Analysis
[0073] Total cell extracts were obtained using lysis buffer containing 150 mM Tris-HCl (pH 6.8). 6% SDS. 30% glycerol. and 0.03% bromophenol blue: 10% 2-ME was added immediately before harvesting cells. Cell lysates were fractionated on SDS-PAGE, transferred to Immobilon-P membranes (MilliporeSigma), and incubated with specific Abs. Western Lightning Plus-ECL (PerkinElmer) was used for detection. Foxo3 N-terminal (no. 2497, specifically recognizing the residues surrounding Glu50 in exon 2 of Foxo3) and C-terminal (no. 12829S, specifically recognizing the C terminus of Foxo3) Abs were purchased from Cell Signaling Technology. Anti-Flag tag Ab (no. 637301) was purchased from BioLegend. p38a (sc-535) Ab was from Santa Cruz Biotechnology.
Statistical Analysis
[0074] Statistical analysis was performed using GraphPad Prism software. Two-tailed Student t test was applied if there were only two groups of samples. In the case of more than two groups of samples, one-way ANOVA was used with one condition, and two-way ANOVA was used with more than two conditions. ANOVA analysis was followed by post hoc Bonferroni correction for multiple comparisons. A p value <0.05 was taken as statistically significant: *p<0.05 and **p<0.01. Data are presented as the meanSD, as indicated in the figure legends.
Example 2: Results
Absence of Foxo3 Enhances Osteoclastogenesis
[0075] To provide genetic evidence for the role of Foxo3 in osteoclasts, we first took advantage of Foxo3 global KO mice, in which the Foxo3 protein is completely deleted. We first used BMMs as osteoclast precursors to examine in vitro osteoclast differentiation in response to RANKL, the master osteoclastogenic inducer. We found that Foxo3 KO-derived BMMs showed an increased responsiveness to RANKL, determined by more TRAP-positive multinucleated osteoclasts (
Foxo3.sup.f/f; LysMcre Mice Express a Truncated Foxo3 Protein that is an Ortholog of Human FOXO3 Isoform2.
[0076] We next wished to examine the role of Foxo3 in vivo using conditional Foxo3 KO mice. We deleted Foxo3 (encoding Foxo3) in myeloid lineage osteoclast precursors by crossing Foxo3.sup.flox/flox mice (The Jackson Laboratory) with LysMcre mice that express Cre under the control of the myeloid-specific lysozyme M promoter. We used Foxo3.sup.flox/flox, LysMcre+ mice and littermate controls with a Foxo3.sup.+/+; LysMcre+ genotype (hereafter referred to as WT) in the experiments. The mouse Foxo3 gene has four exons, and the coding region within exons 2 and 3 produces a full-length Foxo3 protein with 672 aa. The Foxo3.sup.flox/flox mice (The Jackson Laboratory) possess loxP sites flanking exon 2 of the Foxo3 gene (
TABLE-US-00005 TABLEI SequencesofregularPCRPrimers Product Size SEQID PrimerName Sequences (bp) NO Exons2-3 F:5-TTCAAGGATAAGGGCGACAG-3 215 45 R:5-CCTCGGCTCTTGGTGTACTT-3 46 Exons3-4 F:5-CGTTGTTGGTTTGAATGTGG-3 213 47 R:5-CGTGGGAGTCTCAAAGGTGT-3 48 PrimerSet1 F:5-ATGCGCGTTCAGAATGAAG-3 207 49 R:5-GGAGAGCTGGGAAGGACTGT-3 50 PrimerSet2 F:5-CCATGGACAACAGCAACAAG-3 389 51 R:5-CAGCCCATCATTCAGATTCA-3 52 PrimerSet3 F:5-GATGATGATGGACCCCTGTC-3 416 53 R:5-GAAGCAAGCAGGTCTTGGAG-3 54 PrimerSet4 F:5-GGGGAGTTTGGTCAATCAGA-3 348 55 R:5-TTAAAATCCAACCCGTCAGC-3 56 F3andR3 F:5-CTGTCCTATGCCGACCTGAT-3 122 57 primers R:5-CTGTCGCCCTTATCCTTGAA-3 58 F4andR4 F:5-ATGGGAGCTTGGAATGTGAC-3 73 59 primers R:5-TTAAAATCCAACCCGTCAGC-3 60 F5andR5 F:5-AGGAGGAGGAATGTGGAAGG-3 221 61 primers R:5-CCGTGCCTTCATTCTGAAC-3 62 Exon1F F:5-ATTCTAGACTAGGTTGAGGCTCCCTGT-3 2355 63 Exon3R R:5-ATTCCGGATCCGCCTGGTACCCAGCTTTGA-3 64
[0077] As shown in
[0078] When we investigated the human FOXO3 locus, we found annotations for a short isoform of FOXO3 (
[0079] The coding sequences of the mouse and human FOXO3 are highly conserved, determined by 95% of identical amino acids (
[0080] The biological function of the human FOXO3 isoform2 is unclear. Because the Foxo 3.sup.flox/flox; LysMcre.sup.+ mice express Foxo3 isoform2 instead of the full-length protein, we hereafter refer to these mice as Foxo3 isoform2 mice, which could be useful as a promising model for studying the function of the newly identified Foxo3 isoform2.
Mouse Foxo3 Isoform2 Suppresses Osteoclastogenesis and Leads to the Osteopetrotic Phenotype in Mice
[0081] To investigate the role of Foxo3 isoform2 in osteoclastogenesis, we used BMMs as osteoclast precursors to examine osteoclast differentiation in response to RANKL. As shown in
[0082] We next performed microcomputed tomographic (mCT) analyses to examine the bone phenotype of Foxo3 isoform2 mice. The Foxo3 isoform2 mice and their littermate controls exhibit similar body weight and body length (data not shown). As shown in
[0083] Consistent with the Foxo3 global KO data (
[0084] We next performed a structure-functional analysis of Foxo3 protein in osteoclast differentiation. We cloned and generated a series of plasmids that express full-length WT Foxo3 or recombinant Foxo3 peptides encoded by the isoform2 or by exon 2 (hereafter referred to as Exon 2). We confirmed the protein expression of each plasmid in HEK293 cells (
[0085] Foxo3 isoform2 represses osteoclast differentiation via endogenous type I IFN-mediated feedback inhibition We next set off to explore the mechanisms by which Foxo3 isoform2 inhibits osteoclastogenesis. In parallel with the suppressed generation of TRAP-positive polykaryons, we found that the expression of osteoclast marker genes Acp5 (encoding TRAP), Ctsk (encoding cathepsin K), Itgb3 (encoding b3 integrin), Destamp (encoding Dc-Stamp), Calcr (encoding calcintonin receptor), and Atp6V0d2 (encoding ATPase H+ Transporting V0 Subunit D2) was drastically decreased in RANKL-treated Foxo3 isoform2 cells relative to the WT control cells (
[0086] Such Foxo3-mediated changes, however, were not detected in the Foxo3 isoform2 osteoclastogenesis (data not shown). In contrast, we found that the expression of Irf7, an IFN-responsive gene, was markedly elevated in RANKL-treated Foxo3 isoform2 cells relative to WT control cells (
[0087] These results clearly demonstrate enhanced Ifnb expression and response by Foxo3 isoform2 during osteoclastogenesis and indicate that Foxo3 isoform2 suppresses osteoclastogenesis via type I IFN-mediated feedback inhibition.
Example 3: Discussion
[0088] Similarly to the other Foxo proteins, the function of Foxo3 is largely regulated through posttranslational modifications, such as phosphorylation, acetylation, methylation, and ubiquitination. These posttranslational modifications are context dependent and create a complex set of codes, which affect the subcellular location of Foxo3 and give rise to the diverse functions of Foxo family proteins in response to different stimuli (10-14). For example, Foxo3 can be phosphorylated by various protein kinases at many phosphorylation sites from the N to C terminus of the protein. Phosphorylation of specific sites by kinases, such as AKT, SGK1, CDK2, ERK, and IKK, induces cytoplasmic translocation and/or degradation of Foxo3, leading to target gene inhibition. In contrast, phosphorylation of the activating sites by kinases MST1, JNK, and AMPK usually leads to nuclear localization of Foxo3 and the activation of its target genes (10-14, 32). Foxo3 isoform2 lacks most of the N-terminal DNA-binding domain while maintaining the nuclear localization signal, the C-terminal nuclear export signal, and the transactivation domain at C terminus. This molecular structure implies that Foxo3 isoform2 is likely to lose the direct transcriptional regulation of the genes targeted by the full-length Foxo3 because of the lack of DNA-binding domain. However, Foxo3 isoform2 holds several activating phosphorylation sites that usually contribute to gene activation. In addition to the direct DNA-binding transcriptional activity, Foxo transcription factors are able to regulate transcription in a DNA-binding independent manner, often by interaction with other transcriptional activators or repressors. Hence, we cannot exclude the possibility that Foxo3 isoform2 regulates gene transcription in the nucleus together with other partners. In addition, Foxo3 isoform2 carries the nuclear localization signal as well as the nuclear export signal that allow it to shuttle between the nucleus and cytoplasm in response to environmental cues. The overall impact from these possibilities will determine the subcellular localization of Foxo3 isoform2 and the mechanisms by which it inhibits osteoclastogenesis. The exon 2 peptide is shown to promote osteoclast differentiation. With the consideration that exon 2 contains an N-terminal DNA-binding domain, the direct DNA binding presumably results in the osteoclastogenic activity of exon 2, which in turn attenuates the full-length Foxo3's ability in osteoclast inhibition. Further experiments are needed to elucidate the shared or distinct mechanisms mediated by full-length Foxo3 and the isoform2.
[0089] Protein isoforms from the exon skipping mode of alternative splicing often end up with a lack of certain domains that distinguish the function of the isoforms from their original full-length proteins. For example, previous studies identify IRF7 as a critical direct target of FOXO3, and FOXO3 negatively regulates IRF7 transcription in the antiviral response (29). Our results show that Foxo3 isoform2 expression elevates Irf7 transcription and corresponding type I IFN response during osteoclastogenesis. Foxo3 isoform2 lacks the DNA-binding domain and thus may function as an activator to increase Irf7 expression in a DNA-binding independent manner. Although Irf7 is a common target by both full-length Foxo3 and the isoform2, they show distinct regulatory effects on Irf7 expression presumably because of their different DNA binding capacity. Our results revealed that Foxo3.sup.flox/flox; LysMcre.sup.+ mice are not fully conditional KO mice because of the existence of the isoform2. The position of the loxp sites caused an in-frame deletion of exon 2 in this mouse line. This was not known at the time when previous loss-of-function studies used this Foxo3.sup.flox/flox line. The interpretation of the mutant phenotype in such studies might be now questionable, dependent on cell types. Therefore, future work should pay close attention to the verification of frameshift deletion by cre-loxp recombination as well as the presence of isoforms. Collectively, our findings in the current study identify the first, to our knowledge, known biological function of Foxo3 isoform2, which acts as an important suppressor of osteoclast differentiation via endogenous type I IFN-mediated feedback inhibition. The Foxo3 floxed allele mice (Foxo3.sup.flox/flox) could be used as a mouse resource in various areas to investigate the function of Foxo3 isoform2 that recapitulates human FOXO3 isoform2. Environmental cues often affect gene transcription and alternative splicing. For example, bone marrow macrophages/osteoclast precursors mainly express full-length Foxo3 with a trace amount of isoform2 in a physiological condition. Upon RANKL stimulation, Foxo3 isoform2 expression is increased (
REFERENCES
[0090] 1. Novack, D. V., and S. L. Teitelbaum. 2008. The osteoclast: friend or foe? Annu. Rev. Pathol. 3:457-484. [0091] 2. Sato, K., and H. Takayanagi. 2006. Osteoclasts, rheumatoid arthritis, and osteoimmunology. Curr. Opin. Rheumatol. 18:419-426. [0092] 3. Schett, G., and E. Gravallese. 2012. Bone erosion in rheumatoid arthritis: mechanisms, diagnosis and treatment. Nat. Rev. Rheumatol. 8:656-664. [0093] 4. Asagiri, M., and H. Takayanagi. 2007. The molecular understanding of osteoclast differentiation. Bone 40:251-264. [0094] 5. Binder, N., C. Miller, M. Yoshida, K. Inoue, S. Nakano, X. Hu, L. B. Ivashkiv, G. Schett, A. Pernis, S. R. Goldring, et al. 2017. Def6 restrains osteoclastogenesis and inflammatory bone resorption. J. Immunol. 198:3436-3447. [0095] 6. Li, S., C. H. Miller, E. Giannopoulou, X. Hu, L. B. Ivashkiv, and B. Zhao. 2014. RBP-J imposes a requirement for ITAM-mediated costimulation of osteoclastogenesis. [0096] J. Clin. Invest. 124:5057-5073. [0097] 7. Zhao, B., S. N. Grimes, S. Li, X. Hu, and L. B. Ivashkiv. 2012. TNF-induced osteoclastogenesis and inflammatory bone resorption are inhibited by transcription factor RBP-J. J. Exp. Med. 209:319-334. [0098] 8. Zhao, B., and L. B. Ivashkiv. 2011. Negative regulation of osteoclastogenesis and bone resorption by cytokines and transcriptional repressors. Arthritis Res. Ther. 13:234. [0099] 9. Zhao, B., M. Takami, A. Yamada, X. Wang, T. Koga, X. Hu, T. Tamura, K. Ozato, Y. Choi, L. B. Ivashkiv, et al. 2009. Interferon regulatory factor-8 regulates bone metabolism by suppressing osteoclastogenesis. Nat. Med. 15:1066-1071. [0100] 10. Hedrick, S. M., R. Hess Michelini, A. L. Doedens, A. W. Goldrath, and E. L. Stone. 2012. FOXO transcription factors throughout T cell biology. Nat. Rev. Immunol. 12:649-661. [0101] 11. Tia, N., A. K. Singh, P. Pandey, C. S. Azad, P. Chaudhary, and I. S. Gambhir. 2018. Role of Forkhead Box O (FOXO) transcription factor in aging and diseases. Gene 648:97-105. [0102] 12. Wang, X., S. Hu, and L. Liu. 2017. Phosphorylation and acetylation modifications of FOXO3a: independently or synergistically? Oncol. Lett. 13:2867-2872. [0103] 13. Salih, D. A., and A. Brunet. 2008. FoxO transcription factors in the maintenance of cellular homeostasis during aging. Curr. Opin. Cell Biol. 20:126-136. [0104] 14. van der Vos, K. E., and P. J. Coffer. 2008. FOXO-binding partners: it takes two to tango. Oncogene 27:2289-2299. [0105] 15. Morris, B. J., D. C. Willcox, T. A. Donlon, and B. J. Willcox. 2015. FOXO3: a major gene for human longevityA mini-review. Gerontology 61:515-525. [0106] 16. Bartell, S. M., H. N. Kim, E. Ambrogini, L. Han, S. Iyer, S. Serra Ucer, P. Rabinovitch, R. L. Jilka, R. S. Weinstein, H. Zhao, et al. 2014. FoxO proteins restrain osteoclastogenesis and bone resorption by attenuating H.sub.2O.sub.2 accumulation. Nat. Commun. 5:3773. [0107] 17. Wang, Y., G. Dong, H. H. Jeon, M. Elazizi, L. B. La, A. Hameedaldeen, E. Xiao, C. Tian, S. Alsadun, Y. Choi, and D. T. Graves. 2015. FOXO1 mediates RANKL-induced osteoclast formation and activity. J. Immunol. 194:2878-2887. [0108] 18. Gregersen, P. K., and N. Manjarrez-Orduo. 2013. FOXO in the hole: leveraging GWAS for outcome and function. Cell 155:11-12. [0109] 19. Lee, J. C., M. Espi, C. A. Anderson, M. A. Linterman, J. M. Pocock, N. J. Williams, R. Roberts, S. Viatte, B. Fu, N. Peshu, et al: UK IBD Genetics Consortium. 2013. Human SNP links differential outcomes in inflammatory and infectious disease to a FOXO3-regulated pathway. Cell 155:57-69. [0110] 20. Miller, C. H., S. M. Smith, M. Elguindy, T. Zhang, J. Z. Xiang, X. Hu, L. B. Ivashkiv, and B. Zhao. 2016. RBP-J-regulated miR-182 promotes TNF--induced osteoclastogenesis. J. Immunol. 196:4977-4986. [0111] 21. Vacik, T., and I. Raska. 2017. Alternative intronic promoters in development and disease. Protoplasma 254:1201-1206. [0112] 22. Kim, H. K., M. H. C. Pham, K. S. Ko, B. D. Rhee, and J. Han. 2018. Alternative splicing isoforms in health and disease. Pflugers Arch. 470:995-1016. [0113] 23. Dlamini, Z., F. Mokoena, and R. Hull. 2017. Abnormalities in alternative splicing in diabetes: therapeutic targets. J. Mol. Endocrinol. 59: R93-R107. [0114] 24. Inoue, K., Z. Deng, Y. Chen, E. Giannopoulou, R. Xu, S. Gong, M. B. Greenblatt, L. S. Mangala, G. Lopez-Berestein, D. G. Kirsch, et al. 2018. Bone protection by inhibition of microRNA-182. Nat. Commun. 9:4108. [0115] 25. Trapnell, C., L. Pachter, and S. L. Salzberg. 2009. TopHat: discovering splice junctions with RNA-Seq. Bioinformatics 25:1105-1111. [0116] 26. Trapnell, C., B. A. Williams, G. Pertea, A. Mortazavi, G. Kwan, M. J. van Baren, S. L. Salzberg, B. J. Wold, and L. Pachter. 2010. Transcript assembly and quantification by RNA-Seq reveals unannotated transcripts and isoform switching during cell differentiation. Nat. Biotechnol. 28:511-515. [0117] 27. Anders, S., P. T. Pyl, and W. Huber. 2015. HTSeqa Python framework to work with high-throughput sequencing data. Bioinformatics 31:166-169. [0118] 28. Robinson, M. D., D. J. McCarthy, and G. K. Smyth. 2010. edgeR: a Bioconductor package for differential expression analysis of digital gene expression data. Bioinformatics 26:139-140. [0119] 29. Litvak, V., A. V. Ratushny, A. E. Lampano, F. Schmitz, A. C. Huang, A. Raman, A. G. Rust, A. Bergthaler, J. D. Aitchison, and A. Aderem. 2012. A FOXO3-IRF7 gene regulatory circuit limits inflammatory sequelae of antiviral responses. Nature 490:421-425. [0120] 30. Takayanagi, H., S. Kim, K. Matsuo, H. Suzuki, T. Suzuki, K. Sato, T. Yokochi, H. Oda, K. Nakamura, N. Ida, et al. 2002. RANKL maintains bone homeostasis through c-Fos-dependent induction of interferon-beta. Nature 416:744-749. [0121] 31. Yarilina, A., K. H. Park-Min, T. Antoniv, X. Hu, and L. B. Ivashkiv. 2008. TNF activates an IRF1-dependent autocrine loop leading to sustained expression of chemokines and STAT1-dependent type I interferon-response genes. Nat. Immunol. 9:378-387. [0122] 32. Calnan, D. R., and A. Brunet. 2008. The FoxO code. Oncogene 27:2276-2288.