Modified mini-nucleosome core proteins and use in nucleic acid delivery
12606833 ยท 2026-04-21
Assignee
Inventors
Cpc classification
C07K2319/35
CHEMISTRY; METALLURGY
C07K2319/80
CHEMISTRY; METALLURGY
C07K2319/033
CHEMISTRY; METALLURGY
A61K48/0025
HUMAN NECESSITIES
C12N15/87
CHEMISTRY; METALLURGY
A61K48/005
HUMAN NECESSITIES
International classification
A61K48/00
HUMAN NECESSITIES
Abstract
The present disclosure provides compositions and methods relating to modified mini-nucleosome core proteins and/or delivery of nucleic acids. In particular, the present disclosure includes, among other things, non-viral proteinaceous vehicles for delivery of nucleic acids. In various embodiments, non-viral proteinaceous vehicles provided herein include (a) a nucleic acid binding domain; (b) a targeting domain; (c) a nucleic acid release domain; and, optionally. (d) further domains including, e.g., one or more of a stability domain, an oligomerization domain, and/or a linker domain. In various embodiments, the proteinaceous vehicles include one or more modified residues.
Claims
1. An engineered polypeptide comprising: A modified amino acid, wherein the amino acid modification comprises mannosylation; and wherein the engineered polypeptide comprises an amino acid sequence having at least 90% sequence identity over the full length of SEQ ID NO: 447.
2. A polynucleotide that encodes the amino acid sequence of an engineered polypeptide of claim 1.
3. A composition comprising: (i) at least one polynucleotide, and (ii) at least one engineered polypeptide of claim 1.
4. The engineered polypeptide of claim 1, wherein the engineered polypeptide comprises SEQ ID NO: 447.
Description
BRIEF DESCRIPTION OF THE DRAWING
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
DETAILED DESCRIPTION
(36) The present disclosure provides, among other things, methods and compositions relating to mini-nucleosome core proteins and uses thereof. Mini-nucleosome core proteins disclosed herein include, among other things, (a) a nucleic acid binding domain (NABD), (b) a targeting domain and/or (c) a nucleic acid release domain, and/or a stability domain, and/or an oligomerization domain, and/or a linker domain. Certain mini-nucleosome core proteins disclosed herein include (a) a nucleic acid binding domain (NABD); (b) a targeting domain; (c) a nucleic acid release domain; and, optionally, (d) further domains including, e.g., one or more of a stability domain, an oligomerization domain, and/or a linker domain. In various embodiments, mini-nucleosome core protein of the present disclosure is a modified mini-nucleosome core protein, i.e., a mini-nucleosome core protein that is modified in that it includes one or more modified amino acid residues, such as an amino acid residue modified to include a modification provided herein, including without limitation any of one or more of (i) phosphorylation; (ii) sulfation; (iii) glycosylation (e.g., N-glycosylation, C-glycosylation, and/or O-glycosylation); (iv) prenylation (e;g., geranylation and/or farnesylation); (v) methylation;; (vi) sialylation; (vii) lipidation and/or lipoylation;; (viii) acetylation; (ix) hydroxylation;; (x) palmitoylation; (xi) mannosylation; (xii) myristoylation; (xiii) fucosylation; (xiv) pegylation; and/or; (xv) any combination thereof, including any number of one or more of the modifications or variants thereof, e.g., in a branched or unbranched modification chain. In various embodiments, a mini-nucleosome core protein of the present disclosure can be a modified mini-nucleosome core protein that includes (a) a nucleic acid binding domain (NABD); (b) a targeting domain; (c) a modified amino acid residue; and, optionally, (d) further domains including, e.g., one or more of a nucleic acid release domain, a stability domain, an oligomerization domain, and/or a linker domain. In various embodiments, a mini-nucleosome core protein of the present disclosure can be a modified mini-nucleosome core protein that includes (a) a nucleic acid binding domain (NABD); (b) a targeting domain; (c) a nucleic acid release domain; (d) a modified amino acid residue; and, optionally, (e) further domains including, e.g., one or more of a stability domain, an oligomerization domain, and/or a linker domain. In various embodiments, a mini-nucleosome core protein is associated with one or more nucleic acid molecules, thereby forming a loaded mini-nucleosome core protein (the mini-nucleosome core protein and associated nucleic acid molecules also referred to together herein as a loaded mini-nucleosome). In various embodiments, a loaded mini-nucleosome includes two or more mini-nucleosome core proteins and one or more nucleic acid molecules. In various embodiments, a loaded mini-nucleosome is administered to a subject in need thereof.
(37) Polynucleotide chains typically carry phosphates with negative charge. Accordingly, positive charges in proteins such as histones help condense nucleic acids. The present disclosure appreciates that nucleic acid binding domains, derived, e.g., from histones, can be utilized in artificially constructed mini-nucleosome core proteins as a non-viral proteinaceous vector.
(38) Most mammalian cells possess cell surface binding moieties or receptors that recognize (and/or are recognized by), bind, and internalize molecules or entities like viruses and bacteria. Various compositions and methods disclosed herein make use of such cell surface binding motifs in combination with nucleic acid binding domains and poly-Arginine domains in a mini-nucleosome core protein. In various embodiments, a mini-nucleosome core protein is capable of condensing, or participating in or facilitating the condensation of, one or more nucleic acids. In various embodiments, a mini-nucleosome core protein facilitates internalization of associated nucleic acids, e.g., in a loaded mini-nucleosome, into specific cell types, e.g., via endocytosis or via other cellular entry mechanisms. Accordingly, in various embodiments, the present disclosure includes mini-nucleosome core proteins that incorporate targeting moieties capable of binding with cell surface moieties or receptors that are naturally present on cells of a system, e.g., a system that is a human, where the cell surface moiety or receptor provides a cell entry mechanism. In various instances, the cell surface moiety or receptor is cell-type specific and thus facilitates specific delivery of nucleic acids to selected cell types.
(39) Nucleic acid molecules can have a large negative charge, are vulnerable for degradation in body fluids, e.g., after administration to subjects, and cannot enter a cell via simple injections or exposure to the cell. That large negative charge can be neutralized by mini-nucleosome core-proteins, including modified mini-nucleosome core proteins, to form loaded mini-nucleosomes of certain shape, size, and charge and/or that are capable of entering into cells by passive diffusion or active transport. Various mini-nucleosome core proteins described herein allow proper binding, condensation and targeting of nucleic acids. These domains described herein, may be derived from human proteins or other organisms. One skilled in the art may contemplate modifying or engineering domains and/or mini-nucleosome core proteins described herein, e.g., with changes to the amino acid sequence for enhancing certain functions such as cell attachment, internalization etc. but not limited to these. One skilled in the art may also contemplate placing the domain in reverse sequence or by switching amino acid positions within the domain or adding various posttranslational modifications such as acetylation, glycation etc. to amino acids but not limited to these. Various mini-nucleosome core proteins described herein include at least one modified amino acid residue.
(40) Nucleic Acid Binding Domains
(41) The present disclosure includes the recognition that positively charged domains associate with nucleic acids. The present disclosure provides nucleic acid binding domains, e.g., DNA and RNA binding domains, that can be included in a mini-nucleosome core protein. In some instances, a DNA binding domain present in a mini-nucleosome core protein is a DNA binding domain disclosed herein. In some instances, a RNA binding domain present in a mini-nucleosome core protein is a RNA binding domain disclosed herein.
(42) In some particular instances, an NABD that is a DNA binding domain present in a mini-nucleosome core protein disclosed herein can be derived from a histone polypeptide sequence. Non-viral vectors such as DNA nanoparticles utilizing poly-lysine peptides to compact DNA into smaller particles for gene delivery (Liu G. et al, 2003) have been used, at least some instances, with no success or significant responses in treatment of diseases (Konstan M.W. et al, 2004). The present disclosure provides a significantly different approach that includes, in various embodiments, use of DNA binding domain of histones, for example the amino acid sequence KRHRK. This amino acid sequence serves two purpose-first it gives the highly positive charge that is needed to associate with nucleic acids, Secondly, it also gives stability to the mini-nucleosome core protein structure. Thirdly, the amino acid sequence KRH in this NABD also is a cleavage site for proprotein convertases thus allows efficient release of the genetic cargo in cells.
(43) Other examples of NABDs are provided in Table 3.
(44) A poly-arginine tract such as RRRRR can be included in a mini-nucleosome core protein to increase nucleic acid binding as well as to enhance positive charge and/or cell penetration ability of the composition. A poly-arginine tract can be present in a mini-nucleosome core protein in a position suitable to facilitate penetration of cells by the mini-nucleosome core protein and/or by loaded mini-nucleosomes including the mini-nucleosome core protein. Those of skill in the art will be aware of the methods and techniques that allow determination of such a position. Arginine interacts with phospholipids to form of bi-or multi-dentate hydrogen bonding from simultaneous association with the phosphates of more than one lipid head therefore interacts with the phosphate on a single lipid head group. Since, only arginine can form bi-dentate hydrogen-bonds, poly-arginines could bond with more zwitterionic and anionic lipids and therefore generate positive curvature along its contour length, thus resulting in negative Gaussian curvature (Rothbard, J. B., et al. 2005). A poly-Arginine tract may also be modified to include specifically one or more Histidine (H) amino acid (or any other amino acid) to improve stability of the mini-nucleosome core protein. Histidine (or any other amino acid) may be inserted in any position in the poly-Arginine tract as shown in Table 3. Other arginine-rich peptides such as ANTP Penetratin, and TAT have also shown similar impact on cell penetration.
(45) The present disclosure includes the recognition that localization of a mini-nucleosome core protein to a euchromatin area of the nucleus can be facilitated by acetylation of lysines in mini-nucleosome core proteins. The mechanism of this stabilization may be related, at least in part, to mechanisms that stabilize post-translationally modified histones. Methylated histones pack more tightly. Histone methylation can be dynamic. Other post translational modifications that can be applied are: phosphorylation, glycosylation, prenylation, lipoylation, alkylation, acylation, glycation, nitrosylation, sulfation, carbamylation, carbonylation, sumoylation, neddylation, biotinylation, ribosylation etc. Modifications may not be limited to these mentioned here. Other modifications may include attachment of co-factors, co-enzymes, hydrophobic groups, hydrophilic groups, smaller chemical groups, smaller peptides etc. Such modification could also be applied to amino acids in these mini-nucleosome core proteins described herein. Nucleic acid binding domains mentioned herein, in Table 3 can be incorporated in polypeptides at any location to enhance nucleic acid binding in combination with other domains provided in Tables 4, 5, 6, 7, 9, 10, 11 and 12.
(46) TABLE-US-00003 TABLE 3 Exemplary Domains SEQ ID NO: Name Exemplary Utility Reference KRHRK 1 DNA binding Enhanced DNA Bottomley domain binding M.J., 2004 RRR, RRRR, 2, 3, 4, 5 Poly-Arginines: Enhanced cell Mishra, A. et RRRRRR, (RR)X DNA binding penetration al, 2008 domain RRLARR 6 Condensing Enhanced DNA John P. H. domain (part of) binding; Th'ng et al. condensation 2005 KKAKAAAKPKK 7 Condensing Enhanced DNA John P. H. domain (part of) binding and Th'ng et al. condensation 2005 KKDGKKRKR 8 Condensing Enhanced DNA John P. H. domain (part of) binding and Th'ng et al. condensation 2005 KKKLK 9 HTH motif (part Enhanced DNA Uniprot of binding KKRIRK, RKKSK 10, 11 RUNX1 binding Enhanced DNA Uniprot (part of) binding KKPKK 12 Condensing Enhanced DNA John P. H. domain (part of) binding and Th'ng et al. condensation 2005 RRHRR 13 Nucleic acid Enhanced nucleic Uniprot binding acid binding and stability RHRRR 14 Nucleic acid Enhanced nucleic Uniprot binding acid binding and stability RRRRHR 15 Nucleic acid Enhanced nucleic Uniprot binding acid binding and stability KRTVRK 16 Nucleic acid Enhanced nucleic Uniprot binding acid binding KRQRNR 17 Nucleic acid Enhanced nucleic Uniprot binding acid binding RVCACPGR 18 P53 DNA Enhanced nucleic Uniprot interaction acid binding (KKK)x 19 Nucleic acid Enhanced nucleic Uniprot binding acid binding DEMGLGKT 20 Nucleic acid Nucleotide binding Uniprot binding QRE, HLSQHLN, 21, 22, 23, Nucleic acid Interaction with Uniprot KTQK, RFKW, 24, 25, 26 binding DNA RVY, NRRK TFF 27 Nucleic acid RNA binding Uniprot binding RPRGRPRKHTVTS 28 Nucleic acid Enhanced nucleic Uniprot binding acid binding
(47) For the avoidance of doubt, the present disclosure includes modified nucleic acid binding domains, including without limitation a nucleic acid binding domain of the present disclosure in which at least one amino acid of the nucleic acid binding domain includes a modification disclosed herein.
(48) Targeting Domains
(49) Mini-nucleosome core proteins disclosed herein include targeting domains that target mini-nucleosomes to one or more cells or cell types.
(50) In some embodiments, a targeting domain of a mini-nucleosome core protein is an amino acid domain that allows attachment to and enter into one or more cells or cell types. It is to be understood that targeting domains can be specific to certain cell types but can also include domains that facilitate entry into cells generally. In general, a targeting domain of a mini-nucleosome core protein can contribute to one or more of attachment, cell-type specific binding, and internalization. A targeting domain can be, for example, a cell attachment targeting domain, beta galactose binding domain, fucose binding domain, heparin binding domain, sialic acid binding domain, glycoprotein binding domain, carbohydrate binding domain, lysophosphatidic acid binding, cAMP binding domain, hyaluronan binding domain, chondroitin sulfate binding domain, integrin binding domain, nucleolin binding domain, collagen binding domain, clathrin binding domain, Fc receptor binding domain, actin binding domain, endocytosis motif or a nuclear localization signal. In some embodiments, a targeting domain of a mini-nucleosome core protein is an amino acid domain that allows binding and entry into one or more cells or cell types and that is derived from a mammal, virus, viral particle, prion, bacteria or fungal amino acid sequence.
(51) For the avoidance of doubt, the present disclosure includes modified targeting domains, including without limitation a targeting domain of the present disclosure in which at least one amino acid of the targeting domain includes a modification disclosed herein.
(52) Cell Attachment Targeting Domains
(53) Cell attachment is a means by which a mini-nucleosome core protein, or loaded mini-nucleosome include the mini-nucleosome core protein, can adhere to cell and, in various instances, facilitate entry to into the cell. Various viruses have adhesion molecules or domains that allow binding to host cells and enhance entry into them. For example, flu virus has hemagglutinin on its surface that allows it to bind to sialic acid on the cell surface. The present disclosure provides, among other things, several such domains that allow mini-nucleosome core protein binding to sialic acid, galactose, fucose, hyaluronic acid, and chondroitin sulfate, as well as glycoproteins that enhance cell attachment for internalization. A mini-nucleosome core protein disclosed herein can include one or more cell attachment targeting domains. Cell attachment targeting domains include the domains shown in Table 4. A cell attachment targeting domain of the present disclosure can be present in a mini-nucleosome core protein at any position and/or in combination with any of one or more other domains provide herein, e.g., in Tables 3, 5, 6, 78, 9, 10, 11 and 12.
(54) TABLE-US-00004 TABLE 4 Exemplary Exemplary Domains SEQ ID NO: Name Utility Reference WGREERQ 29 Cell Enhanced cell Uniprot attachment surface site on attachment via LGALS3 beta-galactose binding NTQIH & WNNKTPH 30, 31 CTxB domain Enhanced cell Uniprot surface attachment via galactose binding TPH 32 CTxB domain Enhanced cell Uniprot surface attachment via Fucose binding VNRWS 33 Sialic acid Enhanced muscle Uniprot binding cell surface domain attachment via Sialic acid binding XBBBXXBX, 34, 35 Heparin Enhanced cell Cardin and ARKKAAKA binding surface Weintraub, domain attachment via 1989 Heparin binding. QRR, SRR 36, 37 CPC motif Enhanced cell Torrent M. surface et. al, 2012 attachment via Heparin binding WEPSRPFPVD 38 B3GAT3 Enhanced cell Uniprot motif surface attachment via galactose binding HRRTRKAPKRIRLPHIR 39 Herpes Enhanced cell Uniprot glycoprotein surface gD motif attachment via glycoprotein binding KRTGQYKLGSKTGPGQK 40 Heparin Enhanced cell Uniprot binding surface domain in attachment via FGF2 heparin binding KKTK 41 Heparin Enhanced cell Nelson C. Di sulfate surface Paolo et al, binding attachment via 2007 heparin sulfate binding domain KLRSQLVKK 42 Hyaluronan Enhanced cell Uniprot binding motif surface attachment via Hyaluronan binding RRRCGQKKK 43 Hyaluronan Enhanced cell Uniprot binding motif surface attachment via Hyaluronan binding BX(7)B 44 BX7B domain Enhanced cell Jean L. et al, surface 2001 attachment via Hyaluronan binding RIQNLLKITNLRIKFVK 45 AC15 domain Enhanced cell Kokona surface Kouzi-K. et attachment via al. 1989 heparin binding KKEKDIMKKTI 46 Sgl MOTIF Enhanced cell Joji I. et al, of integrin surface 1998 attachment via chondroitin sulfate binding domain HGSRFTFHRGSM, HRPH, 47, 48, Lectin binding Enhanced cell Uniprot DVAR, HFNPR, WGTE 49, 50, surface 51 attachment via Beta-galactoside binding binding domain KKQFGAEC 52 Chondroitin Enhanced cell Uniprot sulfate surface binding attachment RRPRPGTGPGRRPRPRPRP 53 Heparan Enhanced cell Uniprot sulfate surface binding attachment
(55) Cell attachment can also be achieved by domains such as RGD, RGDS etc. (D'Souza S E et al, 1991). Binding to cell surface proteins such as integrins, nucleolin, collagen, clathrins, Fc receptors also help viruses and other particles get entry to the cell. The present disclosure provides, among other things, domains that allow binding to as integrins, nucleolin, collagen, clathrins, Fc receptors for increased cellular uptake. Cell attachment targeting domains include the domains shown in Table 5. A cell attachment targeting domain provided in Table 5 can be present in a mini-nucleosome core protein at any position and/or in combination with any of one or more other domains provide herein, e.g., in Tables 3, 4, 6, 7, 8, 9, 10, 11 and 12.
(56) TABLE-US-00005 TABLE 5 SEQ ID Exemplary Domains NO: Name Exemplary Utility Reference KGE 54 Cell attachment Enhanced cell Maginnis motif attachment via M. S. et al, Integrin binding 2006 RGD, RGDS 55, 56 Cell attachment Can be used to block D'Souza SE motif RPE transduction. et al, 1991 TTVVNPKYEGK, 57, 58 Betal integrin cell Enhanced cell Reszka A. A. ERMSQIKRLLS attachment domain attachment via et al, 1992 Integrin binding WRHRARS 59 NS5B domain Enhanced cell Kusakawa T. attachment via et al, 2007 Nucleolin binding GFOGER 60 A-domains of Enhanced cell Knight C. G. Integrins attachment via et al, 2000 Collagen I and IV binding to Integrins LFDLM 61 ENTH domain Enhanced cell Kalthoff et al, attachment via 2002 Clathrin terminal domain binding WGREERQ 62 Galactose binding Enhanced cell Uniprot motif attachment via galactose binding site on LGALS3 QSTEKRG 63 Cclec6A motif Enhanced cell Uniprot attachment via association with Fc receptor gamma chain (FCER1G) LPNTG 64 LPXTG motif Enhanced cell Dramsi et al, attachment 2008 DSPE, FQVT 65, 65 Popeye domain CAMP binding Brand, T. 2016 QSTEKRG 66 CLEC6a motif Carbohydrate Uniprot binding RQGLID 67 domain in LPAR1 Lysophosphatidic Uniprot acid binding RKKH 68 Midas motif Echo virus 1 and Pentikainen integrin binding O. et al, 1999 motif. Collagen binding. YPK, YNQYT 69, 70 Sialoadhesion Myelin associated Kelm S. et al, domain glycoprotein 1994 KWNYK 71 Sialic acid binding Siglec7 Uniprot domain GPQSVKFKSPDQI 72 Adhesion domain Cytoadherence Uniprot RVGENWWY, 73, 74, Chondroitin sulfate Cell surface Uniprot RTLQAHHDR, 75, 76, binding attachment RESPFSGSSR, 77, 78, 79 REEIQERMR, QDSSSFHHQ, KKQFGAEC, KRALHNAEC KQKIKHVVKLK, 80, 81 Hyaluronic acid Cell surface Uniprot KLRCQLAKKK binding attachment
(57) For the avoidance of doubt, the present disclosure includes modified cell attachment targeting domains, including without limitation a cell attachment targeting domain of the present disclosure in which at least one amino acid of the cell attachment targeting domain includes a modification disclosed herein.
(58) Internalization Targeting Domains
(59) Certain domains in viral and mammalian proteins can directly impact cellular internalization. For example, domains of certain proteins, and sequential arrangement, is described in Oleson et al., 2008. For example, a PPxY-Motif is required for adenovirus entry into cells (Wodrich et al, 2010), where x could be any amino acid. Another example of an internalization targeting domain is the GTALL motif-a five-amino acid residue domain, in the carboxyl-terminus tail of leutinizing hormone (LH) receptor directs the ligand-receptor complexes from a degradative to recycling pathway (Pandey, 2009). The GTALL motif also shows sequence homology to carboxyl-terminus tetrapeptide sequence motif DSLL, which has been suggested to participate in the internalization of -adrenergic receptors. Pandey also discusses that the clathrin-dependent cargo usually contains a short sequence motif such as YXXQ (where X could be any amino acid), recognized by adaptor protein-2 (AP-2) and may contain Asn-Pro-X-Tyr sequence (NPXY) motifs, which are recognized by the accessory clathrin adaptor proteins. Transferrin. NPXY motif has also been discussed by Kirchhausen, 1999. NPTY is also the Endocytosis motif of APP. Another example of clathrin binding domain that allows internalization is FXDXF (where X could be any amino acid) (Lene E. Oleson. 2008). Internalization targeting domains include the domains provided in Table 6.
(60) Other features provided by the present disclosure include one or more leucine and isoleucine residues, which residues are highly hydrophobic in nature. In fact, leucine is the second most hydrophobic amino acid. In various embodiments, leucine residues can serve multiple functions in the composition of mini-nucleosome core proteins. First, the hydrophobicity of the nonpolar face of an amphipathic molecule plays an important role in stabilizing the peptide secondary structure (Chen Y. et al, 2007). Secondly, dileucine-type of signal motifs have been shown to be essential for internalization and trafficking of membrane receptors and membrane proteins into subcellular compartments. For example, GLUT4 (glucose transporter 4), LDL (low density lipoprotein); LH (leutinizing hormone), TGN (Trans-Golgi network) all have dileucine motifs that help internalization into cells. Fc receptor dileucine motif also signals for endocytosis (Wu Z. and Simister N.E., 2001). An internalization targeting domain provided in Table 4 can be present in a mini-nucleosome core protein at any position and/or in combination with any of one or more other domains provide herein, e.g., in Tables 3, 4, 5, 7, 8, 9, 10, 11 and 12.
(61) TABLE-US-00006 TABLE 6 SEQ ID Exemplary Exemplary Domains NO: Name Utility Reference FXDXF 82 FXDXF-motif Clathrin binding Lene E. Oleson motif facilitates JBC. 2008 internalization PPSY 83 PPxY-Motif Facilitates H Wodrich et al, Adenovirus 2010 Entry. At the end of the sequence. FEDNFVP 84 7-mer peptide from Enhanced Lene E. Oleson amphiphysin. Internalization JBC. 2008 YIRV, YADW, YTQV 85, 86, 87 Internalization Enhanced Zrarate et al, 2007 motif Internalization KKRPKP 88 Prion Is sufficient to (Sunyach, 2003). internalization direct motif internalization. SSDDE, RRASS 89, 90 CcN motif Efficient nuclear (David A Jans. transport and 1995 JBC) localization (YXXL)2 91 Internalization For viral entry Inabe K et al, motif of bovine and 1999 leukemia virus incorporation of viral envelope protein into virions. LPLTG, LAFTG 92, 93 Sorting signal Sortase Ton-That, H., and dependent entry. O. Schneewind. 2003 L, I, LI, IL 94, 95, Leucines, Increased Chen Y. et al, 96, 97 Isoleucine hydrophobicity 2007 for polypeptide stability LL 98 Dileucine Enhanced Wu Z. and cellular Simister N. E., internalization 2001 KRRHPKK 99 Cardin-Weintraub Heparan sulfate Uniprot motif binding EPS, EPNLPEE, ND 100, 101, Mannose binding Enhanced Uniprot 102 domian cellular internalization NFR 103 N-acetyl-D- Enhanced Uniprot glucosamine cellular binding internalization YWV 104 PDZ binding Enhanced Uniprot cellular internalization AICKRIPNKKPGKRT 105 Heparin binding Enhanced Uniprot cellular internalization VAR, KIL 106 Receptor binding Enhanced Uniprot (CXCL12) cellular internalization RCPCR, 107, 108 Heparin binding Enhanced Uniprot RANVKHLKILN, 109 cellular VARLKNNNRQV internalization VRKKP, 110, 111 PDGFA binding to Enhanced Uniprot YVRKKPKLK its receptor cellular internalization ISRRLI 112 PDGFB binding to Enhanced Uniprot its receptor cellular internalization LTKRSRQ, 113, 114 Gag binding Enhanced Uniprot NRKISVQRL cellular internalization YYKQRLI 115 Nucleocytoplasmic Enhanced Uniprot transport cellular internalization
(62) For the avoidance of doubt, the present disclosure includes modified internalization targeting domains, including without limitation an internalization targeting domain of the present disclosure in which at least one amino acid of the internalization targeting domain includes a modification disclosed herein.
(63) Nucleus Targeting Domains
(64) In various embodiments, it is important that, following cellular entry, a nucleic acid cargo reaches the nucleus. Nuclear internalization signals or binding to the nuclear import machinery are key to nuclear localization. Functional eukaryotic nuclear localization signals are widespread in terminal proteins of bacteriophages (Redrejo-Rodrguez et. al, 2012). Chan and Jans have shown that polylysine by itself doesn't function as a nuclear localization signal. Thus, adding a nuclear targeting signals to enhance non-viral gene transfer is a logical approach (Chan and Jans, 1999). Location of NLS in the polypeptide is also key for its function. We have listed the NLS sequences in Table 7 for enhanced nuclear entry and provided certain preferred locations of NLS signal within mini-nucleosome core proteins for efficient nuclear entry in Table 13. Domains mentioned herein, in Table 7 can be incorporated in mini-nucleosome core protein at any location to enhance nucleic acid binding in combination with other domains provided in Table 3, 4, 5, 6, 8, 9, 10, 11 and 12.
(65) TABLE-US-00007 TABLE 7 SEQ ID Source Exemplary Exemplary Domains NO: protein Utility Reference KKKYKLK 116 Gag pol Nuclear Uniprot localization signal KKRKLE 117 LMNA Nuclear Uniprot localization signal TRSK 118 VP22 Nuclear Uniprot localization signal HRKRKR 119 Aprataxin Nuclear Uniprot localization signal NKRKRK 120 SAP30L Nuclear Uniprot localization signal AEKSKKK 121 HMGB1 Nuclear Uniprot localization signal RKSK, KRVK 122, HIPK2 Nuclear Uniprot 123 localization signal KRK 124 NFATC1 Nuclear Uniprot localization signal LQQTPLHLAVI 125 NFKB Nuclear Uniprot inhibitor localization alpha signal contains ankyrin repeats RRPR, PRPR, RPPP 126, Bovine Nuclear Uniprot 127, Herpes localization 128 Virus signal for bovine herpes. RKKRKGK 129 DAG1 (dystroglycan). Uniprot In the c- terminal PAAKRVKLD 130 c-Myc Nuclear Uniprot localization signal KLKIKRPVK 131 TUS Nuclear Uniprot localization signal PKKKRKV 132 SV40 Nuclear Uniprot localization signal QRKRQK 133 NFKB Nuclear Uniprot localization signal KRPR 134 TOPBP1 Nuclear Uniprot localization signal RKRRRP 135 DEDD2 Nuclear Uniprot localization signal KKGRRNRFK 136 HNF1A Nuclear Uniprot localization signal RHRDRLNTELDRLASLLPFPQDVINKLDK 137 AHR Nuclear Uniprot localization signal KRGRKP 138 CBX2 Nuclear Uniprot localization signal KKRAGRRIFKETR 139 DREBE1 Nuclear Uniprot localization signal
(66) For the avoidance of doubt, the present disclosure includes modified nucleus targeting domains, including without limitation a nucleus targeting domain of the present disclosure in which at least one amino acid of the nucleus targeting domain includes a modification disclosed herein.
(67) Cell-type Specific Targeting Domains
(68) In various embodiments, it is most desirable that larger concentration of the particles home into the desired cell type. This allows for increased uptake and increased expression-two favorable gene therapy output. In literature, there are very few motifs that have been discovered for such properties. Most of these come from experiments that have shown viral tropism to be different from different capsids. The present disclosure includes, in various embodiments, use of some of those defined motifs, to enhance expression in neurons, muscles, liver, lung, kidney, endothelial cells or tumor sites. Cell-type specific targeting domains include the domains shown in Table 8. A cell-type specific targeting domain of Table 8 can be present in a mini-nucleosome core protein at any position and/or in combination with any of one or more other motifs provide herein, e.g., in Tables 3, 4, 5, 6, 7, 9, 10, 11 and 12.
(69) TABLE-US-00008 TABLE 8 SEQ ID Exemplary Domains NO: Exemplary Utility Reference ASSLNIA 140 Muscle targeting Yu C-Y. et al. 2009 SKIFNTHPQSTP 141 Muscle targeting Y Seow et al. 2010 YKQCHKKGGHCFPKEK 142 Muscle targeting Uniprot LGKMDCRWKWKCCKKGSG 143 Muscle targeting Uniprot HGSRFTFHRGSM 144 Muscle targeting Uniprot KKEEEKKEEEKKEEE 145 Renal targeting Wischnjow A, et al, 2016 LIFHKEQ 146 LIVER targeting Uniprot KFNKPFVFLI 147 Lung targeting Buning H. et al, 2003 QPEHSST 148 Endothelial cell targeting Work, L. M. et. al, 2006 EYHHYNK 149 Vascular smooth muscle cell Work, L. M, et. al, 2004 targeting NGR 150 Tumor homing Arap W, et. al, 1998 GEKGEP 151 Facilitate phagocytosis by Uniprot monocytes KTKKK, KALKKK, KGKKK 152, 153, Phagocytosis of the particles. Caberoy N. B. et al, 2010 154 CSVTCG 155 Interaction with CD36; bind to Asch A. S., et. al 1992 cancerous cells. LRE 156 Neuron targeting by enhanced Hunter D. D. et al, 1989 neuronal attachment. YKYNLNGRES 157 Lung targeting Asokan A, et al, 2006 YRSL 158 Basolateral targeting Anderson E., et al, 2005 KGGK7 159 Actin-binding Dahlin-Huppe K. et al., 1997 KKKQYTSIHHG 160 Basolateral sorting Zheng P. et al, 1998 KDEL 161 Endosomal Reticulum targeting Chinnapen D. J. et al, 2007 LADQDYTKTA 162 Retrograde transport Tervo D. G. R., et. al, 2016 DDNN 163 Corin surface targeting Uniprot SAVTTVVN 164 ITGB1 interaction with Uniprot ITGB1BP1
(70) For the avoidance of doubt, the present disclosure includes modified cell-type specific targeting domains, including without limitation a cell-type specific targeting domain of the present disclosure in which at least one amino acid of the cell-type specific targeting domain includes a modification disclosed herein.
(71) Nucleic Acid Release Domains
(72) In some embodiments, a nucleic acid release domain (NARD) of a mini-nucleosome is an amino acid domain that causes or facilitates release of a nucleic acid cargo of a loaded mini-nucleosome (e.g., release of one or more of the nucleic acids associated with a mini-nucleosome core protein of a loaded mini-nucleosome). In various embodiments, by controlling or regulating the conditions under which a nucleic acid cargo is released, a nucleic acid release domain can improve delivery a nucleic acid cargo to cells, e.g., to the cytoplasm or nucleus of cells.
(73) It is highly desirable that nucleic acids associated with a loaded mini-nucleosome core protein (e.g., when delivered to a subject or system) do not release from a loaded mini-nucleosome prior to the loaded mini-nucleosome entering a cell (e.g., a cell of the subject or system). Within a cell, release of nucleic acid cargo in the cytoplasm or nucleus may be preferred. Various proteases and endopeptidases known in the art could cause or facilitate release of one or more nucleic acids of a loaded mini-nucleosome inside cells, e.g., causing or facilitating disassociation of one or more nucleic acids of a loaded mini-nucleosome from the mini-nucleosome core protein of the loaded mini-nucleosome. Proprotein convertases and endopeptidases are exemplary agents that cleave polypeptides at certain amino acid domains, which phenomenon is utilized herein to provide mini-nucleosome core proteins that can release an associated nucleic acid cargo upon delivery into a cell (e.g., a cell of a subject or system), e.g., into the cytoplasm or nucleus of a cell.
(74) KRH is an exemplary cleavage domain that can be included in a mini-nucleosome core protein as a nucleic acid release domain. KRH is the cleavage site for Pcsk 1 and Pcsk2. To provide one non-limiting example of a KRH cleavage site, proglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal cells by Pcsk1 or Pcsk2.
(75) NRRKKRAL is an exemplary cleavage domain that can be included in a mini-nucleosome core protein as a nucleic acid release domain. To provide one non-limiting example of an NRRKKRAL cleavage domain, NRRKKRAL is a Furin cleavage site of for TGFB1. Another exemplary cleavage domain is KSVKKRSVSEIQ, which is a Furin cleavage site in parathyroid hormone.
(76) Various other cleavage domains are known in the art and can be included in a mini-nucleosome core protein as a nucleic acid release domain. As those of skill in the art will appreciate, cleavage sites can also be predicted in silico using bioinformatics platforms such as Expasy, OmicX, PROSPERous, Prop1.0, SignalP-5.0, MEROPS, CutDB, Peptide Cutter etc.
(77) The present disclosure provides that cleavage domains of the present disclosure can be included in mini-nucleosome core proteins to cause or facilitate release of a nucleic acid cargo of a loaded mini-nucleosomes in cells (e.g., cells of a subject or system), e.g., in cytoplasm or nucleus. Domains provided herein, including those provided in Table 9, can be present in a mini-nucleosome core protein of the present disclosure (e.g., a modified mini-nucleosome core protein) at any position within the mini-nucleosome core protein. For the avoidance of doubt, a nucleic acid release domain of the present disclosure can be present in a mini-nucleosome core protein in combination with other domains provided herein, including without limitation those provided in Tables 3, 4, 5, 6, 7, 8, 10, 11 and 12. When present anywhere within a mini-nucleosome core protein of the present disclosure, a nucleic acid release domain of the present disclosure can enhance release of a nucleic acid cargo of a loaded mini-nucleosome.
(78) TABLE-US-00009 TABLE 9 SEQ ID Exemplary Domains NO: Exemplary Utility Reference GRKKRRQRRRPQ 165 Release at extracellular or Tian and Huang intracellular sites depending on et al, 2011 tissues expressing furin. KRH 166 Release at extracellular or Uniprot intracellular sites depending on tissues expressing Pcsk1 and Pcsk2 KSVKKRSVSEIQ 167 Release at extracellular or Uniprot intracellular sites depending on tissues expressing Pesk1 and Pcsk2 NRRKKRAL 168 Release at extracellular or Tian and Huang intracellular sites depending on et al, 2011 tissues expressing furin. KFERQ 169 Breakdown in the lysosomes. Park J. S. et al., 2016 VRGP 170 Cleavage by Thrombin Uniprot NKDS, NRDN 171 Cleavage by Plasmin Uniprot ANNR 172 Cleavage by Hementin Uniprot HL 173 Cleavage by MMP9 Uniprot RI, ET, GQ, RS, RD, 174, 175, Cleavage by autolysis Uniprot RN, RC, RG, RL, DA, 176, 177, RA, GS, LT, FS, GL, 178, 179, SA, DP, GT, GC, RQ, 180, 181, LS, HA 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195 FV, QH, EA, AL, LY, 196, 197, Cleavage by Pepsin Uniprot YL, GF, PS, RE, DP, 198, 199, PI, QS 200, 201, 202, 203, 204, 205, 206, 207 ND 208 Cleavage by BMP1 Uniprot
(79) For the avoidance of doubt, the present disclosure includes modified nucleic acid release domains, including without limitation a nucleic acid release domain of the present disclosure in which at least one amino acid of the nucleic acid release domain includes a modification disclosed herein.
(80) Stability Domains
(81) In some embodiments, a stability domain of a mini-nucleosome is an amino acid domain that allows loaded mini-nucleosomes to stay stable in bodily fluids, cytoplasm and the nucleus.
(82) Particle stability is important for safe passage into cells and longevity of expression. There are several reasons for particles to lose stability. First, particles should be stable in blood and other bodily fluids. Secondly, particles need to safely traverse the endosomal entry and escape safely to make it out to the cytoplasm. Viral particles or recycled receptors use several domains to enter the endosome and escape it. We provide examples of mini-nucleosome core proteins that incorporate endosomal entry and escape domains to increase stability. Domains mentioned herein, in Table 10 can be incorporated in mini-nucleosome core protein preferably at the C-terminal but also at any location to enhance stability of the mini-nucleosome core protein when combined with other domains provided in Table 3, 4, 5, 6, 7, 8, 9, 11 and 12. One skilled in the art may also contemplate fluorination of hydrophobic amino acids in the peptides to provide means of increasing protein stability, enhanced assembly etc. and to strengthen ligand-receptor interactions. One skilled in the art may also contemplate other post translational modifications to amino acids in the peptides to provide means of increasing protein stability, enhanced assembly etc. and to strengthen ligand-receptor interactions.
(83) TABLE-US-00010 TABLE 10 SEQ ID Exemplary Domains NO: Exemplary Utility Reference YTRF 209 Endocytosis signal for Pandey K. N. Transferrin receptor 2009 GDAY 210 Internalization signal for Pandey K. N. endocytosis of NPRA 2009 LLEE 211 Endosomal entry of Cd209 Uniprot RKKRRQRRR 212 Allows for endosomal escape Najjar K, et. al., 2015 YKSL 213 Endosomal entry of Cd209 Uniprot YENF 214 Endosomal entry of CELC10a Uniprot FQDL 215 Endosomal entry of CELC10a Uniprot YIGSR 216 Integrin conjugation, Graf, J et al, increased cell attachment 1987 IKVAV 217 Cell Membrane Penetrating Tashiro, K, et al Peptide, cell attachment 1989 EFAKFE 218 Recycling endosomes Uniprot LLEEEQLRGLGFRQTRGYKSL 219 Endosomal entry of Cd209 Uniprot
(84) For the avoidance of doubt, the present disclosure includes modified nucleic acid release domains, including without limitation a nucleic acid release domain of the present disclosure in which at least one amino acid of the nucleic acid release domain includes a modification disclosed herein.
(85) Oligomerization Domains
(86) Oligomerization is a chemical process by which monomers associate to form multimers, including dimers and higher order macromolecular complexes. Oligomerization of proteinaceous molecules is often facilitated by domains that promote association of monomers.
(87) In some embodiments, an oligomerization domain of a mini-nucleosome is an amino acid domain that allows mini-nucleosome core proteins or loaded mini-nucleosomes to associate in higher order structures such as homodimer, heterodimer, tetramer, octamers or other higher order structures. Oligomerization can reduce the size of a loaded mini-nucleosome. A multimers of mini-nucleosome core proteins can include two or more of the same mini-nucleosome core protein (e.g., two mini-nucleosome core proteins having the same amino acid sequence) and/or can include two more distinct mini-nucleosome core proteins (e.g., two mini-nucleosome core proteins having different amino acid sequences). Examples of oligomerization domains provided herein are not in any way limiting and one skilled in the art can appreciated that such domains may be recognized or identified by various methods including yeast-two hybrid screening, affinity purification coupled to mass spectrometry, text mining, or by application of artificial intelligence and machine learning. One skilled in the art can also create an inducible system of forming loaded mini-nucleosomes using an inducible homodimerization system and/or chemically induced dimerization.
(88) In some embodiments, an oligomerization domain can include 3 or more amino acids. Oligomerization domains disclosed herein, e.g., in Table 11, can be incorporated in mini-nucleosome core protein at any position of a mini-nucleosome core protein, e.g., in combination with other domains provided herein, e.g., in Table 3, 4, 5, 6, 7, 8, 9,10 and 12. In certain particular embodiments, an oligomerization domain is positioned at the C-terminus of a mini-nucleosome core protein.
(89) TABLE-US-00011 TABLE 11 SEQ ID Exemplary Domains NO: Exemplary Utility Reference LIRERTE 220 Dimerization Tucker C. L., et al, 1999 LVEERTQ 221 Dimerization Tucker C. L., et al, 1999 IITFTK 222 Human PTB Domain helps Markovtsov, V et al, 2000 dimerization ILFNK 223 Human PTB Domain helps Markovtsov, V et al, 2000 dimerization PIRTLSK 224 Human PTB Domain helps Markovtsov, V et al, 2000 dimerization YGNSPLHRFK 225 Human PTB Domain helps Markovtsov, V et al, 2000 dimerization FFQKDR 226 Human PTB Domain helps Markovtsov, V et al, 2000 dimerization KSRP 227 Human PTB Domain helps Markovtsov, V et al, 2000 dimerization YVM 228 GRB2 domain mediated Uniprot interaction YMKM 229 YXXL domain helps Uniprot oligomerization RSSSFG 230 Protein-protein interaction Uniprot LKIRGRER, 231, 232 P53 oligomerization (part of) Uniprot LKIRGRKR HVIFKKVSR 233 Heterodimerization of SAG with Uniprot Rho RGPRV 234 Polymerization of Fibrin Uniprot RANVKHLK 235 Polymerization of CXCL12 Uniprot YPKAG, YPRTG 236, 237 Dimerization of DPP-IV Tang, H-K et. al, 2011
(90) For the avoidance of doubt, the present disclosure includes modified oligomerization domains, including without limitation an oligomerization domain of the present disclosure in which at least one amino acid of the oligomerization domain includes a modification disclosed herein.
(91) Linkers
(92) It is known in the art of creating fusion proteins that proteins can, some instances, benefit from inclusion of a linker. The present disclosure includes mini-nucleosome core proteins that include one or more linkers, e.g., between two domains of a mini-nucleosome core protein. Linkers can contribute to protein structure stability. In some cases, linkers work as a separation between domains and in others they can directly affect function of proteins. Some linkers increase stiffness thus allowing effective separation of protein domains. Linkers also may be implemented to introduce cleavage sites. Linkers have been used for these reasons in the field of protein engineering. However, in the context of non-viral gene transfer this strategy hasn't been utilized. We show here that linkers can be successfully used to engineer domains for functional purposes such as selective transduction, gene delivery and transgene expression in desired cell types (
(93) In some embodiments, a linker sequence can include 1 or more amino acids. Linker amino acid sequences disclosed herein, e.g., in Table 12, can be incorporated in mini-nucleosome core protein between domains as shown in SEQ ID NOS: 238-335, where a linker could be a linker having any of the amino acids or amino acid sequences provided in Table 1 and 12. The linkers may contain other amino acid sequences not limited to those provided in Table 12. Linker sequences may also be generated via program called LINKER, which searches database of linker sequences using user-chosen inputs and generate output of linker sequences that fit the criteria. Threonine, serine, glycine, proline, arginine and alanine are preferred residues in natural linkers and thus, in mini-nucleosome core proteins.
(94) TABLE-US-00012 TABLE 12 SEQ ID Linkers NO: L 238 LL 239 GSS 240 GSSGSS 241 GGS 242 SSS 243 SSSSSS 244 GGSGG 245 GGSGGGGG 246 GGSGGHMGSGG 247 A(EAAAK).sub.nA 248 (AP).sub.n 249 (KP).sub.n 250 (EP).sub.n 251 GT 252 AAGAATAA 253 GSGSGSGS 254 GGSSG 255 PP 256 WW 257 MH 258 QP 259 PL 260 CM 261 RM 262 RK 263 QR 264 HR 265 FW 266 PW 267 HR 268 DH 269 QS 270 WG 271 GM 272 KP 273 LF 274 YQ 275 RI 276 FY 277 FN 278 TA 279 HY 280 QV 281 DW 282 AW 283 YI 284 HT 285 CH 286 HP 287 TA 288 EM 289 KH 290 ML 291 AQ 292 YL 293 FI 294 KY 295 WR 296 LA 297 FS 298 AR 299 FN 300 ET 301 LW 302 NE 303 LH 304 MH 305 FY 306 PH 307 YE 308 HK 309 PW 310 HF 311 IM 312 DH 313 VH 314 DR 315 RI 316 QS 317 FC 318 GM 319 HR 320 HN 321 EC 322 VT 323 TH 324 CR 325 FQ 326 EV 327 KT 328 TD 329 SF 330 ST 331 QV 332 YK 333 NO 334 QK 335
(95) For the avoidance of doubt, the present disclosure includes a modified linker, including without limitation a linker of the present disclosure in which at least one amino acid of the linker includes a modification disclosed herein.
(96) Mini-Nucleosome Core Proteins
(97) A mini-nucleosome core protein can include one or more domains provided herein.
(98) Mini-nucleosome proteins disclosed herein include at least a positively charged amino acid sequence that contains a nucleic acid binding domain, a targeting domain and/or a nucleic acid release domain and/or a stability domain. The mini-nucleosome core protein can be sequences that have e.g., at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with a mini-nucleosome core protein as set forth in any of SEQ ID NOs: 336-388. In various embodiments, a mini-nucleosome core protein has at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with a mini-nucleosome core protein as set forth in one of SEQ ID NOs: 388-394, 399, 401, or 447.
(99) In some embodiments, a mini-nucleosome core protein may contain amino acid sequence length from 10 to 100 amino acids. Amino acids, e.g., 10, 12, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 55, 70, 75, 80, 85, 90, 95, or 100 amino acids. In certain embodiments, a mini-nucleosome core protein can have a length of, e.g., 15 to 90 amino acids, 20 to 80 amino acids, 20 to 70 amino acids, 20 to 60 amino acids, or 30 to 40 amino acids.
(100) In certain embodiments, a mini-nucleosome core protein includes one or more domains disclosed herein and one or more amino acids that is not present in a domain disclosed herein. In certain instances, amino acids not present in a domain disclosed herein that are N-terminal or C-terminal of a domain disclosed herein can be referred to as flanking amino acids, and the sum of all amino acids present in a mini-nucleosome not present in any domain disclosed herein can be referred to as the non-domain amino acids.
(101) In various embodiments, non-domain amino acids of a mini-nucleosome core protein can have a sequence that contributes to the charge of the mini-nucleosome core protein. In various embodiments, non-domain amino acids of a mini-nucleosome core protein include at least 10% positively charged amino acids, e.g., at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% positively charged amino acids.
(102) In some embodiments, at pH7, a mini-nucleosome core protein may have a total positive charge in between 10 and 100.
(103) In some embodiments, a mini-nucleosome core protein can contain one or more nucleic acid binding domains placed at any location of the amino acid sequence. In some cases, the mini-nucleosome core protein may contain only the nucleic acid binding domains. In some cases, the mini-nucleosome core protein may contain on the nucleic acid binding domains and the poly-Arginine domains. In some cases, the mini-nucleosome core protein may contain on the nucleic acid binding domains and the targeting domains. In some cases, the mini-nucleosome core protein may contain only the poly-Arginine domains and the targeting domains. In some cases, the mini-nucleosome core protein may contain only the poly-Arginine domains, nucleic acid release domains and the targeting domains.
(104) In some embodiments, a mini-nucleosome core protein may contain one or more poly-Arginines placed at any location of the amino acid sequence. The poly-Arginine sequence may contain 4-30 Arginines.
(105) In some embodiments, a mini-nucleosome core protein may contain one or more targeting domains The targeting domain may be placed at any location in the amino acid sequence of the mini-nucleosome core protein.
(106) In some embodiments, a mini-nucleosome core protein may contain one or more nucleic acid release domains. Preferably, the nucleic acid release domains are placed in the middle of the amino acid sequence of the mini-nucleosome core protein. Preferably, the nucleic acid release domains are placed after 6 amino acids from the N-terminus or before 6 amino acids from the C-terminus.
(107) In some embodiments, a mini-nucleosome core protein can contain one or more stability domains. Preferably, the stability domains are placed in the C-terminal of the amino acid sequence of the mini-nucleosome core protein. In some cases, the stability domains are placed in the N-terminal of the amino acid sequence of the mini-nucleosome core protein.
(108) In some embodiments, a mini-nucleosome core protein can include one or more oligomerization domains. In certain particular embodiments, the oligomerization domains are positioned at the C-terminus of the amino acid sequence of a mini-nucleosome core protein. In some cases, the oligomerization domain is positioned at the N-terminus of the amino acid sequence of a mini-nucleosome core protein.
(109) Thus, for the avoidance of doubt, a mini-nucleosome core protein, as set forth herein, can include (a) a nucleic acid binding domain (NABD), and (b) a targeting domain, and in some embodiments can include (a) a nucleic acid binding domain (NABD), (b) a targeting domain, and (c) a nucleic acid release domain. Those of skill in the art will appreciate from the present disclosure that a polypeptide including these components will constitute a mini-nucleosome core protein as disclosed herein, optionally subject to additional limitations set forth herein and/or including, without limitation, one or more further domains provided herein or otherwise known in the art. In some embodiments, a mini-nucleosome core protein can include a nucleic acid binding domain having at least 65% sequence identity with a nucleic acid binding domain as set forth in any of SEQ ID NOs: 1-28 (e.g., as set forth in Table 3), e.g., at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, and/or that differs from a nucleic acid binding domain as set forth in any of SEQ ID NOs: 1-28 by no more than two amino acid changes (e.g., a deletion, addition, or substitution, e.g., a conservative substitution) or no more than one amino acid changes. In some embodiments, a mini-nucleosome core protein can include a targeting domain that is a cell attachment targeting domain having at least 65% sequence identity with a cell attachment targeting domain as set forth in any of SEQ ID NOs: 29-53 (e.g., as set forth in Table 4), e.g., at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, and/or that differs from a cell attachment targeting domain as set forth in any of SEQ ID NOs: 29-53 by no more than two amino acid changes (e.g., a deletion, addition, or substitution, e.g., a conservative substitution) or no more than one amino acid changes. In some embodiments, a mini-nucleosome core protein can include a targeting domain that is a cell attachment targeting domain having at least 65% sequence identity with a cell attachment targeting domain as set forth in any of SEQ ID NOs: 54-81 (e.g., as set forth in Table 5), e.g., at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, and/or that differs from a cell attachment targeting domain as set forth in any of SEQ ID NOs: 54-81 by no more than two amino acid changes (e.g., a deletion, addition, or substitution, e.g., a conservative substitution) or no more than one amino acid changes. In some embodiments, a mini-nucleosome core protein can include a targeting domain that is an internalization targeting domain having at least 65% sequence identity with an internalization targeting domain as set forth in any of SEQ ID NOs: 82-115 (e.g., as set forth in Table 6), e.g., at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, and/or that differs from an internalization targeting domain as set forth in any of SEQ ID NOs: 82-115 by no more than two amino acid changes (e.g., a deletion, addition, or substitution, e.g., a conservative substitution) or no more than one amino acid changes. In some embodiments, a mini-nucleosome core protein can include a targeting domain that is a nucleus targeting domain having at least 65% sequence identity with a nucleus targeting domain as set forth in any of SEQ ID NOs: 116-139 (e.g., as set forth in Table 7), e.g., at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, and/or that differs from a nucleus targeting domain as set forth in any of SEQ ID NOs: 116-139 by no more than two amino acid changes (e.g., a deletion, addition, or substitution, e.g., a conservative substitution) or no more than one amino acid changes. In some embodiments, a mini-nucleosome core protein can include a targeting domain that is a cell-type specific targeting domain having at least 65% sequence identity with a cell-type specific targeting domain as set forth in any of SEQ ID NOs: 140-164 (e.g., as set forth in Table 8), e.g., at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, and/or that differs from a cell-type specific targeting domain as set forth in any of SEQ ID NOs: 140-164 by no more than two amino acid changes (e.g., a deletion, addition, or substitution, e.g., a conservative substitution) or no more than one amino acid changes. In some embodiments, a mini-nucleosome core protein can include a nucleic acid release domain having at least 65% sequence identity with a nucleic acid release domain as set forth in any of SEQ ID NOs: 165-208 (e.g., as set forth in Table 9), e.g, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, and/or that differs from a nucleic acid release domain as set forth in any of SEQ ID NOs: 165-208 by no more than two amino acid changes (e.g., a deletion, addition, or substitution, e.g., a conservative substitution) or no more than one amino acid changes. In some embodiments, a mini-nucleosome core protein can include a stability domain having at least 65% sequence identity with a stability domain as set forth in any of SEQ ID NOs: 209-219 (e.g., as set forth in Table 10), e.g., at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, and/or that differs from a stability domain as set forth in any of SEQ ID NOs: 209-219 by no more than two amino acid changes (e.g., a deletion, addition, or substitution, e.g., a conservative substitution) or no more than one amino acid changes. In some embodiments, a mini-nucleosome core protein can include an oligomerization domain having at least 65% sequence identity with an oligomerization domain as set forth in any of SEQ ID NOs: 220-237 (e.g., as set forth in Table 11), e.g., at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, and/or that differs from an oligomerization domain as set forth in any of SEQ ID NOs: 220-237 by no more than two amino acid changes (e.g., a deletion, addition, or substitution, e.g., a conservative substitution) or no more than one amino acid changes. In some embodiments, a mini-nucleosome core protein can include a linker domain having at least 65% sequence identity with a linker domain as set forth in any of SEQ ID NOs: 238-335 (e.g., as set forth in Table 12), e.g., at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, and/or that differs from a linker domain as set forth in any of SEQ ID NOs: 238-335 by no more than two amino acid changes (e.g., a deletion, addition, or substitution, e.g., a conservative substitution) or no more than one amino acid changes.
(110) Those of skill in the art that domains of a mini-nucleosome core protein provided herein can be arranged in any order, orientation, or sequence as provided herein or as will otherwise be understood from the present disclosure by those of skill in the art. For instance, those of skill in the art will appreciate the intended use of linkers, e.g., as optional sequences that can be included individually or in a tandem plurality between any pair of domains or adjacent to any domain, with or without one or more intervening amino acids not specifically disclosed herein. Thus, for example, a NABD can be C-terminal or N-terminal of a targeting domain. Additional domains provided herein, including without limitation additional NABDs or additional targeting domains, can be C-terminal or N-terminal of NABD and C-terminal or N-terminal of a targeting domain. Moreover, for each domain present in mini-nucleosome core protein, including a linker, one or more linker domains can be included C-terminal of the domain or N-terminal of the domain. Exemplary mini-nucleosome proteins are provided herein. As will be readily apparent to those of skill in the art from the present disclosure, domains provided herein are modular and can be included with their intended function in any order and/or thereby provide the mini-nucleosome with the intended utility or functionality regardless of the order in which they are present.
(111) Those of skill in the art will further appreciate that mini-nucleosome core proteins of the present disclosure can include any number or type of modifications (e.g., posttranslational modifications) known in the art. Such modifications include, without limitation, pegylation, acetylation, methylation, glycosylation, phosphorylation, sumoylation, amidation, lipidation, and/or methylation. In various embodiments, a mini-nucleosome core protein can be pegylated.
(112) In some embodiments, a mini-nucleosome core protein is modified by association of the mini-nucleosome core protein with polyethylene glycol (PEG). PEG are nonionic, nontoxic, biocompatible and highly hydrophilic polymers. PEG is mostly used for the covalent modification of biological macromolecules and surfaces. PEG conjugation increases the apparent size of the polypeptide, thus reducing the renal filtration and altering biodistribution. PEGylation of peptides can enhance therapeutic properties due to their increased solubility (for hydrophobic peptides), prolonged half-life through reduced renal clearance, and masked antigenicity for minimum immune response in the host. PEGs of varying PEG chain lengths have been used in FDA cleared drugs with molecular weights ranging from 5-40 kDa. In
(113) Many current particles use PEG of size 10 kDa or larger, however, a drawback to using larger PEG size is that it also increases particle size. (Feuz L. et al. 2007). The present disclosure provides, among other things, particles with varying PEG length to formulate mini-nucleosomes with varying size-preferably smaller than 20 m in diameter. In
(114) In some embodiments, a mini-nucleosome core protein can have a total molecular weight between 1700 g/mol and 20000 g/mol, e.g., 1700, 1800, 1900, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10000, 10500, 11000, 11500, or 20000 g/mol. In various embodiments, a mini-nucleosome core protein can have a total molecular weight between 100Kda and 10,000 kDa, e.g, 100, 200, 500, 1000, 2,000, 3000, 5000, 8000, and 10000 kDa.
(115) The amino acid sequence may be used in reverse or in any order. One may also contemplate changing one or non-essential amino acid in the domain to obtain same charge or other properties of the domain. For the avoidance of doubt, any mini-nucleosome core protein provided herein, including the exemplary mini-nucleosome core proteins provided in Table 13 below, can be modified at any amino acid and/or with any of one or more of the modifications provided herein.
(116) TABLE-US-00013 TABLE13 SEQ Net Number Molecular Exemplary ID charge of weight Iso-electric Mini-nucleosomecoreproteinsequences NO. atpH7 residues (g/mol) point(pH) KRHRKLREKRHRKLRRRRRLKRHRKKRHRKLREK 336 22.4 34 4773.77 12.72 KRHRKGSSLREKRHRKLRRRRRLKRHRKKRHRKLR 337 22.4 40 5206.16 12.72 EGGSK KRHRKREGSSLREKRHRKNDLRRRRRLKRHRKKRH 338 21.4 44 5720.65 12.46 RKLREGGSK KKPKKREGSSLREKRHRKNDLRRRRRLKRHRKKRH 339 21.3 44 5624.6 12.38 RKLREGGSK RRLARRGSSLREKRHRKLRRRRRLKKPKKKRHRKLR 340 22.2 41 5213.23 12.72 EGGSK KRHRKLREKRHRKLREKRHRKLKRHRKKRHRKLRE 341 21.5 36 4984 12.48 K KRHRKRILREKRHRKLREARKRHRKLKRHRKKRHR 342 23.5 40 5480.61 12.56 KLREK KRHRKKGKKKKGEKGKKKLKGKKKLRRRRRRRQR 343 25.1 35 4507.55 12.78 R KRHRKAPAPKGKKKKGEKGKKKLKGKKKLKPKPRR 344 27.1 43 5294.51 12.79 RRRRRQRR KRHRKGGSGGKGKKKKGEKGKKKLKGKKKLARRR 345 25.1 41 4893.91 12.78 RRRRQRR KRHRKLREKRHRKRRRRRRRKRHRKLREKRRQRR 346 24.3 34 4906.85 12.84 KRHRKKRHRKKRVKKKRHRKRRRRRRDSLL 347 21.3 30 4141.02 12.86 KRHRKKRHRKYQKRVKKKRHRKSSSRRRRRRDSLL 348 21.3 35 4693.55 12.64 KRHRKKKEEEKKEEEKKEEEKRRRRRRRQRRR 349 12.1 32 4473.09 11.61 KRHRKWRKKEEEKKEEEKKEEEKRIRRRRRRRQRRR 350 14.1 36 5084.83 11.79 KRHRKRGDKRHRKRRRRRKRHRKTPHKKK 351 20.4 29 3964.72 12.82 KRHRKFIRGDKRHRKRRRRRKRHRKLATPHKKK 352 20.4 33 4409.28 12.82 KRHRKRGDKRHRKRRRRRKRHRKGSSRNTPHQKKK 353 22.4 36 4722.51 12.86 K KRHRKRGDKRHRKLKRHRKRRRRKRHRKTPHKK 354 22.5 33 4499.37 12.86 KRHRKRGDKRHRKKRHRKKRHRKRGDKKTK 355 19.4 30 3983.71 12.5 KRHRKRGDKKRKKKKRGDKKRRRRRKKKPPSY 356 21.1 32 4172.01 12.33 KRHRKRKRKRKRRRRRKKKRASSLNIAKRRRR 357 24.1 32 4308.23 13.26 KRKKRKGKRLKRRREKRHRKRASSLNIAKKKK 358 20.1 32 4054.95 12.68 KRKKRRLKRKRKRRRRREKRHRKRRRQRRRKK 359 27.1 32 4618.63 13.01 KRKKRRKRKRRRRRKRHRKLRERKRRLREKK 360 24.1 31 4420.4 12.75 KRKNGRKRKRKKRHRKKKKRRRRKRHRKNGRKKK 361 28.2 34 4587.61 13.2 KRHRKWRHRARSKRHRKKKKKKRKKRKGK 362 22.3 29 3902.77 13.03 KRHRKRGDKRHRKKKKNRRKKRALRKKRKGK 363 22.2 31 4047.92 12.73 KKRKRGGKTKKKAKKALKKKKKGKKKKRRRRKKA 364 28 38 4541.77 12.87 APKK KKKAYPKALKKPKKKKKAYPKALKRRRRRKNRRK 365 29.1 43 5481.83 12.53 KRALKRHRK KTRSKKKKKRGDKKKKNRRKKRALNTQIHKKKKKA 366 23.1 39 4725.78 12.4 APKK KGKKKKGEKGKKKLKGKKKLRRRRRSPKKRRQRR 367 23 34 4242.23 12.68 KRHRKLREKRHRKLRRRRRLKRHRKKRHRKLREK 368 22.4 34 4773.77 12.72 KRHRKLREKRHRKLREKRHRKLKRHRKKRHRKLRE 369 21.5 36 4984 12.48 K KRHRKKGKKKKGEKGKKKLKGKKKLRRRRRRRQR 370 25.1 35 4507.55 12.78 R KRHRKLREKRHRKRRRRRRRKRHRKLREKRRQRR 371 24.3 34 4906.85 12.84 KRHRKKRHRKKRVKKKRHRKRRRRRRDSLL 372 21.3 30 4141.02 12.86 KRHRKKKEEEKKEEEKKEEEKRRRRRRRQRRR 373 12.1 32 4473.09 11.61 KRHRKQSKKEEEKKEEEKKEEEKNQRRRRRRRQRR 374 12.1 36 4930.53 11.61 R KRHRKRGDKRHRKRRRRRKRHRKTPHKKK 375 20.4 29 3964.72 12.82 KRHRKRGDKRHRKLKRHRKRRRRKRHRKTPHKK 376 22.5 33 4499.37 12.86 KRHRKRGDKRHRKKRHRKKRHRKRGDKKTK 377 19.4 30 3983.71 12.5 KRHRKRGDKKRKKKKRGDKKRRRRRKKKPPSY 378 21.1 32 4172.01 12.33 KRHRKGGSRGDKKRKKKKRGDSSSKKRRRRRKKKP 379 21.1 38 4634.43 12.33 PSY KRHRKRKRKRKRRRRRKKKRASSLNIAKRRRR 380 24.1 32 4308.23 13.26 KRKKRKGKRLKRRREKRHRKRASSLNIAKKKK 381 20.1 32 4054.95 12.68 KRKKRRLKRKRKRRRRREKRHRKRRRQRRRKK 382 27.1 32 4618.63 13.01 KRKKRRKRKRRRRRKRHRKLRERKRRLREKK 383 24.1 31 4420.4 pH12.75 KRKNGRKRKRKKRHRKKKKRRRRKRHRKNGRKKK 384 28.2 34 4587.61 13.2 KRKWRNGRKRKRQKRHRKKKKRARRRRKRHRKNG 385 30.3 40 5422.54 13.26 RKHKKK KRHRKWRHRARSKRHRKKKPKKRKKRKGK 386 21.3 29 3871.71 13.03 KRHRKPKPRIWRHRARSRDKRHRKKKPKKRKKRKG 387 23.3 36 4734.73 12,78 K KKKRKLRGDLKRKGSSYQPLAPAPKKKRKRGDKRK 388 16.0 41 4894.87 11.77 LFYQPL
(117) For the avoidance of doubt, the present disclosure includes modified mini-nucleosome core proteins, including without limitation a mini-nucleosome core protein of the present disclosure in which at least one amino acid of the mini-nucleosome core protein includes a modification disclosed herein.
(118) Modified Mini-Nucleosome Core Proteins
(119) The present disclosure provides, among other things, mini-nucleosome core proteins that include at least one modified amino acid residue. Various modifications and certain advantageous thereof are provided throughout the present disclosure. For the avoidance of doubt, the present disclosure provides that any and/or all residues of any and/or all domains, mini-nucleosome core proteins, or other polypeptides provided herein, and/or any and all residues of any portion(s) thereof, can be modified in accordance with the present disclosure of modifications. Moreover, various advantages resulting from any such amino acid modification as disclosed herein do not depend upon the specific residue within a domain, mini-nucleosome core protein, or other polypeptide that is modified, and/or the position thereof within a domain, mini-nucleosome core protein, or other polypeptide. In various embodiments, various advantages resulting from any such amino acid modification as disclosed herein are realized upon inclusion of the modification at any of one or more residues of a domain, mini-nucleosome core protein, or other polypeptide in accordance with the present disclosure.
(120) In various embodiments, a modification of an amino acid present in a domain, mini-nucleosome core protein, or other polypeptide can be any of: (i) phosphorylation; (ii) sulfation; (iii) glycosylation (e.g., N-glycosylation, C-glycosylation, and/or O-glycosylation); (iv) prenylation (e;g., geranylation and/or farnesylation); (v) methylation; (vi) sialylation; (vii) lipidation and/or lipoylation; (viii) acetylation; (ix) hydroxylation; (x) palmitoylation; (xi) mannosylation; (xii) myristoylation; (xiii) fucosylation; (xiv) pegylation; and/or (xv) any combination thereof, including any number of one or more of the modifications or variants thereof, e.g., in a branched or unbranched modification chain.
(121) Examples of modifications and modified mini-nucleosome core proteins are found, e.g., in
(122) Phosphorylated Mini-Nucleosome Core Proteins
(123) Phosphorylation typically occurs on serine, threonine, tyrosine, and/or histidine residues (S, Y, T, and/or H; see, e.g.,
(124) In various embodiments, phosphorylation of one more residues of a modified mini-nucleosome core protein increases the stability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the phosphorylation modifications. In various embodiments, phosphorylation of one more residues of a modified mini-nucleosome core protein increases the half-life and/or bioavailability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the phosphorylation modifications. In various embodiments, phosphorylation of one more residues of a modified mini-nucleosome core protein increases the affinity or avidity with a target cell or other binding partner of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the phosphorylation modifications. In various embodiments, phosphorylation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, enters one or more target cells (i.e., crosses the cell membranes of target cells) as compared to a reference mini-nucleosome core protein that does not include one or more of the phosphorylation modifications. In various embodiments, phosphorylation of one more residues of a modified mini-nucleosome core protein increases the affinity or avidity of the mini-nucleosome core protein with one or more nucleic acid cargos as compared to a reference mini-nucleosome core protein that does not include one or more of the phosphorylation modifications. Thus, in some embodiments, phosphorylation of one more residues of a modified mini-nucleosome core protein increases delivery of a mini-nucleosome core protein, loaded mini-nucleosome core protein, or nucleic acid cargo of a mini-nucleosome core protein to a target cell, tissue, or organ.
(125) In certain particular embodiments of the present disclosure, phosphorylation of one more residues of a modified mini-nucleosome core protein decreases accumulation in liver of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the phosphorylation modifications. This is particularly advantageous in view of the empirical observation that most molecules and drug products, including adeno-associated viruses injected intravenously, accumulate in liver cells. Thus, phosphorylated mini-nucleosome core proteins of the present disclosure advantageously provide a means of nucleic acid delivery that reduces accumulation in liver of mini-nucleosome core proteins and/or loaded mini-nucleosome core proteins.
(126) In certain particular embodiments of the present disclosure, targeting of a phosphorylated mini-nucleosome core protein, or loaded mini-nucleosome core protein including the same, to a target, target cell, or target tissue, e.g., by inclusion in the mini-nucleosome core protein of a targeting domain as provided herein, is increased in affinity, avidity, or rate as compared to a reference mini-nucleosome core protein that does not include one or more of the phosphorylation modifications. For example, phosphorylated mini-nucleosome core proteins, and loaded mini-nucleosome core proteins including the same, that are targeted to neurons, e.g., by inclusion of targeting domain for neuronal targeting, can deliver nucleic acid cargos to neurons with increased affinity, avidity, or rate as compared to a reference mini-nucleosome core protein that does not include one or more of the phosphorylation modifications.
(127) Exemplary domains that can be included in mini-nucleosome core proteins, and which can optionally be modified by phosphorylation at one more residues, are provided in below Tables 14-16.
(128) Table 14 includes exemplary targeting domains that target neurons, and which target neurons with greater affinity, avidity, or rate when phosphorylated at one or more underlined serine, threonine, and/or tyrosine residues.
(129) Table 15 includes exemplary targeting domains that target muscle cells, and which target muscle cells with greater affinity, avidity, or rate when phosphorylated at one or more underlined serine, threonine, and/or tyrosine residues.
(130) Table 16 includes exemplary targeting domains that target endothelial cells, and which target endothelial cells with greater affinity, avidity, or rate when phosphorylated at one or more underlined serine, threonine, and/or tyrosine residues.
(131) TABLE-US-00014 TABLE14 Exemplarymini-nucleosomecore SEQID proteindomain NO. KKRHRKYPKKSRRSRLRNFRGDYNQYTRRRRR 397 KRKKRHRKRIRGRDVKYSYARKRHRKFQKWNYK 398 KKRHRKARRVTALREGRRHRKGERRRRRPPSY 399 KKRHRKALGSSDSLLARKRHRKKRKRKKRHRK 400 KKRHRKGSSKKRPKPRKKRHRKKRHRKKRHRKLL 401 KKRHRKRIQRRSRRGSSKHKGRDVILKKDVRKRHRK 402 KKRHRKKKDGKKRKRLLRKKHARALYIGSRKRGRKP 403 KKRHRKPPKDGEAQPKRHRKRRRRRKRHRKLRA 404 KKRKKRHRKLARGPRVARKRHRKRRRRRDRYQRL 405
(132) TABLE-US-00015 TABLE15 Exemplarymini-nucleosomecore SEQID proteindomain NO. KKRHRKRGFRRVSRRRGKKKEQRRERNARGKKGKRHRK 406 KKRHRKRRQPPRSISSHPLRKKRKGKTRRLRGDLRNSRR 407 KKRHRKRLRKKRKGKGSRPGSGFVKKTKQRRRRR 408 KKRHRKHRTKSGRSRIRKKRKGKRHARKKRRQRRRPPSY 409 KKRHRKKPVNRWSARNRRKKRALLRRRHYQRL 410 KKRHRKRKYKQCHKKGGHCFPKEKARRKKRKGKNEI 411 KKRHRKRIKKYRYYLKPLKKKRKKRKGKRHYLIIR 412 KKRHRKDRGRKKRRQRRRPQKPRKKRRQRRFQQI 413 KKRHRKGSSDPFRDDPFHRKRHRKKRHRKKRHRGRR 414 KKRHRKARSKTFNTHPQSTPYKRHRKRKKRKGKKRPK 415 RKKRKGKRAKRHRKKRHRKKPKNMTPYRSPPPYVPP 416
(133) TABLE-US-00016 TABLE16 Exemplarymini-nucleosomecore SEQID proteindomain NO. KKKRKRGDKRKRKRHRKKKRRRRLSIPPKA 417 KKKRKRGDKRKRKRHRKKKRRRRFQTPPQL 418 KKKRKRGDKRKRKRHRKKKRRRRLTPATAI 419 KKKRKRGDKRKRKRHRKKKRRRRSIGYPLP 420 KKKRKRGDKRKRKRHRKKKRRRRCLIRRTSIC 421 KKKRKRGDKRKRKRHRKKKRRRRCFFWKFRWMC 422
Sulfated Mini-Nucleosome Core Proteins
(134) Sulfation refers to the covalent linkage of sulfate to a tyrosine (Y) residue (see, e.g.,
(135) In various embodiments, sulfation of one more residues of a modified mini-nucleosome core protein increases affinity or avidity with a target cell or other binding partner of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the sulfation modifications. In various embodiments, sulfation of one more residues of a modified mini-nucleosome core protein increases affinity or avidity of binding with a target receptor of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the sulfation modifications. Thus, in some embodiments, sulfation of one more residues of a modified mini-nucleosome core protein increases delivery of a mini-nucleosome core protein, loaded mini-nucleosome core protein, or nucleic acid cargo of a mini-nucleosome core protein to a target cell, tissue, or organ.
(136) In various embodiments, sulfation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, enters one or more target cells (i.e., crosses the cell membranes of target cells) as compared to a reference mini-nucleosome core protein that does not include one or more of the sulfation modifications.
(137) In various embodiments, sulfation of one more residues of a modified mini-nucleosome core protein increases blood-brain barrier penetration by the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the sulfation modifications.
(138) In various embodiments, sulfation of one more residues of a modified mini-nucleosome core protein increases selectivity of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, for target receptors, and/or selectivity of internalization after receptor binding, as compared to a reference mini-nucleosome core protein that does not include one or more of the sulfation modifications.
(139) Table 17 includes exemplary sulfated domains for inclusion in mini-nucleosome core proteins that enhance binding to endothelial cell surface markers and/or increase update of mini-nucleosome core proteins and/or loaded mini-nucleosome core proteins by endothelial cells.
(140) TABLE-US-00017 TABLE17 Exemplarymini-nucleosomecore SEQID proteindomain NO. KKKRKRGDKRKRKRHRKKKRRRREYYLSIPPKA 423 KKKRKRGDKRKRKRHRKKKRRRDYRFQTPPQL 424 KKKRKRGDKRKRKRHRKKKRRRHYRLTPATAI 425 KKKRKRGDKRKRKRHRKKKRRRRVYQSIGYPLP 426 KKKRKSYRRGDKRKRKRHRKKKRRRRCLIRRTSIC 427 KKKRKEYRGDKRKRKRHRKKKRRRRCFFWKFRWMC 428
Glycosylated Mini-Nucleosome Core Proteins
(141) Glycosylation includes, among other things, N-glycosylation, O-glycosylation, and C-glycosylation. N glycosylation, refers to covalent linkage of a glycan to a nitrogen atom of a side chain of an amino acid, typically the amide nitrogen of an asparagine (N) residue. Examples of N glycosylation include GlcNAc--Asn, GlcNac--Asn, and Glc-Asn. O-glycosylation refers to covalent linkage of a glycan to an oxygen atom of a hydroxyl side chain of an amino acid, typically an oxygen atom of a hydroxyl side chain of a serine(S) or threonine (T) residue. Examples of O-glycosylation include GlcNac--Ser/Thr and GalNac--Ser/Thr. C-glycosylation refers to covalent linkage of mannose to a carbon atom of a side chain of an amino acid, typically a carbon atom of a tryptophan (W) residue. An example of C-glycosylation is -mannosyl tryptophan. Accordingly, in various embodiments, glycosylation can refer to one or more modifications, each of which modifications can be any of N-glycosylation, C-glycosylation, or O-glycosylation. Known functions of glycosylation modifications include contributions to protein folding and cell signaling. In general, glycosylation is also known to improve protein stability and serve as an epitope for association with binding partners.
(142) In various embodiments, glycosylation of one more residues of a modified mini-nucleosome core protein increases the stability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the glycosylation modifications. In some embodiments, glycosylation increases stability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, in that physical properties of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, including protein structure and protein charge, are maintained and/or maintained for a longer period of time, e.g., after administration to a subject. In some embodiments, glycosylation decreases the occurrence or rate of thermal and/or kinetic denaturation of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the glycosylation modifications.
(143) In various embodiments, glycosylation of one more residues of a modified mini-nucleosome core protein increases half-life and/or bioavailability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the glycosylation modifications.
(144) In various embodiments, glycosylation of one more residues of a modified mini-nucleosome core protein increases affinity or avidity with a target cell or other binding partner of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the glycosylation modifications. In various embodiments, glycosylation of one more residues of a modified mini-nucleosome core protein increases affinity or avidity of binding with a target receptor of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the glycosylation modifications. Thus, in some embodiments, glycosylation of one more residues of a modified mini-nucleosome core protein increases delivery of a mini-nucleosome core protein, loaded mini-nucleosome core protein, or nucleic acid cargo of a mini-nucleosome core protein to a target cell, tissue, or organ.
(145) In various embodiments, glycosylation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, enters one or more target cells (i.e., crosses the cell membranes of target cells) as compared to a reference mini-nucleosome core protein that does not include one or more of the glycosylation modifications.
(146) In various embodiments, glycosylation of one more residues of a modified mini-nucleosome core protein decreases precipitation and/or aggregation of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the glycosylation modifications.
(147) Table 18 includes exemplary glycosylated domains, in particular galactose-modified targeting domains that target mini-nucleosome core proteins to liver.
(148) TABLE-US-00018 TABLE18 Exemplarymini-nucleosomecore SEQID proteindomain NO. KKRHRKARARKKAAKARIKKAAPAKKAANRARKKH 429 KKRHRKGSSRRPRPGTGPGRRPRPRPRPRKKRNRSRQRRR 430 KKRHRKKYKQKIKHVVKLKKHRKRKRNRSIKVAV 431 KKRHRKSSSRTLQAHHDRQSNKRKRKNRSRRRRR 432 KKRHRKRNRSIHFNPRHRRRRRRDVARARAEKSKKK 433 KKRHRKNRSKKQRFRHRNRKGYRSQRGHSRGRNQNSRR 434
Prenylated Mini-Nucleosome Core Proteins
(149) Prenylation typically occurs on cysteine residues (see, e.g.,
(150) In various embodiments, prenylation of one more residues of a modified mini-nucleosome core protein increases affinity or avidity with a target cell or other binding partner of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the prenylation modifications. In various embodiments, prenylation of one more residues of a modified mini-nucleosome core protein increases affinity or avidity of binding with a target receptor of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the prenylation modifications. Thus, in some embodiments, prenylation of one more residues of a modified mini-nucleosome core protein increases delivery of a mini-nucleosome core protein, loaded mini-nucleosome core protein, or nucleic acid cargo of a mini-nucleosome core protein to a target cell, tissue, or organ.
(151) In various embodiments, prenylation of one more residues of a modified mini-nucleosome core protein increases strength (e.g., affinity or avidity) of association with cell membranes of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the prenylation modifications. In various embodiments, prenylation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, penetrates cell membranes as compared to a reference mini-nucleosome core protein that does not include one or more of the prenylation modifications. In various embodiments, prenylation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, enters one or more target cells (i.e., crosses the cell membranes of target cells) as compared to a reference mini-nucleosome core protein that does not include one or more of the prenylation modifications.
(152) In various embodiments, prenylation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, home to target subcellular localization as compared to a reference mini-nucleosome core protein that does not include one or more of the prenylation modifications.
(153) Table 19 includes exemplary prenylated domains, in particular prenylated targeting domains that target mini-nucleosome core proteins to liver cells and other cell types.
(154) TABLE-US-00019 TABLE19 Exemplarymini-nucleosomecore SEQID proteindomain NO. KKRHRKARARKKAAKARIKKAAPAKKAARACIILRKKH 435 KKRHRKGSSRRPRPGTGPGRRPRPRPRPRKKRCASERQ 436 RRR KKRHRKCIIEKYKQKIKHVVKLKKHRKRKRIKVAV 437 KKRHRKCQALSSSRTLQAHHDRQSNKRKRKRRRRR 438 KKRHRKRIHFNPRHRRRRRRCIAEDVARARAEKSKKK 439 KRHRKKKQRFRHRNRKGYRSQRGHSRGRNQNSRRCIILR 440
Methylated Mini-Nucleosome Core Proteins
(155) Methylation typically occurs on lysine (K) and arginine (R) residues (see, e.g.,
(156) In various embodiments, methylation of one more residues of a modified mini-nucleosome core protein increases the rate of delivery to the nuclei of target cells of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the methylation modifications. In various embodiments, methylation of one more residues of a modified mini-nucleosome core protein increases the rate of delivery to the nuclei of target cells of a nucleic acid cargo of a loaded mini-nucleosome core protein including the modified mini-nucleosome core protein, as compared to delivery of the nucleic acid cargo of a reference loaded mini-nucleosome core protein that includes a mini-nucleosome core protein that does not include one or more of the methylation modifications. In various embodiments, methylation of one more residues of a modified mini-nucleosome core protein increases expression in target cells of a coding sequence of a nucleic acid cargo of a loaded mini-nucleosome core protein including the modified mini-nucleosome core protein, as compared to expression of a coding sequence of a nucleic acid cargo of a reference loaded mini-nucleosome core protein that includes a mini-nucleosome core protein that does not include one or more of the methylation modifications.
(157) Table 20 includes exemplary methylated domains, in particular methylated targeting domains that target mini-nucleosome core proteins to cell nuclei and/or increase expression of nucleic acid cargos when included in a mini-nucleosome core protein of a loaded mini-nucleosome core protein.
(158) TABLE-US-00020 TABLE20 Exemplarymini-nucleosomecore SEQID proteindomain NO. KKRHRKARARKKAAKARIKKAAPAKKAARARKKH 441 KKRHRKGSSRRPRPGTGPGRRPRPRPRPRKKRRQ 442 RRR KKRHRKKYKQKIKHVVKLKKHRKRKRIKVAV 443 KKRHRKSSSRTLQAHHDRQSNKRKRKRRRRR 444 KKRHRKRIHFNPRHRRRRRRDVARARAEKSKKK 445 KRHRKKKQRFRHRNRKGYRSQRGHSRGRNQNSRR 446
Sialylated Mini-Nucleosome Core Proteins
(159) Sialylation refers to the covalent addition of sialic acid to the terminal end of a glycoprotein oligosaccharide chain. Sialylation can occur, e.g., on asparagine (N) and serine(S) residues. Sialylation can increase endothelial cell targeting and/or blood brain barrier penetration. In some instances, endothelial cell targeting provides a means of increased blood brain barrier penetration.
(160) In various embodiments, sialylation of one more residues of a modified mini-nucleosome core protein increases blood-brain barrier penetration by the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the sialylation modifications.
(161) In various embodiments, sialylation of one more residues of a modified mini-nucleosome core protein increases strength (e.g., affinity or avidity) of association with cell membranes (e.g., endothelial cell membranes) of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the sialylation modifications. In various embodiments, sialylation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, penetrates cell membranes (e.g., endothelial cell membranes) as compared to a reference mini-nucleosome core protein that does not include one or more of the sialylation modifications. In various embodiments, sialylation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, enters one or more target cells (i.e., crosses the cell membranes of target cells), such as endothelial cells, as compared to a reference mini-nucleosome core protein that does not include one or more of the sialylation modifications.
(162) Table 21 includes exemplary sialylated domains, in particular sialylated targeting domains that increase endothelial cell targeting and/or blood brain barrier penetration when included in a mini-nucleosome core protein.
(163) TABLE-US-00021 TABLE21 Exemplarymini-nucleosomecore SEQID proteindomain NO. KKRHRKGGSLLRGEKELKRPPRRRRRKYIGSR 447 KKKRKLRGDLKRKPLISRRLIDRYQKKKRKRGDKRK 448 KKKRKLRGDLKRKSSSVRKKPGGSKKKRKRGDKRK 449 KKKRKLRGDLKRKGTQPEHSSTDHKKKRKRGDKRK 450 KKKRKRGDKRKRKRHRKKKRRRRLSIPPKA 451 KKKRKRGDKRKRKRHRKKKRRRRFQTPPQL 452 KKKRKRGDKRKRKRHRKKKRRRRNRSLTPATAI 453 KKKRKRGDKRKRKRHRKKKRRRRSIGYPLP 454 KKKRKRGDKRKRKRHRKKKRRRRNRSCLIRRTSIC 455 KKKRKRGDKRKRKRHRKKKRRRRNRSCFFWKFRWMC 456 KKKRKNRSRGDKRKRKRHRKKKRRRRIELLQARGC 457 KKKRKRGDKRKRKRHRKKKNRSRRRRREDV 458 KKKRKRGDKRKRKRHRKKKRRRRVHPKQHRGGSKGC 459
Lipidated and or Lipoylated Mini-Nucleosome Core Proteins
(164) Amino acids can be covalently modified by linkage to a variety of lipids, including fatty acids, isoprenoids, and cholesterol (see, e.g.,
(165) Lipidation and/or lipoylation can contribute to polypeptide localization and function. Lipidation and/or lipoylation can improve pharmacokinetic properties of a polypeptide such as a mini-nucleosome core protein, e.g., to increase half-life in circulation. Lipidation and/or lipoylation, e.g., with long-chain fatty acids, can also increase targeting of polypeptides such as a mini-nucleosome core protein (see, e.g., Hossieni et al., 2019, demonstrating that palmitoylation can significantly improve targeting in Wnt trafficking). Linkage of a mini-nucleosome core protein to cholesterol can increase membrane anchoring and thereby increase delivery to target cells.
(166) In various embodiments, lipidation and/or lipoylation of one more residues of a modified mini-nucleosome core protein increases affinity or avidity with a target cell or other binding partner of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the lipidation and/or lipoylation modifications. In various embodiments, lipidation and/or lipoylation of one more residues of a modified mini-nucleosome core protein increases affinity or avidity of binding with a target receptor of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the lipidation and/or lipoylation modifications. Thus, in some embodiments, lipidation and/or lipoylation of one more residues of a modified mini-nucleosome core protein increases delivery of a mini-nucleosome core protein, loaded mini-nucleosome core protein, or nucleic acid cargo of a mini-nucleosome core protein to a target cell, tissue, or organ.
(167) In various embodiments, lipidation and/or lipoylation of one more residues of a modified mini-nucleosome core protein increases half-life and/or bioavailability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the lipidation and/or lipoylation modifications.
(168) Acetylated Mini-Nucleosome Core Proteins
(169) Acetylation can occur, e.g., on alanine (A), valine (V), and/or lysine (K) residues. An acetyl group can be covalently linked to an -amino group of the N-terminus of a polypeptide or to an -amino group of a lysine residue (see, e.g.,
(170) In various embodiments, acetylation of one more residues of a modified mini-nucleosome core protein increases the stability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the acetylation modifications. In some embodiments, acetylation increases stability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, in that physical properties of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, including protein structure and protein charge, are maintained and/or maintained for a longer period of time, e.g., after administration to a subject. In some embodiments, acetylation decreases the occurrence or rate of thermal and/or kinetic denaturation of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the acetylation modifications.
(171) In various embodiments, acetylation of one more residues of a modified mini-nucleosome core protein increases half-life and/or bioavailability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the acetylation modifications.
(172) Hydroxylated Mini-Nucleosome Core Proteins
(173) Hydroxylation can occur, e.g., on proline (P) and lysine (K) residues, as well as other amino acids including without limitation asparagine, aspartate and histidine (see, e.g.,
(174) In various embodiments, hydroxylation of one more residues, e.g., one or more proline residues, of a modified mini-nucleosome core protein increases the stability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the hydroxylation modifications. In some embodiments, hydroxylation of one more residues, e.g., one or more proline residues, increases stability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, in that physical properties of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, including protein structure and protein charge, are maintained and/or maintained for a longer period of time, e.g., after administration to a subject. In some embodiments, hydroxylation of one more residues, e.g., one or more proline residues, decreases the occurrence or rate of thermal and/or kinetic denaturation of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the hydroxylation modifications.
(175) In various embodiments, hydroxylation of one more residues, e.g., one or more proline residues, of a modified mini-nucleosome core protein increases half-life and/or bioavailability of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the hydroxylation modifications.
(176) Palmitoylated Mini-Nucleosome Core Proteins
(177) Palmitoylation is a lipid modification that typically occurs on cysteine I residues, and can also occur, e.g., on serine(S) and threonine (T) residues. Palmitoylation includes the covalent attachment of a fatty acid, such as palmitic acid, to a residue of a polypeptide such as a mini-nucleosome core protein. Palmitoylation can be present, e.g., on residues of membrane proteins.
(178) In various embodiments, palmitoylation of one more residues of a modified mini-nucleosome core protein increases strength (e.g., affinity or avidity) of association with cell membranes (e.g., endothelial cell membranes) of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the palmitoylation modifications. In various embodiments, palmitoylation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, penetrates cell membranes (e.g., endothelial cell membranes) as compared to a reference mini-nucleosome core protein that does not include one or more of the palmitoylation modifications. In various embodiments, palmitoylation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, enters one or more target cells (i.e., crosses the cell membranes of target cells), such as endothelial cells, as compared to a reference mini-nucleosome core protein that does not include one or more of the palmitoylation modifications.
(179) Mannosylated Mini-Nucleosome Core Proteins
(180) Mannosylation can refer to modification of an amino acid to include a mannose glycoside. Mannosylation can occur, e.g., on threonine (T) residues of a polypeptide, e.g., a mini-nucleosome core protein. To provide one particular example, mono-O-mannosyl glycans concentrate in inhibitory GABAergic neurons, and the present disclosure includes mono-O-mannosylation of mini-nucleosome core proteins to target mini-nucleosome core proteins to GABAergic neurons.
(181) Myristoylated Mini-Nucleosome Core Proteins
(182) Myristoylation is a lipid modification that includes covalent linkage of a myristoyl group with an amino acid, e.g., a residue of a polypeptide such as a mini-nucleosome core protein. Myristoylation can occur, e.g., on a glycine (G) residue of a polypeptide such as a mini-nucleosome core protein. For instance, protein N-myristoylation is a lipidic modification that can be present on the alpha-amino group of an N-terminal glycine residue. Myristoylation can contribute to cellular signaling, protein-protein interaction, and targeting of proteins to endomembrane and plasma membrane systems
(183) In various embodiments, myristoylation of one more residues of a modified mini-nucleosome core protein increases affinity or avidity with a target cell or other binding partner of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the myristoylation modifications. In various embodiments, myristoylation of one more residues of a modified mini-nucleosome core protein increases affinity or avidity of binding with a target receptor of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the myristoylation modifications. Thus, in some embodiments, myristoylation of one more residues of a modified mini-nucleosome core protein increases delivery of a mini-nucleosome core protein, loaded mini-nucleosome core protein, or nucleic acid payload of a mini-nucleosome core protein to a target cell, tissue, or organ.
(184) In various embodiments, myristoylation of one more residues of a modified mini-nucleosome core protein increases strength (e.g., affinity or avidity) of association with cell membranes (e.g., endothelial cell membranes) of the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, as compared to a reference mini-nucleosome core protein that does not include one or more of the myristoylation modifications. In various embodiments, myristoylation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, penetrates cell membranes (e.g., endothelial cell membranes) as compared to a reference mini-nucleosome core protein that does not include one or more of the myristoylation modifications. In various embodiments, myristoylation of one more residues of a modified mini-nucleosome core protein increases the rate at which the modified mini-nucleosome core protein, or loaded mini-nucleosome core proteins including the same, enters one or more target cells (i.e., crosses the cell membranes of target cells), such as endothelial cells, as compared to a reference mini-nucleosome core protein that does not include one or more of the myristoylation modifications.
(185) Fucosylated Mini-Nucleosome Core Proteins
(186) Fucosylation is a form of glycosylation that refers to the addition of fucose to an amino acid, e.g., a threonine (T) residue. Fucosylation includes attachment of a fucose residue to N-glycans, O-glycans, and glycolipids.
(187) Pegylated Mini-Nucleosome Core Proteins
(188) Pegylation (sometimes written PEGylation) includes the modification of biological molecules by covalent conjugation with polyethylene glycol (PEG), a non-toxic, non-immunogenic polymer. PEG is generally understood to be biocompatible and/or to lack immunogenicity, antigenicity, and/or toxicity. PEG is soluble in water and other organic solvents, is readily cleared from the body, and has high mobility in solution. Pegylation can impact physical and chemical properties of a polypeptide such as a mini-nucleosome core protein, including properties such as conformation, electrostatic binding, and hydrophobicity. Pegylation can cause an improvement in pharmacokinetic behavior of a polypeptide such as a mini-nucleosome core protein. Pegylation can improve drug solubility and decreases immunogenicity of a polypeptide such as a mini-nucleosome core protein. PEGylation can increases drug stability and/or retention time of a polypeptide such as a mini-nucleosome core protein in blood. Pegylation can reduce proteolysis and/or renal excretion polypeptide such as a mini-nucleosome core protein, which can reduce the therapeutically effective dose of a polypeptide such as a mini-nucleosome core protein. As those of skill in the art will appreciate, techniques for use of PEG and pegylation in combination with polypeptide agents are well known in the art. The present disclosure includes, without limitation, modified mini-nucleosome core proteins that include a pegylated amino acid alone or in combination with other modifications of the same or other amino acids of the mini-nucleosome core protein.
(189) Modified Mini-Nucleosome Core Proteins with Multiple and or Branched Modifications
(190) Those of skill in the art will appreciate that a polypeptide such as a mini-nucleosome core protein can include one or more amino acids that each include one or more modifications provided herein. Accordingly, a mini-nucleosome core protein can include a plurality of modified amino acids each including the same modification, or can include a plurality of modified amino acids of which at least two include different modifications. Moreover, as those of skill in the art will further appreciate, in some embodiments a single modified amino acid can include two or more modifications (see, e.g.,
(191) Modification chains of the present disclosure can include a plurality of modifications. In some embodiments, a modification chain includes a plurality of linearly associated modifications, which modifications are directly or indirectly covalently linked in a single linear chain. A modification chain including a single covalently linked linear chain of directly or indirectly linked modifications can be referred to as an unbranched modification chain. Modification chains of the present disclosure can be branched, e.g., where the modification chain includes a trunk that is covalently linked to an atom of the canonical core structure of an amino acid, and which trunk is covalently linked to two or more branches of covalently linked atoms, each of which branches can include one or more modifications. In such branched modification chains, the trunk and two or more branches do not form a single covalently linked linear chain. As provided herein, a trunk or unbranched modification chain can include any number of modifications provided herein, e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modifications provided herein, any of which may be the same modification as any other in the trunk or chain or a different modifications from any other in the trunk or chain. As provided herein, a branch can include any number of modifications provided herein, e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 modifications provided herein, any of which may be the same modification as any other in the branch or chain or a different modifications from any other in the branch or chain.
(192) Thus, for the avoidance of doubt, a mini-nucleosome core protein, as set forth herein, can include (a) a nucleic acid binding domain (NABD), and (b) a targeting domain, and in some embodiments can include (a) a nucleic acid binding domain (NABD), (b) a targeting domain, and (c) a nucleic acid release domain, where any of the various mini-nucleosome core proteins provided herein can optionally include one or more modified amino acid residues.
(193) Nucleic Acid Cargos
(194) Loaded mini-nucleosomes disclosed herein can be loaded with a nucleic acid cargo that is, e.g., RNA, DNA, or a nucleic acid analog thereof. A nucleic acid cargo can be single stranded or double stranded. A nucleic acid cargo can be linear or circular. A nucleic acid cargo can encode one or more of each of a protein, an RNA, an shRNA, an miRNA, an antibody, a nanobody, a Darpin, an Ankyrin repeat, or a polypeptide. For example, a nucleic acid cargo can be a cDNA molecule that encodes at least one functional protein. In various embodiments, a nucleic acid cargo can be an inhibitory RNA, e.g., a gRNA, siRNA, miRNA, or shRNA.
(195) A nucleic acid cargo can encode, e.g., an RNA, protein, polypeptide, antibody, nanobody, miRNA, shRNA, gRNA, Cas9, non-coding RNA when delivered into a nucleus of any cell. Expression may not be limited to entities mentioned herein.
(196) Loaded Mini-Nucleosomes
(197) A loaded mini-nucleosome of the present disclosure can include one or more mini-nucleosome core proteins of the present disclosure and one or more polynucleotides. Those of skill in the art will appreciate from the present disclosure that such loaded mini-nucleosomes can be generated from combining mini-nucleosome core proteins and polynucleotides in a variety of ways. Those of skill in the art will appreciate that, in at least one embodiment, loaded mini-nucleosome assembly will occur simply upon inclusion of one or more mini-nucleosome core proteins provided herein and one or more polynucleotides in a solution, e.g., without limitation, an aqueous solution, e.g., at a standard temperature and e.g., vortexing at a standard speed. Methods of generating loaded mini-nucleosome core proteins therefore include approaches provided herein and others that will be apparent to those of skill in the art. Those of skill in the art will appreciate that, in at least one embodiment, loaded mini-nucleosome assembly will occur upon inclusion of one or more mini-nucleosome core proteins provided herein and one or more polynucleotides in a solution, e.g., without limitation, an aqueous solution, e.g., at a standard temperature in the presence of catalysts that help enhance condensation of nucleic acids.
(198) A loaded mini-nucleosome of the present disclosure can be at an uncondensed state and a condensed state. A loaded mini-nucleosome is in a condensed state where at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% of negative charges in the nucleic acid molecule has been neutralized. A loaded mini-nucleosome is considered in an uncondensed state when less than 90% of negative charges in the nucleic acid molecule has been neutralized. Unless specified, references to mini-nucleosomes in the present disclosure encompass at least condensed and uncondensed states and, where applicable, characteristics thereof.
(199) A mini-nucleosome can include, e.g., 1 to 10,000 mini-nucleosome core proteins. A mini-nucleosome can include, e.g., 1 to 100 nucleic acid cargo molecules.
(200) In some embodiments, loaded mini-nucleosome can be of size between 0.5 to 50 nanometers in diameter. Mini-nucleosomes can include nucleic acid cargo molecules that can have a length of up to 50 kb while maintaining a small diameter of between 0.5 and 50 nm.
(201) In some embodiments, loaded mini-nucleosome can have a molecular weight of between 100 and 10000 kDa, e.g., 100, 200, 500, 1000, 3000, 5,000, 8000, 10000 kDa.
(202) In various embodiments, loaded mini-nucleosome can have a net charge of 100 to 100. In some embodiments, the zeta potential of the loaded mini-nucleosome formulation may range from 10 milliVolts to 100 millivolts. In some examples, a complex of nucleic acid cargo and mini-nucleosome core protein is condensed to a minimal size compared to the nucleic acid molecule and polypeptide molecules used to construct the mini-nucleosome particle. The final positive to negative charge ratio is approximately 1:1, thereby forming a non-charged, slightly positively charged or slightly negatively charged molecule. The final particle may form in several shapes including rod, spherical or circular but not limited to these.
(203) In various embodiments, the mini-nucleosome core protein may be modified with one or more molecules of polyethylene glycol of molecular weight of 5 Daltons to 20 kDa A polyethylene glycol (PEG) moiety maybe attached to any amino acid residue in the polypeptide.
(204) In certain embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1:1 and 1:2,000 or between 1:3 and 1:2,000. In certain embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1:1 and 1:2,000. In certain embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1:1 and 1:1,000, between 1:1 and 1.500, between 1:1 and 1:200, between 1:1 and 1:100, between 1:1 and 1:50. In certain embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1:3 and 1:1,000, between 1:3 and 1:500, between 1:3 and 1:200, between 1:3 and 1:100, or between 1:3 and 1:50. In certain embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1:200 and 1:2,000, between 1:200 and 1.1000, or between 1:200 and 1.500. In certain embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1:1 and 1:50, 1:1 and 1:40, 1:1 and 1:30, 1:1 and 1:20, 1:1 and 1:10, 1:1 and 1:5, 1:1 and 1:4, 1:1 and 1:3, or]: 1 and 1:2.
(205) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 3 mini-nucleosome core proteins (1:3) and 1 nucleic acid molecule to 3,000 mini-nucleosome core proteins (1:3,000), or within any range there between.
(206) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 3 mini-nucleosome core proteins (1:3) and 1 nucleic acid molecule to 2,000 mini-nucleosome core proteins (1:2,000).
(207) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 3 mini-nucleosome core proteins (1:3) and 1 nucleic acid molecule to 1,000 mini-nucleosome core proteins (1:1,000).
(208) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 3 mini-nucleosome core proteins (1:3) and 1 nucleic acid molecule to 500 mini-nucleosome core proteins (1:500)
(209) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 3 mini-nucleosome core proteins (1:3) and 1 nucleic acid molecule to 200 mini-nucleosome core proteins (1:200).
(210) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 3 mini-nucleosome core proteins (1:3) and 1 nucleic acid molecule to 100 mini-nucleosome core proteins (1:100).
(211) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 3 mini-nucleosome core proteins (1:3) and 1 nucleic acid molecule to 50 mini-nucleosome core proteins (1:50).
(212) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 50 mini-nucleosome core proteins (1:50) and 1 nucleic acid molecule to 2,000 mini-nucleosome core proteins (1:2,000).
(213) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 50 mini-nucleosome core proteins (1:50) and] nucleic acid molecule to 1,000 mini-nucleosome core proteins (1:1,000).
(214) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 50 mini-nucleosome core proteins (1:50) and 1 nucleic acid molecule to 500 mini-nucleosome core proteins (1:500).
(215) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 50 mini-nucleosome core proteins (1:50) and 1 nucleic acid molecule to 200 mini-nucleosome core proteins (1:200).
(216) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 50 mini-nucleosome core proteins (1:50) and 1 nucleic acid molecule to 100 mini-nucleosome core proteins (1:100).
(217) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 200 mini-nucleosome core proteins (1:200) and 1 nucleic acid molecule to 2,000 mini-nucleosome core proteins (1:2,000).
(218) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 200 mini-nucleosome core proteins (1:200) and 1 nucleic acid molecule to 1,000 mini-nucleosome core proteins (1:1,000).
(219) In various embodiments, a loaded mini-nucleosome includes a ratio of nucleic acid molecules to mini-nucleosome core proteins that is between 1 nucleic acid molecule to 200 mini-nucleosome core proteins (1:200) and 1 nucleic acid molecule to 500 mini-nucleosome core proteins (1:500)
(220) The skilled artisan will appreciate that mini-nucleosome core protein molecules can be produced and/or constituted by various means, including without limitation in several different salt conditions including acetate, trifluoroacetate, bicarbonate, and chloride. Final formulation of the loaded mini-nucleosome may be constituted in normal saline, water or any other pharmaceutically acceptable buffers.
(221) Delivery of Loaded Mini-Nucleosomes to Target Cells or Tissues
(222) In certain embodiments, a mini-nucleosome can deliver a nucleic acid where the target cell is the retinal pigment epithelium (RPE). For efficient gene therapy, some embodiments include delivery of a large copy number of genetic cargo such as DNA or RNA into one cell type. For example, in wet-age-related macular degeneration, expressing anti-VEGF in the RPE may provide therapeutic levels of proteins necessary for inhibiting endothelial cell proliferation and vascular leakage. We provide herein, examples of mini-nucleosomes core proteins (SEQ ID NO. 392) that allow enhanced uptake into the RPE (
(223) In certain embodiments, a mini-nucleosome can deliver a nucleic acid where the target cell is a neuron in the retina. It has been described that amino acid domain LRE (SEQ ID NO. 156) could be used for enhanced neuronal attachment (Dale D, et al, 1989). We have made use of such domain in a non-viral vector using a GFP construct (SEQ ID NO. 395) with mini-nucleosome core protein (SEQ ID NO. 394) to express GFP to target neuronal cells in the retina (
(224) In various embodiments, a mini-nucleosome can deliver a nucleic acid where the target cell is for e.g. a muscle cell, a liver cell, an endothelial cell, hematopoietic stem cell, lung epithelial, cell, a pericyte, a beta cell, gut epithelial cell, a microglial cell, a macrophage cell, a neuronal cell, skin cell, a blood cell, etc. but not limited to these. Various combination of domains described herein (Table 3-12), may allow delivery of loaded mini-nucleosomes to certain target cell type for therapeutic effects in other parts of the body including brain, retina, gut, liver, lung, kidney, muscle, pancreas but not limited to it.
(225) Pharmaceutical Compositions
(226) The present disclosure contemplates a loaded mini-nucleosome therapeutic that includes a loaded mini-nucleosome and at least one pharmaceutically acceptable carrier. Formulations of pharmaceutically acceptable carrier solutions are well-known to those skilled in the art, as is the development of suitable dosing and treatment regimens. Typically, these formulations can contain 102 genome copies or more of desired transgenes. Other factors such as solubility, bioavailability, half-life, shelf-life will be contemplated by one skilled in the art. As such, various doses and treatment regiments may be desirable. Loaded mini-nucleosome therapeutic could be used to deliver nucleotides to variety of cell types, tissue types or organs in a human body including retina, liver, CNS, gut etc. but not limited to it.
(227) A loaded mini-nucleosome therapeutic can be formulated such that it is pharmaceutically acceptable for administration to cells or animals. Loaded mini-nucleosome therapeutic may be administered in vitro, ex vivo or in vivo. A loaded mini-nucleosome therapeutic can be administered to a subject either alone or in combination with one or more other therapeutic modalities, e.g., antibodies, steroids, vitamins, AAVs etc.
(228) In certain instances, a loaded mini-nucleosome therapeutic can include one or more nucleic acid cargos that each or together encode one or more distinct expression products.
(229) In certain circumstances, it will be desirable to deliver the loaded mini-nucleosome formulations in suitably formulated pharmaceutical compositions disclosed herein either by subcutaneous, intraocular, intravitreal, parenteral, intravenous, intramuscular, intrathecal, topical, oral, intraperitoneal injections, or by nasal inhalation but not limited to these techniques. Solutions of the loaded mini-nucleosome formulations may be prepared in sterile water, sterile saline and may also suitably mixed with one or more surfactants, such as pluronic acid. Dispersions may also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof. Storage preparations may contain preservatives to prevent microorganisms from growing.
(230) A suitable means of administration of a loaded mini-nucleosome therapeutic agent can be selected based on the condition or disease to be treated and upon the age and condition of a subject. Dose and method of administration can vary depending on the weight, age, condition, and the like of a patient, and can be suitably selected as needed by those skilled in the art.
(231) In various instances, a loaded mini-nucleosome therapeutic agent composition can be formulated to include a pharmaceutically acceptable carrier or excipient. Examples of pharmaceutically acceptable carriers include, without limitation, any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Compositions of the present invention can include a pharmaceutically acceptable salt, e.g., an acid addition salt or a base addition salt.
(232) In various embodiments, a composition including a loaded mini-nucleosome therapeutic agent as described herein, e.g., a sterile formulation for injection, can be formulated in accordance with conventional pharmaceutical practices using distilled water for injection as a vehicle. For example, physiological saline or an isotonic solution containing glucose and other supplements such as D-sorbitol, D-mannose, D-mannitol, and sodium chloride may be used as an aqueous solution for injection, optionally in combination with a suitable solubilizing agent, for example, alcohol such as ethanol and polyalcohol such as propylene glycol or polyethylene glycol, and a nonionic surfactant such as polysorbate 80, HCO-50 and the like.
(233) As disclosed herein, a loaded mini-nucleosome therapeutic agent composition may be in any form known in the art. Such forms include, e.g., liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories.
(234) Selection or use of any particular form may depend, in part, on the intended mode of administration and therapeutic application. For example, compositions containing a composition intended for systemic or local delivery can be in the form of injectable or infusible solutions. Accordingly, a loaded mini-nucleosome therapeutic agent composition can be formulated for administration by a parenteral mode (e.g., intravenous, subcutaneous, intraperitoneal, or intramuscular injection). As used herein, parenteral administration refers to modes of administration other than enteral and topical administration, usually by injection, and include, without limitation, intravenous, intranasal, intraocular, pulmonary, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intrapulmonary, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural, intracerebral, intracranial, intracarotid and intrasternal injection and infusion.
(235) A parenteral route of administration can be, for example, administration by injection, transnasal administration, transpulmonary administration, or transcutaneous administration. Administration can be systemic or local by intravenous injection, intramuscular injection, intraperitoneal injection, subcutaneous injection.
(236) In various embodiments, a loaded mini-nucleosome therapeutic agent composition of the present invention can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable for stable storage at high concentration. Sterile injectable solutions can be prepared by incorporating a composition described herein in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filter sterilization. Generally, dispersions are prepared by incorporating a composition described herein into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, methods for preparation include vacuum drying and freeze-drying that yield a powder of a composition described herein plus any additional desired ingredient (see below) from a previously sterile-filtered solution thereof. The proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prolonged absorption of injectable compositions can be brought about by including in the composition a reagent that delays absorption, for example, monostearate salts, and gelatin.
(237) A loaded mini-nucleosome therapeutic agent composition can be administered parenterally in the form of an injectable formulation comprising a sterile solution or suspension in water or another pharmaceutically acceptable liquid. For example, the loaded mini-nucleosome therapeutic agent composition can be formulated by suitably combining the therapeutic molecule with pharmaceutically acceptable vehicles or media, such as sterile water and physiological saline, vegetable oil, emulsifier, suspension agent, surfactant, stabilizer, flavoring excipient, diluent, vehicle, preservative, binder, followed by mixing in a unit dose form required for generally accepted pharmaceutical practices. The amount of loaded mini-nucleosome therapeutic agent included in the pharmaceutical preparations is such that a suitable dose within the designated range is provided. Nonlimiting examples of oily liquid include sesame oil and soybean oil, and it may be combined with benzyl benzoate or benzyl alcohol as a solubilizing agent. Other items that may be included are a buffer such as a phosphate buffer, or sodium acetate buffer, a soothing agent such as procaine hydrochloride, a stabilizer such as benzyl alcohol or phenol, and an antioxidant. The formulated injection can be packaged in a suitable ampule.
(238) In some embodiments, a loaded mini-nucleosome therapeutic agent composition can be formulated for storage at a temperature below 0 C. (e.g., 20 C. or 80 C.). In some embodiments, the composition can be formulated for storage for up to 2 years (e.g., one month, two months, three months, four months, five months, six months, seven months, eight months, nine months, 10 months, 11 months, 1 year, 11/2 years, or 2 years) at 2-8 C. (e.g., 4 C.). Thus, in some embodiments, the compositions described herein are stable in storage for at least 1 year at 2-8 C. (e.g., 4 C.).
(239) In particular instances, a loaded mini-nucleosome therapeutic agent composition can be formulated as a solution. In some embodiments, a composition can be formulated, for example, as a buffered solution at a suitable concentration and suitable for storage at 2-8 C. (e.g., 4 C.).
(240) Compositions including a loaded mini-nucleosome therapeutic agent as described herein can be formulated in immunoliposome compositions. Such formulations can be prepared by methods known in the art. Liposomes with enhanced circulation time are disclosed in, e.g., U.S. Pat. No. 5,013,556.
(241) In certain embodiments, compositions can be formulated with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are known in the art. See, e.g., J. R. Robinson (1978) Sustained and Controlled Release Drug Delivery Systems, Marcel Dekker, Inc., New York.
(242) In some embodiments, compositions can be formulated in a composition suitable for intrapulmonary administration (e.g., for administration via an inhaler or nebulizer) to a mammal such as a human. Methods for formulating such compositions are well known in the art. Dry powder inhaler formulations and suitable systems for administration of the formulations are also known in the art. Pulmonary administration may be oral and/or nasal. Examples of pharmaceutical devices for pulmonary delivery include metered dose inhalers, dry powder inhalers (DPIs), and nebulizers. For example, a composition described herein can be administered to the lungs of a subject by way of a dry powder inhaler. These inhalers are propellant-free devices that deliver dispersible and stable dry powder formulations to the lungs. Dry powder inhalers are well known in the art of medicine and include, without limitation: the TURBOHALER (AstraZeneca; London, England) the AIR inhaler (ALKERMES; Cambridge, Mass.); ROTAHALER (GlaxoSmithKline; London, England); and ECLIPSE (Sanofi-Aventis; Paris, France). See also, e.g., PCT Publication Nos. WO 04/026380, WO 04/024156, and WO 01/78693. DPI devices have been used for pulmonary administration of polypeptides such as insulin and growth hormone. In some embodiments, a composition described herein can be intrapulmonarily administered by way of a metered dose inhaler. These inhalers rely on a propellant to deliver a discrete dose of a compound to the lungs. Additional devices and intrapulmonary administration methods are set forth in, e.g., U.S. Patent Application Publication Nos. 20050271660 and 20090110679, the disclosures of each of which are incorporated herein by reference in their entirety.
(243) In some embodiments, loaded mini-nucleosome therapeutic agent compositions can be formulated for delivery to the eye, e.g., in the form of a pharmaceutically acceptable solution, suspension or ointment. A preparation for use in treating an eye can be in the form of a sterile aqueous solution containing, e.g., additional ingredients such as, but not limited to, preservatives, buffers, tonicity agents, antioxidants and stabilizers, nonionic wetting or clarifying agents, and viscosity-increasing agents. A preparation as described herein can be administered topically to the eye of the subject in need of treatment (e.g., a subject afflicted with AMD) by conventional methods, e.g., in the form of drops, or by bathing the eye in a therapeutic solution, containing one or more compositions.
(244) A variety of devices for introducing drugs into the vitreal cavity of the eye may be appropriate, in certain embodiments, for administration of a composition as described herein. For example, U.S. Publication No. 2002/0026176 describes a pharmaceutical-containing plug that can be inserted through the sclera such that it projects into the vitreous cavity to deliver the pharmaceutical agent into the vitreous cavity. In another example, U.S. Pat. No. 5,443,505 describes an implantable device for introduction into a suprachoroidal space or an avascular region for sustained release of drug into the interior of the eye. U.S. Pat. Nos. 5,773,019 and 6,001,386 each disclose an implantable drug delivery device attachable to the scleral surface of an eye. Additional methods and devices (e.g., a transscleral patch and delivery via contact lenses) for delivery of a loaded mini-nucleosome therapeutic agent to the eye are described in, e.g., Ambati and Adamis (2002) Prog Retin Eye Res 21 (2): 145-151; Ranta and Urtti (2006) Adv Drug Delivery Rev 58 (11): 1164-1181; Barocas and Balachandran (2008) Expert Opin Drug Delivery 5 (1): 1-10 (10); Gulsen and Chauhan (2004) Invest Opthalmol Vis Sci 45:2342-2347; Kim et al. (2007) Ophthalmic Res 39:244-254; and PCT publication no. WO 04/073551, the disclosures of which are incorporated herein by reference in their entirety.
(245) In various embodiments, subcutaneous administration can be accomplished by means of a device, such as a syringe, a prefilled syringe, an auto-injector (e.g., disposable or reusable), a pen injector, a patch injector, a wearable injector, an ambulatory syringe infusion pump with subcutaneous infusion sets, or other device for subcutaneous injection.
(246) In some embodiments, a loaded mini-nucleosome therapeutic agent composition described herein can be therapeutically delivered to a subject by way of local administration. As used herein, local administration or local delivery, can refer to delivery that does not rely upon transport of the loaded mini-nucleosome therapeutic agent composition or loaded mini-nucleosome therapeutic agent to its intended target tissue or site via the vascular system. For example, the loaded mini-nucleosome therapeutic agent composition may be delivered by injection or implantation of the composition or agent or by injection or implantation of a device containing the composition or agent. In certain embodiments, following local administration in the vicinity of a target tissue or site, the composition or agent, or one or more components thereof, may diffuse to an intended target tissue or site that is not the site of administration.
(247) In some embodiments, the compositions provided herein are present in unit dosage form, which unit dosage form can be suitable for self-administration. Such a unit dosage form may be provided within a container, typically, for example, a vial, cartridge, prefilled syringe or disposable pen. A doser such as the doser device described in U.S. Pat. No. 6,302,855, may also be used, for example, with an injection system as described herein.
(248) A suitable dose of a loaded mini-nucleosome therapeutic agent composition described herein, which dose is capable of treating or preventing a disorder in a subject, can depend on a variety of factors including, e.g., the age, sex, and weight of a subject to be treated, the condition or disease to be treated, and the particular loaded mini-nucleosome therapeutic agent used. Other factors affecting the dose administered to the subject include, e.g., the type or severity of the condition or disease. Other factors can include, e.g., other medical disorders concurrently or previously affecting the subject, the general health of the subject, the genetic disposition of the subject, diet, time of administration, rate of excretion, drug combination, and any other additional therapeutics that are administered to the subject. It should also be understood that a specific dosage and treatment regimen for any particular subject can also be adjusted based upon the judgment of a medical practitioner.
(249) A loaded mini-nucleosome therapeutic agent solution can include a therapeutically effective amount of a composition described herein. Such effective amounts can be readily determined by one of ordinary skill in the art based, in part, on the effect of the administered composition, or the combinatorial effect of the composition and one or more additional active agents, if more than one agent is used. A therapeutically effective amount can be an amount at which any toxic or detrimental effects of the composition are outweighed by therapeutically beneficial effects.
(250) Pharmaceutical forms of loaded mini-nucleosome therapeutic formulations suitable for injection can include sterile aqueous solutions or dispersions. A formulation can be sterile and must be fluid to allow proper flow in and out of a syringe. A formulation can also be stable under the conditions of manufacture and storage. A carrier can be a solvent or dispersion medium containing, for example, water and saline or buffered aqueous solutions. Preferably, isotonic agents, for example, sugars or sodium chloride can be used in the formulations. For human administration, final preparations and compositions should meet sterility, pyrogenicity, and the general endotoxin levels, safety and purity standards as required by the US FDA and EU regulatory standards. Temperature and exposure to other proteins can alter the properties of loaded mini-nucleosomes. The final preparations and compositions must be stored at appropriate temperatures, preferably at 2-8 degree Celsius or at room temperature (20-25 degree Celsius).
(251) In addition, one skilled in the art may also contemplate additional delivery method may be via electroporation, sonophoresis, intraosseous injections methods or by using gene gun. Vectors may also be implanted into microchips, nano-chips or nanoparticles.
(252) In certain embodiments, the compositions described herein may be formulated in a kit. Such kits may be used for therapeutic or diagnostic purposes. The present disclosure provides, among other things, one or more compositions together with one or more pharmaceutically-acceptable excipients, carriers, diluents, adjuvants, and/or other components, as may be employed in the formulation of a composition consisting of mini-nucleosome core proteins and nucleic acids, and in the preparation of therapeutic agents for administration to a mammal, and in particularly, to a human, for one or more diseases described herein. In particular, such kits may include one or more of the disclosed mini-nucleosome core protein compositions in combination with instructions for using nucleic acids in the treatment various disorders in a mammal, and may typically include containers prepared for convenient commercial packaging.
(253) Compositions described herein can be administered to an animal that is a mammal, e.g., a human. Compositions described herein are also applicable to animals of commercial interest, livestock, and household pets such as dogs and cats. Compositions in kits can include partially or significantly purified loaded mini-nucleosomes compositions, either alone, or in combination with one or more other ingredients or drugs for therapeutic or diagnostic use. Therapeutic kits can also be prepared that include at least one loaded mini-nucleosome component based gene therapy compositions disclosed herein and instructions for using the composition as a therapeutic agent. The container means for such kits may typically include at least one vial, test tube, flask, bottle, syringe or other container means, into which the disclosed mini-nucleosomes composition(s) may be placed, and preferably suitably aliquoted.
(254) Applications
(255) Mini-nucleosomes provided herein can, in various embodiments, be characterized by small size, ability to enter cells by receptor mediated or passive diffusion processes, precision in the location of gene expression, precision in the duration of gene expression, and/or retention until release of nucleic acids in the cytoplasm of the nucleus of a target cell. Some of the desired application of the mini-nucleosome technology are described herein.
(256) The present disclosure further includes the recognition that modified mini-nucleosomes of the present disclosure can target delivery of nucleic acid payloads to particular cells or tissues and/or to achieve expression of an expression product encoded by a nucleic acid payload in one or more particular cells or tissues. As will be readily apparent from the present disclosure, delivery and/or expression of a nucleic acid payload in a particular cell or tissue can be useful in a variety of methods and compositions that benefit from the presence of a particular expression product (e.g., a particular protein) in a particular targeted cell or tissue.
(257) In certain embodiments, a modified mini-nucleosome of the present disclosure includes one or more phosphorylated residues (e.g., where one or more, or all, of the phosphorylated residues are selected from serine, threonine, or tyrosine residues). The present disclosure includes the recognition that the presence, rather than the specific number or position, of the phosphorylated residue mediates the ability of the modified mini-nucleosome to target delivery of nucleic acid payloads to particular cells or tissues and/or to achieve expression of an expression product encoded by a nucleic acid payload in one or more particular cells or tissues. Without wishing to be bound by any particular scientific theory, the present disclosure includes that at least certain advantages that characterize phosphorylated mini-nucleosome core proteins (e.g., targeting of particular cell or tissues) result from interaction of the modification with cell surface receptors of target cells and are therefore not sequence specific or specific to the position of any modified residue. The present disclosure specifically includes the recognition that phosphorylated mini-nucleosome core proteins can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, target cells that are cells of the central nervous system (CNS). In certain embodiments, a phosphorylated mini-nucleosome core proteins can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, CNS neurons. In certain embodiments, a phosphorylated mini-nucleosome core proteins can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, CNS astrocytes, microglia, oligodendrocytes, or glia. In certain embodiments, a phosphorylated mini-nucleosome core protein can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, spinal cord cells, e.g., spinal cord neurons or spinal cord glial cells. In various embodiments, expression of an expression product encoded by a nucleic acid payload associated with a modified mini-nucleosome core protein (e.g., a phosphorylated mini-nucleosome core protein, e.g., in a loaded mini-nucleosome) is increased as compared to expression achieved under reference (e.g., same or similar) conditions using a reference (e.g., unmodified) mini-nucleosome core protein. The present disclosure recognizes that expression in various such target cell types is significant for treatment of certain conditions that effect or are effected by target cell types, e.g., diseases of the CNS.
(258) In certain embodiments, delivery of a nucleic acid payload and/or expression of a nucleic acid payload in target cells is facilitated by a particular route of delivery. In various embodiments in which a phosphorylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to cells of the central nervous system. In various embodiments in which a phosphorylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to CNS neurons. In various embodiments in which a phosphorylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to CNS astrocytes, microglia, oligodendrocytes, or glia. In various embodiments in which a phosphorylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to spinal cord cells, e.g., spinal cord neurons or spinal cord glial cells. Those of skill in the art will be familiar with routes of administration to particular cells, cell types, and tissues. In certain particular embodiments, administration to a subject is by injection, e.g., injection to the CNS (e.g., to a cell or tissue of the CNS). In certain particular embodiments, administration to a subject is intrathecal, intracranial, or intra-cisterna magna. In certain particular embodiments, administration to a subject is intrathecal.
(259) In various embodiments, a phosphorylated mini-nucleosome core protein can include multiple phosphorylated residues, e.g., one, two, three, or four phosphorylated residues. In various embodiments, a phosphorylated mini-nucleosome core protein can include one or more amino acid modifications disclosed herein that is not phosphorylation. Accordingly, the present disclosure includes combinations of different modifications present in a single modified mini-nucleosome core protein. A phosphorylated amino acid of a modified mini-nucleosome can be present in any domain or at any amino acid position of a modified mini-nucleosome. A phosphorylated amino acid of a modified mini-nucleosome can be present, without limitation, in a linker domain or targeting domain.
(260) In certain embodiments, a modified mini-nucleosome of the present disclosure includes one or more sulfated residues (e.g., where one or more, or all, of the sulfated residues are selected from serine, threonine, or tyrosine residues). The present disclosure includes the recognition that the presence, rather than the specific number or position, of the sulfated residue mediates the ability of the modified mini-nucleosome to target delivery of nucleic acid payloads to particular cells or tissues and/or to achieve expression of an expression product encoded by a nucleic acid payload in one or more particular cells or tissues. Without wishing to be bound by any particular scientific theory, the present disclosure includes that at least certain advantages that characterize sulfated mini-nucleosome core proteins (e.g., targeting of particular cell or tissues) result from interaction of the modification with cell surface receptors of target cells and are therefore not sequence specific or specific to the position of any modified residue. The present disclosure specifically includes the recognition that sulfated mini-nucleosome core proteins can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, target cells that are cells of the central nervous system. In certain embodiments, a sulfated mini-nucleosome core protein can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, CNS neurons. In certain embodiments, a sulfated mini-nucleosome core protein can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, CNS astrocytes, microglia, oligodendrocytes, or glia. In certain embodiments, a sulfated mini-nucleosome core protein can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, spinal cord cells, e.g., spinal cord neurons or spinal cord glial cells. In various embodiments, expression of an expression product encoded by a nucleic acid payload associated with a modified mini-nucleosome core protein (e.g., a sulfated mini-nucleosome core protein, e.g., in a loaded mini-nucleosome) is increased as compared to expression achieved under reference (e.g., same or similar) conditions using a reference (e.g., unmodified) mini-nucleosome core protein. The present disclosure recognizes that expression in various such target cell types is significant for treatment of certain conditions that effect or are effected by target cell types, e.g., diseases of the CNS.
(261) In certain embodiments, delivery of a nucleic acid payload and/or expression of a nucleic acid payload in target cells is facilitated by a particular route of delivery. In various embodiments in which a sulfated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to cells of the central nervous system. In various embodiments in which a sulfated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to CNS neurons. In various embodiments in which a sulfated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to CNS astrocytes, microglia, oligodendrocytes, or glia. In various embodiments in which a sulfated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to spinal cord cells, e.g., spinal cord neurons or spinal cord glial cells. Those of skill in the art will be familiar with routes of administration to particular cells, cell types, and tissues. In certain particular embodiments, administration to a subject is by injection, e.g., injection to the CNS (e.g., to a cell or tissue of the CNS). In certain particular embodiments, administration to a subject is intrathecal, intracranial, or intra-cisterna magna. In certain particular embodiments, administration to a subject is intrathecal.
(262) In various embodiments, a sulfated mini-nucleosome core protein can include multiple sulfated residues, e.g., one, two, three, or four sulfated residues. In various embodiments, a sulfated mini-nucleosome core protein can include one or more amino acid modifications disclosed herein that is not sulfation. Accordingly, the present disclosure includes combinations of different modifications present in a single modified mini-nucleosome core protein. A sulfated amino acid of a modified mini-nucleosome can be present in any domain or at any amino acid position of a modified mini-nucleosome. A sulfated amino acid of a modified mini-nucleosome can be present, without limitation, in a linker domain or targeting domain.
(263) In certain embodiments, a modified mini-nucleosome of the present disclosure includes one or more acetylated residues (e.g., where one or more, or all, of the acetylated residues are lysine residues). The present disclosure includes the recognition that the presence, rather than the specific number or position, of the acetylated residue mediates the ability of the modified mini-nucleosome to target delivery of nucleic acid payloads to particular cells or tissues and/or to achieve expression of an expression product encoded by a nucleic acid payload in one or more particular cells or tissues. Without wishing to be bound by any particular scientific theory, the present disclosure includes that at least certain advantages that characterize acetylated mini-nucleosome core proteins (e.g., targeting of particular cell or tissues) result from interaction of the modification with cell surface receptors of target cells and are therefore not sequence specific or specific to the position of any modified residue. The present disclosure specifically includes the recognition that acetylated mini-nucleosome core proteins can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, target cells that are CNS neurons and/or retinal cells. In certain embodiments, an acetylated mini-nucleosome core protein can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, CNS neurons. In certain embodiments, an acetylated mini-nucleosome core protein can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, retinal cells, e.g., retinal neurons including one or more of photoreceptors, bipolar cells, retinal ganglion cells, horizontal cells and amacrine cells). In certain embodiments, an acetylated mini-nucleosome core protein can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, photoreceptor cells (e.g., rods and/or cones). In various embodiments, expression of an expression product encoded by a nucleic acid payload associated with a modified mini-nucleosome core protein (e.g., an acetylated mini-nucleosome core protein, e.g., in a loaded mini-nucleosome) is increased as compared to expression achieved under reference (e.g., same or similar) conditions using a reference (e.g., unmodified) mini-nucleosome core protein. The present disclosure recognizes that expression in various such target cell types is significant for treatment of certain conditions that effect or are effected by target cell types, e.g., diseases of the CNS, including diseases of the retina (e.g., Retinitis pigmentosa and/or Stargardt's disease).
(264) In certain embodiments, delivery of a nucleic acid payload and/or expression of a nucleic acid payload in target cells is facilitated by a particular route of delivery. In various embodiments in which an acetylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to CNS neurons and/or retinal cells. In various embodiments in which an acetylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to CNS neurons. In various embodiments in which an acetylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to retinal cells, e.g., retinal neurons including one or more of photoreceptors, bipolar cells, retinal ganglion cells, horizontal cells and amacrine cells). In various embodiments in which an acetylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to photoreceptor cells (e.g., rods and/or cones). Those of skill in the art will be familiar with routes of administration to particular cells, cell types, and tissues. In certain particular embodiments, administration to a subject is by injection, e.g., injection to the eye (e.g., to a cell or tissue of the eye). In certain particular embodiments, administration to a subject is intravitreal, suprachoroidal, or subretinal.
(265) In various embodiments, an acetylated mini-nucleosome core protein can include multiple acetylated residues, e.g., one, two, three, or four acetylated residues. In various embodiments, an acetylated mini-nucleosome core protein can include one or more amino acid modifications disclosed herein that is not acetylation. Accordingly, the present disclosure includes combinations of different modifications present in a single modified mini-nucleosome core protein. An acetylated amino acid of a modified mini-nucleosome can be present in any domain or at any amino acid position of a modified mini-nucleosome. An acetylated amino acid of a modified mini-nucleosome can be present, without limitation, in a linker domain or targeting domain.
(266) In certain embodiments, a modified mini-nucleosome of the present disclosure includes one or more mannosylated residues (e.g., where one or more, or all, of the mannosylated residues are serine residues). The present disclosure includes the recognition that the presence, rather than the specific number or position, of the mannosylated residue mediates the ability of the modified mini-nucleosome to target delivery of nucleic acid payloads to particular cells or tissues and/or to achieve expression of an expression product encoded by a nucleic acid payload in one or more particular cells or tissues. Without wishing to be bound by any particular scientific theory, the present disclosure includes that at least certain advantages that characterize mannosylated mini-nucleosome core proteins (e.g., targeting of particular cell or tissues) result from interaction of the modification with cell surface receptors of target cells and are therefore not sequence specific or specific to the position of any modified residue. The present disclosure specifically includes the recognition that mannosylated mini-nucleosome core proteins can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, target cells that are CNS neurons and/or retinal cells. In certain embodiments, a mannosylated mini-nucleosome core protein can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, CNS neurons. In certain embodiments, a mannosylated mini-nucleosome core protein can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, retinal cells, e.g., retinal neurons including one or more of photoreceptors, bipolar cells, retinal ganglion cells, horizontal cells and amacrine cells). In certain embodiments, a mannosylated mini-nucleosome core protein can deliver a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, photoreceptor cells (e.g., rods and/or cones). In various embodiments, expression of an expression product encoded by a nucleic acid payload associated with a modified mini-nucleosome core protein (e.g., a mannosylated mini-nucleosome core protein, e.g., in a loaded mini-nucleosome) is increased as compared to expression achieved under reference (e.g., same or similar) conditions using a reference (e.g., unmodified) mini-nucleosome core protein. The present disclosure recognizes that expression in various such target cell types is significant for treatment of certain conditions that effect or are effected by target cell types, e.g., diseases of the CNS, including diseases of the retina (e.g., Retinitis pigmentosa and/or Stargardt's disease.
(267) In certain embodiments, delivery of a nucleic acid payload and/or expression of a nucleic acid payload in target cells is facilitated by a particular route of delivery. In various embodiments in which a mannosylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to CNS neurons and/or retinal cells. In various embodiments in which a mannosylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to CNS neurons. In various embodiments in which a mannosylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to retinal cells, e.g., retinal neurons including one or more of photoreceptors, bipolar cells, retinal ganglion cells, horizontal cells and amacrine cells). In various embodiments in which a mannosylated mini-nucleosome core protein delivers a nucleic acid payload to, and/or cause expression of a nucleic acid payload in, one or more target cells, cell types, or tissues disclosed herein, administration to a subject is by a route that achieves delivery to photoreceptor cells (e.g., rods and/or cones). Those of skill in the art will be familiar with routes of administration to particular cells, cell types, and tissues. In certain particular embodiments, administration to a subject is by injection, e.g., injection to the eye (e.g., to a cell or tissue of the eye). In certain particular embodiments, administration to a subject is intravitreal, suprachoroidal, or subretinal.
(268) In various embodiments, a mannosylated mini-nucleosome core protein can include multiple mannosylated residues, e.g., one, two, three, or four mannosylated residues. In various embodiments, a mannosylated mini-nucleosome core protein can include one or more amino acid modifications disclosed herein that is not mannosylation. Accordingly, the present disclosure includes combinations of different modifications present in a single modified mini-nucleosome core protein. A mannosylated amino acid of a modified mini-nucleosome can be present in any domain or at any amino acid position of a modified mini-nucleosome. A mannosylated amino acid of a modified mini-nucleosome can be present, without limitation, in a linker domain or targeting domain.
(269) Gene Therapy
(270) In various embodiments, mini-nucleosomes provided herein can be used in methods of gene therapy. The general principles of gene therapy are well known in the art and include the delivery of a polynucleotide to a subject in need thereof to provide an expression product (e.g., an mRNA, protein, or inhibitory RNA) of therapeutic value. In some embodiments, gene therapy can include gene or protein replacement therapy (e.g., enzyme replacement therapy), augmentation, or target inhibition. In various embodiments, mini-nucleosomes provided herein can be applied to rescue deleterious effects of any mutations that cause diseases including, without limitation, Cystic fibrosis, Duchenne muscular dystrophy, Stargardt's disease, Age-related macular degeneration, Huntington, Hemophilia A, Spinal muscular atrophy, Usher syndrome etc. In such diseases, a genetic mutation renders a gene nonfunctional or not available. In such cases, replacing the mutated gene by a functional copy may be beneficial to the patients. By incorporating a functional cDNA or whole gene into a loaded mini-nucleosome, and delivering it to desired cells or tissues, one may receive, in various embodiments, a therapeutic benefit.
(271) In some embodiments, mini-nucleosomes provided herein can be applied to inhibit genes that are upregulated and disease causing. For example, P53 overexpression has been described in various diseases. In some instances, it is also beneficial to knock down genes at specific cells or tissues to downregulate genes that cause inflammation, hypoxia etc. to have therapeutic effects.
(272) Ex-vivo Engineered Cells
(273) Mini-nucleosomes of the present disclosure can be used to engineer cells ex vivo. Cells can be engineered to express therapeutics in various ways. One such cell is immune cell, e.g., T cell. Immune cells can be genetically engineered to express new proteins or receptors that may allow immune recognition of cancerous cells or other harmful cell types for killing and clearance. Such genetic engineering may be performed ex vivo. In various embodiments, mini-nucleosomes provided herein can be used in methods of genetically engineering cells ex vivo. Combination of domains provided herein, may allow loaded mini-nucleosome entry to variety of T cells and deliver a genetic cargo to the nucleus in such cells. The genetic cargo may encode and/or allow expression of chimeric receptors, knockdown of genes or other therapeutic entity. Such cells may then be infused into patients for therapy. One skilled in the art, may contemplate using loaded mini-nucleosomes for creating chimeric antigen receptor T cells (CAR T cells) for use in immunotherapy.
(274) In some embodiments, mini-nucleosomes provided herein can be applied to engineering stem cells ex vivo to express new proteins or receptors for therapeutic purposes. Combination of domains provided herein, may allow loaded mini-nucleosome entry to variety of stem cells to deliver a genetic cargo to the nucleus/cytoplasm in such cells. The genetic cargo may allow expression of chimeric receptors, knockdown of genes or other therapeutic entity. Such cells may then be infused into patients for therapy. One skilled in the art, may contemplate using loaded mini-nucleosomes for creating chimeric stem cells or chimeric hematopoietic stem cells for use in immunotherapy.
(275) Gene Editing And Base Excision Repair
(276) Gene editing, base editing and manipulation is also an applicable area for this mini-nucleosome technology described herein. Gene editing and base excision repair are state-of-the-art technologies that allow correcting a genetic mutation or editing the genes at the DNA or RNA level. Towards this application, a loaded mini-nucleosome may incorporate nucleic acids that encode for gRNA, sgRNA, spCas9, saCas9, dCas9, cytidine deaminase and several other enzymes that help cleave DNA or convert one base to another. One skilled in the art can appreciate that incorporating multiple gRNAs and Cas9 or similar editing enzymes in an AAV is a cumbersome and often inefficient process. Hence, using the method and compositions described herein, that enables easy compaction of nucleic acids onto loaded mini-nucleosomes allows incorporation of several gRNAs and even the largest of Cas9 genes to deliver to desired cells.
(277) Antibody Delivery
(278) Antibodies are a class of drugs that have been life changing for millions of patients worldwide. However, one big drawback in this therapy is the requirement of repeat administration which poses immense burden to patients, physicians and caregivers. One skilled in the art can appreciate that a DNA molecule can be used to express antibodies. Mini-nucleosome technology described herein, provides an opportunity to vectorize the antibody and deliver to desired cells in the patients to create a long-term depot in their bodies to reduce the burden of multiple administration. These DNA molecules that express part or whole of antibody domains can be incorporated into loaded mini-nucleosomes to create a long term therapeutic option for patients that take antibody drugs. One skilled in the art may also vectorize and deliver other antibody like molecules such as nanobody, antibody mimetics, fusion peptides, antibody fragments, camelid or camelid single-domain antibody fragments using mini-nucleosome core proteins.
(279) Vaccine Delivery
(280) Genetically engineered DNA or RNA can produce an antigen to provide a protective immunological response. Nucleic acid vaccines have several potential advantages such as wide-range immunological response over conventional vaccines. Mini-nucleosome technology described herein, can incorporate and deliver such DNA or RNA constructs to desired cells or tissues in animals including humans to protect from several viral, bacterial or parasitic infections.
(281) Cosmetics
(282) Genetically engineered DNA or RNA can be developed for several cosmetic applications for example to enhance muscle mass, repair skin in burn victims, for weight loss, to improve immune function, to slow aging and many other applications. Mini-nucleosome technology described herein, can incorporate and deliver applicable DNA or RNA constructs to desired cells or tissues in animals including humans for desired cosmetic effect.
(283) In various embodiments, the present disclosure further provides vectors relating to preventing or treating a disease in humans or other animals. A prophylactically or therapeutically effective amount of a composition could be administered via intravenous, intramuscular, intranasal, intraperitoneal, subcutaneous, intracerebral, subretinal, intravitreal, via lumbar puncture, topical, rectal, or direct delivery to local organs or tumors but not limited to these techniques. The composition includes of nucleic acid complexes, each complex consisting essentially of a single or more nucleic acid molecule and one or more mini-nucleosome core protein molecules.
(284) The present disclosure provides, among other things, improved methods of condensing DNA, RNA and their analogs etc. for efficient delivery into human cells to treat certain diseases and/or cosmetic applications. The nucleic acid delivered may also have applications to deliver vaccines.
Examples
Example 1: Design and Synthesis of Mini-Nucleosome Core Proteins
(285) This Example is representative of methods and compositions relating to mini-nucleosome core proteins. In this Example, amino acid sequences of peptides (that can condense nucleic acids into loaded-mini-nucleosomes) and their synthesis process are described.
(286) Loaded mini-nucleosomes of the present Example are produced for efficient gene transfer and release of loaded nucleic acid cargo to various cell types. Loaded mini-nucleosomes of the present Example are designed to actively engage with cell surface via binding to cell surface proteins, to be translocated to the cytoplasm/nucleus in cells, and to allow release of the nucleic acid cargo. These characteristics can be achieved by mini-nucleosome core protein and loaded mini-nucleosomes designed based on structured protein/DNA interaction. Accordingly, the present Example includes mini-nucleosome core proteins that include one or more amino acid domains that enhance one or more of cellular attachment, enhanced uptake, enhanced stability, active transport to the nucleus of a target cell, and release via peptidases.
(287) In the present Example, synthesized mini-nucleosome core proteins may include, without limitation, a sequence according to any one of SEQ ID NOS: 389-394, or other sequences derived from domains disclosed herein in Table 3-12, or any combination thereof. Mini-nucleosome core proteins of the present Example are peptides with net positive charge >8 at pH 7 and isoelectric point >9. For example, SEQ ID NO: 394 is a mini-nucleosome core protein sequence including multiple DNA binding domains (KRHRK) combined with multiple Neuronal attachment domains (LRE) and a poly-Arginine domain (RRRRR). In this same construct, Leucines (L) surround the poly-Arginine domain to separate charged domains with hydrophobic amino acids, enabling the cell attachment targeting domain to bind to the cell surface. In this construct, the mini-nucleosome core protein (SEQ ID NO: 394) is designed for enhanced attachment to neurons via LRE domain while the poly-Arginine domain would help cell entry. The present Example also includes mini-nucleosome core proteins with various linkers positioned between certain domains, and examples of linkers include those provided in SEQ ID NOS: 389-394. By design, KRH in SEQ ID NO: 394 also serves as a cut site for PCSK1 for enhanced release of nucleic acids. Other nucleic acid release domains or cleavage domains that could be included in mini-nucleosome core proteins include, without limitation, those described in Table 9. Domains for inclusion in mini-nucleosome core proteins can also be derived for other peptidases, including without limitation those in Table 9.
(288) Mini-nucleosome core proteins of the present Example, including mini-nucleosome core proteins according to SEQ ID NOS: 389-394, include various combinations of sequence features that allows efficient condensation with nucleic acid molecules and delivery of loaded mini-nucleosomes to desired cell types, e.g., animal cells and tissues. In certain mini-nucleosome core proteins of the present Example, an oligomerization domain is included in a mini-nucleosome core protein in order to cause a loaded mini-nucleosome core protein formed by association of the mini-nucleosome core protein with a nucleic acid cargo to have a relatively smaller size as compared to a reference loaded mini-nucleosome core protein, e.g., as compared to a loaded mini-nucleosome including mini-nucleosome core proteins that lack the oligomerization domain(s) but otherwise are identical in amino acid sequence. Exemplary oligomerization domains include those provided in Table 11. Similarly, endosomal entry and escape signals may also be included in mini-nucleosome core proteins for enhanced stability and release.
(289) Mini-nucleosome core proteins of the present Example can be synthesized by various methods. One method of synthesizing mini-nucleosome core proteins is peptide synthesis. Peptide synthesis allows linking of amino acids via amide bonds. For example, mini-nucleosomes core proteins can be chemically synthesized via a condensation reaction between carboxyl group of one amino acid to the amino group of the next desired amino acid, in order of the sequence of a mini-nucleosome core protein. An established method of peptide syntheses is known in the art as solid phase peptide synthesis.
(290) Several strategies can optionally be applied to protect the amino (N-terminal) and carboxy-terminal (C-terminal) of mini-nucleosome core proteins of the present disclosure. If the mini-nucleosome core protein is lyophilized, the lyophilized peptide may contain traces of salts used during the synthesis process. Other methods of mini-nucleosome core protein production include expressing the mini-nucleosome core protein in a cell system or in vivo form DNA constructs encoding the mini-nucleosome core protein. Produced mini-nucleosome core proteins can be purified by a variety of methods known in the art. For instance, several resins may be utilized during the process. Mini-nucleosomes core proteins, in various instances of the present Example, are >90% pure. However, a less pure <90% core protein may also be used to form a loaded mini-nucleosome. Mini-nucleosomes core proteins, in various instances of the present Example, are >90% conjugated with PEG. However, a less conjugated (<90%) or non-conjugated core protein may also be used to form a loaded mini-nucleosome. Mini-nucleosomes core protein purity can be determined by high-pressure liquid chromatography (HPLC) and identity confirmed by mass spectrometry to the very least.
Example 2. Production of loaded Mini-nucleosomes
(291) This Example describes techniques relating to production of a loaded mini-nucleosome, including without limitation a loaded mini-nucleosome of Example 1. Loaded mini-nucleosomes of the present Example include a nucleic acid cargo (DNA or RNA) condensed with mini-nucleosome core proteins with net positive charges. The mini-nucleosome core protein net positive charge neutralizes negative charges of the nucleic acid cargo, resulting in nanometer sized particles. Conjugation of the said mini-nucleosomes core proteins and DNA or RNA can occur in small or large quantities. There are 2 phosphates meaning 2 negative charges associated with every base. The present Example provides that at least 90% of DNA negative charges are neutralized by a nucleosome core protein positive charge. For example, 90-95 percent of DNA negative charges need to be neutralized for efficient condensation of the nucleic acids with a mini-nucleosome core protein. Various mini-nucleosome core proteins of the present Example can include amino acid domains that enhance one or more of cellular attachment, cellular uptake, protein stability, active transport to the nucleus of a target cell, and release of nucleic acid cargo. Thus, certain mini-nucleosome core proteins provided herein can be particularly useful in certain contexts. During the process of mixing the nucleic acids and mini-nucleosomes core proteins to produce a loaded mini-nucleosome, the mixture of nucleic acids and mini-nucleosome core proteins can be mixed or vortexed between 100rpms to 4000rpms. In the process of conjugation of nucleic acids, certain catalysts, such as NaOH and spermidines, that enhance the condensation reaction may be added. These catalysts can be added to the reactor prior to adding the polypeptides and nucleic acids. The nucleic acids may be added in concentrations ranging from 0.1 microgram/microliter to 100 grams/liter. Mini-nucleosomes core proteins may be added at a concentration of 0.1 microgram/microliter to 100 grams/liter. The nucleic acids may be added at once or may be added gradually, e.g., steadily or in sequentially in drops to a vortexing solution. Once the mixing is over, the condensed materials, i.e., loaded mini-nucleosomes may be allowed to be equilibrated for a period of several minutes to several hours, e.g., a period of 2 minutes to a period of 6 hours, prior to purification. Dialysis may be performed to remove impurities and exchange buffers at this stage. Loaded mini-nucleosomes may be purified using several techniques. One such technique is to centrifuge the particles at high speed in a column with molecular weight cutoff parameters of 1kiloDalton or higher. The centrifugation speed may range from 7000 xg to 10,000 xg depending on the sample volume. Similarly, duration of centrifugation may vary from 20 minutes at room temperature to one hour depending in sample volume. Another technique available to purify the mini-nucleosomes is dialysis. The purification technique may not be limited to these two techniques and those of skill in the art will be aware of various further purification techniques from literature that can be used to purify protein/nucleic acid complexes. Finally, the loaded mini-nucleosomes may be eluted or collected in endotoxin free water, normal saline or any other buffered solution but not limited to these. The expected recovery of DNA is 30-70%. Loaded mini-nucleosomes may also undergo further centrifugation in molecular weight cut-off columns to further concentrate the amount of vector genome in the solution. In the present Example, the loaded mini-nucleosome is formulated to minimize the presence of endotoxin. Typical sources of endotoxin are known to include plasmids, peptide synthesis, or from materials used in the prep. Hence, endotoxin free plasmids can be used, and materials and equipment that have been scrubbed of endotoxin can be used, during preparations described in this Example.
(292) A bioreactor can also be used to formulate loaded mini-nucleosomes for consistent mixing of the nucleic acids and peptides to produce particles for commercial and clinical use.
Example 3: Favorable Shapes/Sizes and Formulations for Loaded Mini-Nucleosomes
(293) Provided in this Example are techniques to produce loaded mini-nucleosomes in various formulations, including formulations useful for administration to cells and to mammalian subjects, e.g., humans. Loaded mini-nucleosomes can be formulated to different shape and/or sizes parameters based on the mini-nucleosome core protein amino acid sequence and the buffer conditions in which the synthesis occurs. Loaded mini-nucleosomes can be formulated in different conditions, e.g., with solubility suitable for therapeutic use. Solubility of loaded mini-nucleosomes in water and/or normal saline is one means to allow non-toxic formulation of compositions for administration to patients, and to ease of delivery into patients. To form loaded mini-nucleosomes represented in
Example 4: Route of Administration-Intravenous (Systemic) and Application in Systemic Diseases Such as Hemophilia A
(294) This Example demonstrates that loaded mini-nucleosomes can be delivered by intravenous routes to express proteins in the liver and other organs. Balb/c mice were restrained using standard techniques and insulin syringes were used to deliver loaded mini-nucleosomes and plasmid controls via tail vein injections. F8 expressing plasmid constructs (F8 plasmid; see, e.g., MN #1 and MN #2,
(295) In another experiment, direct GFP fluorescence was observed in tissues collected from mice that underwent intravenous injection of loaded-mini-nucleosomes carrying GFP expressing plasmid (SEQ ID NO: 390+GFP plasmid, SEQ ID NO: 395) (
(296) Results demonstrated that when delivered by intravenous route, mini-nucleosomes successfully reached liver and mini-nucleosome cargo-encoded genes were expressed in liver cells (
(297) One example of a condition that, in view of the present disclosure, can be treated by use of a loaded mini-nucleosome therapeutic agent is Hemophilia A. Hemophilia A is a severe bleeding disorder caused by mutation in factor 8, a clotting factor. It is inherited in an X-lined recessive manner. It occurs in approximately 1 in 5,000 live births. Most serious implications are internal bleeding that may lead to death. Severity depends on amount of F8 circulating in the body. 75% of the hemophilia patients take a recombinant F8 product as therapy. Subjects receiving F8 therapy are repeatedly infused intravenously, leading to huge burden for patients, physicians, and caregivers over time. Currently, gene therapy trials are underway to deliver long term expression of F8 via AAVs. However, F8 is a large gene that cannot be fully incorporated in AAV. Thus, mini-F8 has been utilized to deliver functional domains of F8 to treat this disease. It is well known that mini-F8 doesn't have the same functional capability and stability as of full-length F8. Moreover, 20-40% of population already has neutralizing antibodies against AAV that will render a large population of Hemophilic patients unable to receive the AAV-based medicine. In addition, if a further treatment were to be needed after a first discontinued course of AAV treatment, AAV vectors cannot be redosed due to immunogenicity. By being able to deliver full size of F8 gene (
(298) Other systemic diseases that often stem from defects in secreted proteins could also be treated using loaded mini-nucleosomes therapeutic agents. The present Example (
(299) When injected intravenously, loaded mini-nucleosomes may be delivered at a dose greater than 1e5 genome copies per kg and up to a dose of 1e25 copies per kg of body weight (e.g., at about 1e5, 1e6, 1e7, 1e8, 1e9, 1e10, 1e15, 1e20, or 1e25 copies per kg body weight, or any range there between). Volume of the material may range from 1-900 milliliters (e.g., 1, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, or 900 milliliters). The loaded mini-nucleosomes may also be administered repeatedly (e.g., a selected volume and/or number of genome copies can be administered multiple times or divided among two or more does).
Example 5: Route of administration-Intraocular
(300) This example demonstrates that loaded mini-nucleosomes can be delivered by intra-ocular route to express proteins in the retinal pigment epithelium (RPE) or in other retinal neurons such as photoreceptors, bipolar cells and ganglion cells. In the present Example, Balb/c mice were anesthetized by IP injection with Ketamine/Xylazine (90-100 mg/kg+10 mg/kg) and positioned underneath a microscope. Mice eyes were dilated with topical Tropicamide (1%) and 1 l of loaded mini-nucleosomes (total dose 1.5 micrograms in mice) were injected into the vitreous cavity using 32 gauge blunt needle passing through the incision made by a 25-gauge needle below the limbus. At various time points, mice were perfused with 10 ml of 1xPBS, and then sacrificed using standard techniques. Mice were enucleated and eyecups were collected and incubated in 4% paraformaldehyde overnight. The eyecups were washed with 1xPBS, then immersed in 15% sucrose for few hours and then in 30% sucrose solution overnight for cryopreservation. The eyecups were then placed in a plastic vial and frozen using OCT compound for cryo-sectioning. 10-micron thick tissue sections were obtained for staining. The retinal sections were mounted with mounting media with or without DAPI, coverslip and sealed. Images were acquired by Leica SP5. For wholemount imaging, eyecups were fixed in 4% paraformaldehyde overnight. Eyecups were washed in 1xPBS, retina was removed and the remaining eyecup or RPE wholemount was processed for staining. The RPE tissue was wholemounted with mounting media, coverslip and sealed. Images were acquired by Leica SP5. Native GFP fluorescence were observed in retina and RPE cells (
(301) To target the RPE cells, the present Example utilized a mini-nucleosome core protein (SEQ ID NO: 392) that could bind to the phagocytic proteins like MERTK. RPE are phagocytic cells, that extend their microvilli to the photoreceptor inner/outer segment junction. MERTK is expressed in those microvilli. In SEQ ID NO: 392, we incorporated the eat me signals as descried in Table 8. In literature, eat me signals are described as domains exposed in cellular debris that are primed for phagocytosis (Wei Li, Journal of Cell physiology, 2016, which is incorporated herein by reference). To the present inventor's knowledge, these eat me signals have never been utilized in the context of non-viral vectors before. These eat me signal domains have not been previously applied for non-viral vectors to target the RPE cells.
(302) To selectively transduce photoreceptors, the present Example utilized core proteins like those of SEQ ID NO:394. SEQ ID NO:394 included a neuronal attachment element (LRE) described herein Table 8, that could allow transduction into ganglion cells, bipolar cells and photoreceptors which are all neurons in the retina (
(303) Provided herein are techniques to deliver loaded mini-nucleosomes into different cell types in the retina using intravitreal, suprachoroidal, or subretinal mode of delivery. Diseases like retinal degeneration are mostly caused by mutations in genes expressed in the photoreceptors. Age-related macular degeneration (AMD), is a disease of retinal pigment epithelium (RPE) and choriocapillaries, that affects >10 million Americans and >100 million people worldwide, Currently, the predominant technology to deliver gene therapy vectors to photoreceptors and RPE is a surgical technique where viruses are injected subretinally into the retina. However, subretinal procedure is a complex surgery performed in the operating room by a trained Ophthalmic surgeon. There is an unmet need at least in that, in the United states, there are only a handful of surgeons trained to perform this surgery. One way to reduce the burden for patients and physicians is to develop vectors that can be injected intravitreally that can pass through the retina to transduce the photoreceptors and RPE. Intravitreal injection can be performed by all ophthalmologist in an in-patient visit. Loaded mini-nucleosome therapy solves this problem as intravitreal injections could transduce photoreceptors and RPE selectively (
(304) When injected intraocular, the loaded mini-nucleosomes may be delivered at a dose greater than 1e5 genome copies per eye and up to a dose of 1e25 copies per eye (e.g., at about 1e5, 1e6, 1e7, 1e8, 1e9, 1e10, 1e15, 1e20, or 1e25 copies per, or any range there between). Volume of the material may range from 10-500 microliters when injected subretinally (e.g., 1, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, or 500 microliters) and 10-250 microliters when injection is intravitreal, suprachoroidal, or intracameral (e.g., 1, 5, 10, 20, 30, 40, 50, 100, 150, 200, or 250 microliters). A loaded mini-nucleosome therapeutic agent may also be administered repeatedly (e.g., a selected volume and/or number of genome copies can be administered multiple times or divided among two or more does).
Example 6: Route of administration-Intranasal
(305) This example demonstrates that loaded mini-nucleosomes can be delivered by intra-nasal route to express proteins in lung, trachea, and gut cells. In the present Example, to target epithelial cells in the lung epithelium, 2 NGR amino acid domains were included in a mini-nucleosome core protein alongside nucleic acid binding domains (see use of NGR amino acid domains SEQ ID NO: 390). To the present inventor's knowledge, NGR domains have never been utilized to create and deliver non-viral DNA/protein complexes to retinal cells as disclosed herein. NGR domains in AAV2 have been shown to promote V5 integrin binding. NGR domains are implicated in heparan sulfate binding, known as receptor for AAV2.
(306) In the present Example, Balb/c mice were anesthetized by IP injection with Ketamine/Xylazine (90-100 mg/kg+10 mg/kg) and the anesthetized mice were positioned underneath a microscope for visual of the nasal area for intranasal delivery. 1 l of loaded mini-nucleosome (SEQ ID NO: 390+GFP plasmid) solution was delivered into the nasal cavity every few seconds until 12 microliters were delivered to each nasal side. Total dose of 25 micrograms was delivered. Following sacrifice, mice lung was processed to obtain 10 micron thick sections. Sections were washed in PBS and incubated in blocking buffer (0.1% TritonX-100, 1% BSA, 3% donkey serum) for 1 hr and then incubated in CFTR antibody (prepared on blocking buffer) blocking buffer overnight at 4 degree Celsius. Next day wash in PBS 35 min and incubated in AlexaFlour-555 (Donkey Anti-rabbit IgG secondary) in blocking buffer at RT for 1 hour and washed in PBS 35 min. Mounting media was added and coverslip was applied and sealed. Native fluorescence of GFP was obtained in the 486 nm channel of Leica SP5 scope in the 486-nm wavelength and CFTR expression in the 555-nm channel. We observed loaded mini-nucleosomes expression as early as 3 days and at PI-3 months as well (
(307) In the present Example, whole lung tissue and biodistribution via mini-nucleosome was also evaluated (
(308) Provided herein are techniques to deliver loaded mini-nucleosomes into different cell types in tissues of the pulmonary space such as lung epithelium, and/or trachea using intranasal mode of delivery. Genetic diseases such as cystic fibrosis affect the lung and other organs. To deliver genes to the lung, the intranasal is one of the routes of choices. We observed that loaded-mini-nucleosomes when delivered intranasally, expresses proteins in the alveoli and bronchioles (
(309)
(310) When injected intranasally, the loaded mini-nucleosomes may be delivered at a dose greater than 1e5 genome copies per kg and up to a dose of 1e25 copies per kg of body weight (e.g., at about 1e5, 1e6, 1e7, 1e8, 1e9, 1e10, 1e15, 1e20, or 1e25 copies per kg of body weight, or any range there between). Volume of the material may range from 1-200 milliliters (e.g., 1, 5, 10, 20, 30, 40, 50, 100, or 200 milliliters). The loaded mini-nucleosomes may also be administered repeatedly. The loaded mini-nucleosomes may also be delivered orally to access gut, pancreas etc.
Example 7: Route of Administration-Intramuscular
(311) This example demonstrates that loaded mini-nucleosomes can be delivered by intra-muscular route to express proteins in the muscle cells. Balb/c mice were anesthetized by IP injection with Ketamine/Xylazine (90-100 mg/kg+10 mg/kg) and several loaded mini-nucleosomes were injected into both leg muscle at 17.5 g doses per leg using an insulin syringe (Total dose 35 micrograms per mice). Mice were sacrificed at various time points and leg muscle were obtained for tissue sections. Constructs that contained core proteins such as polylysine (SEQ ID NO: 393) or mini-nucleosome with other domain combinations (SEQ ID NO: 389) didn't exhibit GFP fluorescence at the 3-month time point. Surprisingly, in muscle tissue sections obtained from 3-months post injections, we observed sharp green fluorescence in skeletal muscle cells injected with loaded mini-nucleosomes with containing galactose and fucose binding domain as shown in SEQ ID NO: 391 (
(312) To validate muscle specificity of expression of genes encoded by the nucleic acid cargo, we utilized dystrophin immunolabeling as an endogenous secondary marker. Regions of sharp green fluorescence (panel A) encircled by red fluorescence (panel B; merged in panel C) of Dystrophin staining clearly demonstrates that loaded mini-nucleosomes injected intramuscularly can deliver genes to muscle cells (
(313) Provided herein are techniques to deliver loaded mini-nucleosomes into muscle cells by intramuscular mode of delivery. Many genetic muscular dystrophies lead to atrophy of the muscle cells. To deliver functional genes to these muscle cells, intramuscular route provides direct routes of administration. We demonstrated the muscle tropism and ability of loaded-mini-nucleosomes to express genes in the skeletal muscle cells (
(314) When injected via intramuscular route, the loaded mini-nucleosomes may be delivered at a dose greater than 1e5 genome copies per kg and up to a dose of 1e25 copies per kg of body weight (e.g., at about 1e5, 1e6, 1e7, 1e8, 1e9, 1e10, 1e15, 1e20, or 1e25 copies per kg body weight, or any range there between). Volume of the material may range from 1-900 milliliters (e.g., 1, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, or 900 milliliters). The loaded mini-nucleosomes may also be administered repeatedly (e.g., a selected volume and/or number of genome copies can be administered multiple times or divided among two or more does). The loaded mini-nucleosomes may also be administered intravenously to access muscle cells.
Example 8: Loaded Mini-Nucleosomes are Redosable
(315) This example demonstrates that mini-nucleosomes can be re-administered without any neutralizing effect on the expression of proteins (
(316) Provided herein are examples of mini-nucleosome core proteins and loaded mini-nucleosome that can be delivered repeatedly to boost expression levels of desired proteins. Redosability is a very important feature for any drug that may require repeat administration. In gene therapy, currently one of the most undesirable features of viral vectors is the inability to re-administer drug products. Viral vector once injected into the patient leads to formation of neutralizing antibodies. This causes immunogenicity and inexpressibility when they are administered the second time. We show here that, mini-nucleosome mediated gene delivery solves this problem. The non-immunogenic nature of mini-nucleosome is engineered in by design: by combining self-peptides or human derived amino acid sequences and enhanced by pegylation. In literature, pegylated proteins have been shown to evade the immune system. In this case, in mice, lack of immunogenicity for artificial human derived core proteins, further validates the case for pegylation. This redosability feature will allow multiple treatments to patients when needed. In case of diminishing expression levels over time, this redosable feature will allow repeat treatment to boost the expression to desired levels. This piece of data also shows that in some patients that need multi-organ injections, mini-nucleosome mediated gene transfer will be most desirable. One skilled in the art may also contemplate repeat dosing via many other routes of administration such as topical, oral, vaginal, intraperitoneal, intraocular, intrathecal, intracerebral, subcutaneous etc. or via encapsulation in liposomes or other synthetic materials.
(317) Repeat doses may be delivered at a concentration greater than 1e5 genome copies per kg and up to a dose of 1e25 copies per kg of body weight (e.g., at about 1e5, 1e6, 1e7, 1e8, 1e9, 1e10, 1e15, 1e20, or 1e25 copies per kg body weight, or any range there between). Volume of the material may range from 1-900 milliliters (e.g., 1, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, or 900 milliliters). The loaded mini-nucleosomes may also be administered repeatedly (e.g., a selected volume and/or number of genome copies can be administered multiple times or divided among two or more does).
Example 9: General techniques
(318) This example describes general techniques for cloning, delivery of min-nucleosomes into cells. Some of the cloning techniques that can be applied to constructing these vectors may include-synthesis of transgene constructs, TOPO PCR cloning, blunt end cloning, seamless cloning, long fragment cloning, restriction enzyme digestion and ligation but not limited to these techniques. DNA or RNA molecules may express one or more expression markers such as GFP, YFP and Luciferase but not limited to it. DNA or RNA molecules may express one or more therapeutic RNA or proteins but not limited to it.
(319) Loaded mini-nucleosomes can be tested for their function and characterized in vitro by expressing them in HEK cells or other animal cell lines. Ability of synthesized and/or purified loaded mini-nucleosomes to transduce hematopoietic stem cells or differentiated peripheral blood mononuclear cells can be assayed by exposing the cells to the loaded mini-nucleosomes in culture. Loaded mini-nucleosomes can also be tested for their function and ability to form chimeric T cells in vitro by exposure to mini-nucleosomes or via techniques of transfection, or other physical methods for insertions. Loaded mini-nucleosomes can be tested for their function and characterized in vivo by delivering in mice or any other animal models but not limited to it.
Example 10: Phosphorylated Mini-Nucleosome Core Proteins Deliver Nucleic Acid Payloads to Neurons and Central Nervous System Cells
(320) The present Example demonstrates that a mini-nucleosome core protein including one or more residues modified by phosphorylation is particularly advantageous at least for expression of a nucleic acid payload (i.e., expression of an expression product encoded by a nucleic acid payload) in certain cells or tissues. For example, a mini-nucleosome core protein including one or more residues modified by phosphorylation can be particularly advantageous for expression of a nucleic acid payload in central nervous system cells including neurons, and particularly including spinal cord cells and brain neurons.
(321) Modified mini-nucleosome core proteins were prepared by phosphorylation of a mini-nucleosome core protein having an amino acid sequence according to SEQ ID NO: 399. In particular, a threonine residue at position 11 of the mini-nucleosome core protein was phosphorylated. This residue is positioned in a linker domain (VT) of the mini-nucleosome core protein. However, the present disclosure provides that the presence of the modification, rather than the particular position of the modification within the mini-nucleosome core protein, determines the characteristics of the mini-nucleosome core proteins disclosed herein. Without wishing to be bound by any particular scientific theory, the present Example includes the recognition that modifications of mini-nucleosome core proteins according the present Example can interact with cell surface receptors, improving delivery of loaded mini-nucleosomes to certain target cells. Accordingly, the present disclosure provides that phosphorylation of any amino acid residue(s) of a mini-nucleosome core protein, in particular a serine, threonine, or tyrosine, would provide equivalent advantages and characteristics as phosphorylation of the particular residue of the particular mini-nucleosome core protein modified in the present Example. Unmodified mini-nucleosome core proteins according to the same amino acid sequence were also included in the present example as a control.
(322) Mini-nucleosome core proteins of the present Example were loaded with a nucleic acid payload that included a gene encoding luciferase. In the present Example, luciferase is representative of protein expression generally, in that expression of luciferase is indicative of the ability of a mini-nucleosome core protein modified as disclosed herein and discussed in the present Example to successfully delivery any nucleic acid payload for expression of any expression product. Loaded mini-nucleosomes of the present Example were administered intrathecally to one or more 9-10 week old Balb/c mice (3e10 gc/mouse; 10 l volume).
(323) Results are shown in
Example 11: Sulfated Mini-Nucleosome Core Proteins Deliver Nucleic Acid Payloads to Neurons and Central Nervous System Cells
(324) The present Example demonstrates that a mini-nucleosome core protein including one or more residues modified by sulfation is particularly advantageous at least for expression of a nucleic acid payload (i.e., expression of an expression product encoded by a nucleic acid payload) in certain cells or tissues. For example, a mini-nucleosome core protein including one or more residues modified by sulfation can be particularly advantageous for expression of a nucleic acid payload in central nervous system cells including neurons, and particularly including spinal cord cells and brain neurons.
(325) Modified mini-nucleosome core proteins were prepared by sulfation of a mini-nucleosome core protein having an amino acid sequence according to SEQ ID NO: 388. In particular, a tyrosine residue at position 38 of the mini-nucleosome core protein was sulfated. This residue is positioned in a targeting domain (FYQPL) of the mini-nucleosome core protein. However, the present disclosure provides that the presence of the modification, rather than the particular position of the modification within the mini-nucleosome core protein, determines the characteristics of the mini-nucleosome core proteins disclosed herein. Without wishing to be bound by any particular scientific theory, the present Example includes the recognition that modifications of mini-nucleosome core proteins according the present Example can interact with cell surface receptors, improving delivery of loaded mini-nucleosomes to certain target cells. Accordingly, the present disclosure provides that sulfation of any amino acid residue(s) of a mini-nucleosome core protein, in particular a serine, threonine, or tyrosine, would provide equivalent advantages and characteristics as sulfation of the particular residue of the particular mini-nucleosome core protein modified in the present Example. Unmodified mini-nucleosome core proteins according to the same amino acid sequence were also included in the present example as a control.
(326) Mini-nucleosome core proteins of the present Example were loaded with a nucleic acid payload that included a gene encoding luciferase. In the present Example, luciferase is representative of protein expression generally, in that expression of luciferase is indicative of the ability of a mini-nucleosome core protein modified as disclosed herein and discussed in the present Example to successfully delivery any nucleic acid payload for expression of any expression product. Loaded mini-nucleosomes of the present Example were administered intrathecally to one or more 9-10 week old Balb/c mice (3e10 gc/mouse; 10 l volume).
(327) Results are shown in
Example 12: Acetylated Mini-Nucleosome Core Proteins Deliver Nucleic Acid Payloads to Neurons and Central Nervous System Cells
(328) The present example demonstrates that a mini-nucleosome core protein including one or more residues modified by acetylation is particularly advantageous at least for expression of a nucleic acid payload (i.e., expression of an expression product encoded by a nucleic acid payload) in certain cells or tissues. For example a mini-nucleosome core protein including one or more residues modified by acetylation can be particularly advantageous for expression of a nucleic acid payload in retinal cells, in particular photoreceptors
(329) Modified mini-nucleosome core proteins were prepared by acetylation of a mini-nucleosome core protein having an amino acid sequence according to SEQ ID NO: 401. In particular, a lysine residue at position 10 of the mini-nucleosome core protein was acetylated. This residue is positioned in a targeting domain (KKRPKP) of the mini-nucleosome core protein. However, the present disclosure provides that the presence of the modification, rather than the particular position of the modification within the mini-nucleosome core protein, determines the characteristics of the mini-nucleosome core proteins disclosed herein. Without wishing to be bound by any particular scientific theory, the present Example includes the recognition that modifications of mini-nucleosome core proteins according the present Example can interact with cell surface receptors, improving delivery of loaded mini-nucleosomes to certain target cells. Accordingly, the present disclosure provides that acetylation of any amino acid residue(s) of a mini-nucleosome core protein, in particular a lysine, would provide equivalent advantages and characteristics as acetylation of the particular residue of the particular mini-nucleosome core protein modified in the present Example. Unmodified mini-nucleosome core proteins according to the same amino acid sequence were also included in the present example as a control.
(330) Mini-nucleosome core proteins of the present Example were loaded with a nucleic acid payload that included a gene encoding GFP. In the present Example, GFP is representative of protein expression generally, in that expression of GFP is indicative of the ability of a mini-nucleosome core protein modified as disclosed herein and discussed in the present Example to successfully delivery any nucleic acid payload for expression of any expression product. Loaded mini-nucleosomes of the present Example were administered intravitreally to one or more mice. For intravitreal injections, mice were anesthetized by IP injection with Ketamine/Xylazine (90-100 mg/kg+10 mg/kg), a target pupil was dilated under a microscope using topical Tropicamide (1%), and an incision/insertion was made on the sclera 1 mm below the limbus using a 30-gauge needle. 1 l of loaded mini-nucleosome was injected into the vitreous cavity using 32 gauge blunt needle passing through the incision made by the 25-gauge needle.
(331) Results are shown in
(332) Panels A-C of
Example 13: Phosphorylated Mini-Nucleosome Core Proteins Deliver Nucleic Acid Payloads to Neurons and Central Nervous System Cells
(333) The present Example demonstrates that a mini-nucleosome core protein including one or more residues modified by mannosylation is particularly advantageous at least for expression of a nucleic acid payload (i.e., expression of an expression product encoded by a nucleic acid payload) in certain cells or tissues. For example, a mini-nucleosome core protein including one or more residues modified by mannosylation can be particularly advantageous for expression of a nucleic acid payload in retinal cells, in particular photoreceptors.
(334) Modified mini-nucleosome core proteins were prepared by mannosylation of a mini-nucleosome core protein having an amino acid sequence according to SEQ ID NO: 447. In particular, a serine residue at position 9 of the mini-nucleosome core protein was mannosylated. This residue is positioned in a linker domain (GGS) of the mini-nucleosome core protein. However, the present disclosure provides that the presence of the modification, rather than the particular position of the modification within the mini-nucleosome core protein, determines the characteristics of the mini-nucleosome core proteins disclosed herein. Without wishing to be bound by any particular scientific theory, the present Example includes the recognition that modifications of mini-nucleosome core proteins according the present Example can interact with cell surface receptors, improving delivery of loaded mini-nucleosomes to certain target cells. Accordingly, the present disclosure provides that mannosylation of any amino acid residue(s) of a mini-nucleosome core protein, in particular a serine, would provide equivalent advantages and characteristics as mannosylation of the particular residue of the particular mini-nucleosome core protein modified in the present Example. Unmodified mini-nucleosome core proteins according to the same amino acid sequence were also included in the present example as a control.
(335) Mini-nucleosome core proteins of the present Example were loaded with a nucleic acid payload that included a gene encoding GFP. In the present Example, GFP is representative of protein expression generally, in that expression of GFP is indicative of the ability of a mini-nucleosome core protein modified as disclosed herein and discussed in the present Example to successfully delivery any nucleic acid payload for expression of any expression product. Loaded mini-nucleosomes of the present Example were administered subretinally to one or more mice. For subretinal injections, mice were anesthetized by IP injection with Ketamine/Xylazine (90-100 mg/kg+10 mg/kg), a target pupil was dilated under a microscope using topical Tropicamide (1%), and an incision/insertion was made on the sclera 1 mm below the limbus using a 30-gauge needle. 1 l of loaded mini-nucleosome was injected into the vitreous cavity using 32 gauge blunt needle passing through the incision made by the 25-gauge needle behind the retina. A micropump controlled injector was utilized for this procedure.
(336) Results are shown in
(337)
(338) TABLE-US-00022 CERTAINSEQUENCES: SEQIDNO:394 KKRHRK-[LINKER]-LRE-[LINKER]KRHRKLRRRRRLKRHRKKRHRK-[LINKER]- LRE-[LINKER]-K (where[LINKER]couldbeanyaminoacidsequencedescribedinTable12butnot limitedtoit) SEQIDNO:389 KKKRHRKRKRKRKRRRRKKK-[LINKER]-ASSLNIAK-[LINKER]-RRRR (where[LINKER]couldbeanyaminoacidsequencedescribedinTable12butnotlimitedtoit) SEQIDNO:390 KKKRK-[LINKER]-NGR-[LINKER]-KRKRKKRHRKKKKRRRRKRHRK-[LINKER]- NGR-[LINKER]-KKK (where[LINKER]couldbeanyaminoacidsequencedescribedinTable12butnotlimitedtoit) SEQIDNO:391 KKKRHRKKKKK-[LINKER]-RGD-[LINKER]-KKKK-[LINKER]-NTQIH-[LINKER]- RRRRR-[LINKER]-TPH-[LINKER]-KK (where[LINKER]couldbeanyaminoacidsequencedescribedinTable12butnot limitedtoit) SEQIDNO:392 KKKRK-[LINKER]-KTKKK-[LINKER]-AK-[LINKER]-KALKKK-[LINKER]- KKGKKKKRRRRKAAPKK (where[LINKER]couldbeanyaminoacidsequencedescribedinTable12butnot limitedtoit) SEQIDNO:393 CKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK CBA-F8plasmid SEQIDNO:460 TCGCGCGTTTCGGTGATCGAGGTGAGCCCCACGTTCTGCTTCACTCTCCCCATCTCCC CCCCCTCCCCACCCCCAATTTTGTATTTATTTATTTTTTAATTATTTTGTGCAGCGATG GGGGCGGGGGGGGGGGGGGGGCGCGCGCCAGGCGGGGCGGGGCGGGGCGAGGGG CGGGGCGGGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGCGCGCTCC GAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGC GCGCGGCGGGCGGGAGTCGCTGCGACGCTGCCTTCGCCCCGTGCCCCGCTCCGCCGC CGCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGG GCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTTAATGACGGCTTGT TTCTTTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCGGGAGGGCCCTTTGTGCGG GGGGGAGCGGCTCGGGGGGTGCGTGCGTGTGTGTGTGCGTGGGGAGCGCCGCGTGC GGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGCGGGCGCGGCGCGGGGCTTTGTGCG CTCCGCAGTGTGCGCGAGGGGAGCGCGGCCGGGGGCGGTGCCCCGCGGTGCGGGGG GGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCA GGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCCCTCCCCGAGT TGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTACGGGGCGTGGCGCGGGGC TCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGCC GCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGGAGCGCCGGC GGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATCGTGCGAGAG GGCGCAGGGACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTGGGAGGCGCC GCCGCACCCCCTCTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGA AATGGGCGGGGAGGGCCTTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCCTCTCCA GCCTCGGGGCTGTCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGG GGTTCGGCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCATG CCTTCTTCTTTTTCCTACAGCTCCTGGGCAACGTGCTGGTTATTGTGCTGTCTCATCAT TTTGGCAAAACCGGTCTCGAAGGCCTGCAGGCGGCCGCCGCCACCGCCACCATGCA AATAGCACTCTTCGCTTGCTTCTTTCTGAGCCTTTTCAATTTCTGCTCTAGTGCCATCA GAAGATACTACCTTGGTGCAGTGGAATTGTCCTGGAACTATATTCAGAGTGATCTGC TCAGTGTGCTGCATACAGACTCAAGATTTCTTCCTAGAATGTCAACATCTTTTCCATT CAACACCTCCATCATGTATAAAAAGACTGTGTTTGTAGAGTACAAGGACCAGCTTTT CAACATTGCCAAGCCCAGGCCACCCTGGATGGGTTTGCTAGGTCCTACCATTTGGAC TGAGGTTCATGACACAGTGGTCATTACACTTAAAAACATGGCTTCTCATCCTGTCAG TCTTCATGCTGTTGGTGTGTCCTACTGGAAAGCTTCTGAGGGAGATGAATATGAAGA TCAGACAAGCCAAATGGAGAAGGAAGATGATAAAGTTTTCCCTGGTGAAAGTCATA CTTATGTTTGGCAAGTCCTGAAAGAGAATGGTCCAATGGCCTCTGACCCTCCATGTC TCACTTACTCATATATGTCTCATGTGGATCTGGTGAAAGATTTGAATTCAGGCCTCAT TGGAGCTCTGCTAGTATGTAAAGAAGGCAGTCTCTCCAAAGAAAGAACACAGATGT TGTACCAATTTGTACTGCTTTTTGCTGTATTTGATGAAGGGAAGAGCTGGCACTCAG AAACAAACGACTCTTATACACAGTCTATGGATTCTGCATCTGCTAGAGACTGGCCTA AAATGCACACAGTCAATGGCTATGTAAACAGGTCTCTTCCAGGTCTGATTGGATGCC ATAGGAAATCAGTCTACTGGCACGTGATTGGAATGGGCACCACTCCTGAAATACACT CAATATTCCTCGAAGGTCACACATTTTTTGTGAGGAACCACCGTCAAGCTTCATTGG AGATATCACCAATAACTTTCCTTACTGCTCAAACACTCTTGATAGATCTTGGGCAGTT CCTACTATTTTGTCATATCTCTTCCCATAAACATGATGGCATGGAAGCTTATGTCAAA GTAGATAGCTGCCCTGAGGAATCCCAATGGCAAAAGAAAAATAATAATGAGGAAAT GGAAGATTATGATGATGATCTTTATTCAGAAATGGATATGTTCACATTGGATTATGA CAGCTCTCCTTTTATCCAAATTCGCTCGGTTGCTAAAAAGTACCCTAAAACTTGGAT ACATTATATTTCTGCTGAGGAGGAAGACTGGGACTATGCACCTTCAGTTCCTACCTC GGATAATGGAAGTTATAAAAGCCAGTATCTGAGCAATGGTCCTCATCGGATTGGTA GGAAATATAAAAAAGTCAGATTTATAGCATACACAGATGAAACCTTTAAGACTCGT GAAACTATTCAGCATGAATCAGGACTCTTGGGACCTTTACTTTATGGAGAAGTTGGA GACACACTGTTGATTATTTTTAAGAATCAAGCAAGCCGACCATATAACATTTACCCT CATGGAATCACTGATGTCAGTCCTCTACATGCAAGGAGATTGCCAAGAGGTATAAA GCACGTGAAGGATTTGCCAATTCATCCAGGAGAGATATTCAAGTACAAGTGGACAG TTACAGTAGAAGATGGACCAACTAAATCAGATCCACGGTGCCTGACCCGCTATTATT CAAGTTTCATTAACCCTGAGAGAGATCTAGCTTCAGGACTGATTGGCCCTCTTCTCA TCTGCTACAAAGAATCTGTAGATCAAAGGGGAAACCAGATGATGTCAGACAAAAGA AATGTCATCCTGTTTTCTATATTTGATGAGAACCAAAGCTGGTACATCACAGAGAAC ATGCAACGCTTCCTCCCCAATGCAGCTAAAACACAGCCCCAGGACCCTGGGTTCCAG GCCTCCAACATCATGCACAGCATCAATGGCTATGTTTTTGATAGCTTGGAGTTGACA GTTTGTTTGCATGAGGTGGCATACTGGCACATTCTCAGTGTTGGAGCACAGACAGAC TTCTTATCTATCTTCTTCTCTGGATATACTTTCAAACACAAAATGGTCTATGAAGATA CACTTACCCTGTTCCCATTCTCAGGAGAAACTGTCTTTATGTCGATGGAAAACCCAG GTCTATGGGTCTTGGGGTGTCATAATTCAGACTTTCGGAAGAGAGGTATGACAGCAT TGCTGAAAGTTTCTAGTTGTGACAAGAGCACTAGTGATTATTATGAAGAAATATATG AAGATATTCCAACACAGTTGGTGAATGAGAACAATGTCATTGATCCCAGAAGCTTCT TCCAGAATACAAATCATCCTAATACTAGGAAAAAGAAATTCAAAGATTCCACAATT CCAAAAAATGATATGGAGAAGATTGAGCCTCAGTTTGAAGAGATAGCAGAGATGCT TAAAGTACAGAGTGTCTCAGTTAGTGACATGTTGATGCTCTTGGGACAGAGTCATCC TACTCCACATGGCTTATTTTTATCAGATGGCCAAGAAGCCATCTATGAGGCTATTCA TGATGATCATTCACCAAATGCAATAGACAGCAATGAAGGCCCATCTAAAGTGACCC AACTCAGGCCAGAATCCCATCACAGTGAGAAAATAGTATTTACTCCTCAGCCCGGCC TCCAGTTAAGATCCAATAAAAGTTTGGAGACAACTATAGAAGTAAAGTGGAAGAAA CTTGGTTTGCAAGTTTCTAGTTTGCCAAGTAATCTAATGACTACAACAATTCTGTCAG ACAATTTGAAAGCAACTTTTGAAAAGACAGATTCTTCAGGATTTCCAGATATGCCAG TTCACTCTAGTAGTAAATTAAGTACTACTGCATTTGGTAAGAAAGCATATTCCCTTGT TGGGTCTCATGTACCTTTAAACGTGAGTGAAGAAAATAGTGATTCCAACATATTGGA TTCAACTTTAATGTATAGTCAAGAAAGTTTACCAAGAGATAATATATTATCAATGGA GAATGATAGATTACTCAGAGAGAAGAGGTTTCATGGAATTGCTTTATTGACCAAAG ATAATACTTTATTCAAAGACAATGTCTCCTTAATGAAAACAAACAAAACATATAATC ATTCAACAACTAATGAAAAACTACACACTGAGAGCCCAACATCAATTGAGAATAGT ACAACAGACTTGCAAGATGCCATATTAAAGGTCAATAGTGAGATTCAAGAAGTAAC AGCTTTGATTCATGATGGAACACTTTTAGGCAAAAATTCTACATATTTGAGACTAAA CCATATGCTAAATAGAACTACCTCAACAAAAAATAAAGACATATTTCATAGAAAAG ATGAAGATCCTATTCCACAAGATGAAGAGAATACAATCATGCCATTTTCCAAGATGT TGTTCTTGTCAGAATCTTCAAATTGGTTTAAAAAGACCAATGGAAATAATTCCTTGA ACTCTGAGCAAGAACATAGTCCAAAGCAATTAGTATATTTAATGTTTAAAAAATATG TAAAAAATCAAAGTTTCTTGTCAGAGAAAAATAAAGTCACAGTAGAACAGGATGGA TTTACAAAGAACATAGGACTTAAAGACATGGCTTTTCCACATAATATGAGCATATTT CTTACCACTTTGTCTAACGTACATGAAAATGGTAGGCACAATCAAGAAAAAAATATT CAGGAAGAGATAGAGAAGGAAGCACTAATTGAAGAGAAAGTAGTTTTGCCCCAGGT GCACGAAGCAACTGGCTCTAAGAATTTCTTGAAAGACATATTGATACTAGGCACTAG GCAAAATATAAGTTTATATGAAGTACATGTACCAGTACTTCAAAACATCACATCAAT AAACAATTCAACAAATACAGTACAGATTCACATGGAGCATTTCTTTAAAAGAAGGA AGGACAAGGAAACAAATTCAGAAGGCTTGGTAAATAAAACCAGAGAAATGGTAAA AAACTATCCAAGCCAGAAGAATATTACTACTCAACGTAGTAAACGGGCTTTGGGAC AATTCAGACTGTCAACTCAATGGCTTAAAACCATAAACTGTTCAACACAGTGTATCA TTAAACAGATAGACCACAGCAAGGAAATGAAAAAGTTCATTACTAAATCTTCCTTAT CAGATTCTTCTGTGATTAAAAGCACCACTCAGACAAATAGTTCTGACTCACACATTG TAAAAACATCAGCATTTCCACCAATAGATCTCAAAAGGAGTCCATTCCAAAACAAA TTTTCTCATGTTCAAGCATCATCCTACATTTATGACTTTAAGACAAAAAGTTCAAGA ATTCAAGAAAGCAATAATTTCTTAAAAGAAACCAAAATAAATAACCCTTCTTTAGCC ATTCTACCATGGAATATGTTCATAGATCAAGGAAAATTTACCTCCCCAGGGAAAAGT AACACAAACTCAGTCACATATAAGAAACGTGAGAACATTATTTTCTTGAAACCAACT TTGCCTGAAGAATCTGGCAAAATTGAATTGCTTCCTCAAGTTTCCATTCAAGAGGAA GAAATTTTACCTACAGAAACTAGCCATGGATCTCCTGGACACTTGAATCTCATGAAA GAGGTCTTTCTTCAGAAAATACAGGGGCCTACTAAATGGAATAAAGCAAAGAGGCA TGGAGAAAGTATAAAAGGTAAAACAGAGAGCTCTAAAAATACTCGCTCAAAACTGC TAAATCATCATGCTTGGGATTATCATTATGCTGCACAGATACCAAAAGATATGTGGA AATCCAAAGAGAAGTCACCAGAAATTATATCCATTAAGCAAGAGGACACCATTTTG TCTCTGAGGCCTCATGGAAACAGTCATTCAATAGGGGCAAATGAGAAACAAAATTG GCCTCAAAGAGAAACCACTTGGGTAAAGCAAGGCCAAACTCAAAGGACATGCTCTC AAATCCCACCAGTGTTGAAACGACATCAAAGGGAACTTAGTGCTTTTCAATCAGAAC AAGAAGCAACTGACTATGATGATGCCATCACCATTGAAACAATCGAGGATTTTGAC ATTTACAGTGAGGACATAAAGCAAGGTCCCCGCAGCTTTCAACAGAAAACAAGGCA CTATTTTATTGCAGCTGTGGAACGACTCTGGGACTATGGGATGAGTACATCTCATGT TCTACGAAATAGGTATCAAAGTGACAATGTACCTCAGTTCAAGAAAGTAGTTTTCCA GGAATTTACTGATGGCTCCTTTAGTCAGCCCTTATATCGTGGAGAATTAAATGAACA CCTGGGGTTGTTGGGCCCATATATAAGAGCAGAAGTTGAAGACAACATTATGGTAA CTTTCAAAAACCAGGCCTCCCGTCCCTACTCCTTCTATTCTAGCCTCATTTCTTATAA AGAAGATCAGAGAGGAGAAGAACCTAGAAGAAACTTTGTCAAGCCTAATGAAACC AAAATTTATTTTTGGAAAGTACAACATCATATGGCACCCACAGAAGATGAGTTTGAC TGCAAGGCCTGGGCTTATTTCTCTGATGTTGATCTTGAAAGAGATATGCACTCGGGA TTAATTGGACCCCTTCTGATTTGCCACGCGAACACACTGAATCCTGCTCATGGGAGA CAAGTGTCAGTACAGGAATTTGCTCTGCTTTTCACTATCTTTGATGAGACCAAGAGC TGGTACTTCACTGAAAACGTGAAAAGGAACTGCAAGACACCCTGCAATTTCCAGAT GGAAGACCCCACTTTGAAAGAGAATTATCGCTTCCATGCAATCAATGGTTATGTAAT GGATACCCTACCAGGCTTAGTAATGGCTCAAGATCAAAGGATTCGATGGTATCTTCT CAGCATGGGCAACAATGAGAACATCCAATCTATTCATTTCAGTGGACATGTTTTCAC TGTACGGAAAAAAGAGGAGTATAAAATGGCAGTGTACAACCTCTACCCAGGTGTTT TTGAGACTCTGGAAATGATACCATCCAGAGCTGGAATATGGCGAGTAGAATGCCTT ATTGGCGAGCACTTACAGGCTGGGATGAGCACTCTTTTTCTGGTGTACAGCAAGCAG TGTCAGATTCCTCTTGGAATGGCTTCTGGAAGCATCCGTGATTTCCAGATTACAGCTT CAGGACATTATGGACAGTGGGCCCCAAACCTGGCAAGACTTCATTATTCCGGATCAA TCAATGCCTGGAGTACCAAGGAGCCCTTTTCTTGGATCAAGGTAGATCTGTTGGCAC CAATGATTGTTCATGGCATCAAGACTCAGGGTGCTCGTCAGAAATTTTCCAGCCTTT ATATCTCTCAATTTATCATCATGTATAGCCTGGATGGGAAGAAGTGGCTGAGTTATC AAGGAAATTCCACTGGAACCTTAATGGTTTTCTTTGGCAATGTGGACTCATCTGGGA TTAAGCATAATAGTTTTAATCCTCCAATTATTGCTCGATATATCCGTTTGCACCCCAC TCATTCTAGCATCCGTAGTACTCTTCGCATGGAGTTGATGGGCTGTGATTTAAACAG TTGCAGCATACCATTGGGAATGGAAAGTAAAGTAATATCAGATACACAAATCACTG CCTCATCCTACTTCACCAACATGTTTGCTACTTGGTCTCCTTCACAAGCTCGACTTCA CCTCCAGGGAAGGACTAATGCCTGGCGACCTCAGGTGAATGATCCAAAACAATGGT TGCAAGTGGACTTACAAAAGACAATGAAAGTCACTGGAATAATAACCCAGGGAGTG AAATCTCTCTTTACCAGCATGTTTGTGAAAGAGTTCCTTATTTCCAGCAGTCAAGATG GCCATCACTGGACTCAAATTTTATACAATGGCAAGGTAAAGGTTTTTCAGGGGAATC AGGACTCATCCACACCTATGATGAATTCTCTAGACCCACCATTACTCACTCGCTATC TTCGAATTCACCCCCAGATCTGGGAGCACCAAATTGCTCTGAGGCTTGAGATTCTAG GATGTGAGGCCCAGCAGCAATACTGACCATGGCCCAACTTGTTTATTGCAGCTTATA ATGGTTACAAATAAAGCAATAGCATCACAAATTTCACAAATAAAGCATTTTTTTCAC TGCATTCTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTATCATGTCTGGATCTC GTTAACTCGAGGGATCCATCGATGTCGACTGCAGAGGCCTGCATGCAAGCTTGGTGT AATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAA CATACGAGCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCCTAATGAGTGAGCTAAC TCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCC AGCTGCATTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGC TCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCG GTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGC AGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCC GCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGA CGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCC CCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTG TCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATC TCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTC AGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGAC ACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTAT GTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAG AACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGG TAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAA GCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTAC GGGGTCTGACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATT ATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAAG CCCAATCTGAATAATGTTACAACCAATTAACCAATTCTGATTAGAAAAACTCATCGA GCATCAAATGAAACTGCAATTTATTCATATCAGGATTATCAATACCATATTTTTGAA AAAGCCGTTTCTGTAATGAAGGAGAAAACTCACCGAGGCAGTTCCATAGGATGGCA AGATCCTGGTATCGGTCTGCGATTCCGACTCGTCCAACATCAATACAACCTATTAAT TTCCCCTCGTCAAAAATAAGGTTATCAAGTGAGAAATCACCATGAGTGACGACTGA ATCCGGTGAGAATGGCAAAAGTTTATGCATTTCTTTCCAGACTTGTTCAACAGGCCA GCCATTACGCTCGTCATCAAAATCACTCGCATCAACCAAACCGTTATTCATTCGTGA TTGCGCCTGAGCGAGACGAAATACGCGATCGCTGTTAAAAGGACAATTACAAACAG GAATCGAATGCAACCGGCGCAGGAACACTGCCAGCGCATCAACAATATTTTCACCT GAATCAGGATATTCTTCTAATACCTGGAATGCTGTTTTTCCGGGGATCGCAGTGGTG AGTAACCATGCATCATCAGGAGTACGGATAAAATGCTTGATGGTCGGAAGAGGCAT AAATTCCGTCAGCCAGTTTAGTCTGACCATCTCATCTGTAACATCATTGGCAACGCT ACCTTTGCCATGTTTCAGAAACAACTCTGGCGCATCGGGCTTCCCATACAAGCGATA GATTGTCGCACCTGATTGCCCGACATTATCGCGAGCCCATTTATACCCATATAAATC AGCATCCATGTTGGAATTTAATCGCGGCCTCGACGTTTCCCGTTGAATATGGCTCAT AACACCCCTTGTATTACTGTTTATGTAAGCAGACAGTTTTATTGTTCATGATGATATA TTTTTATCTTGTGCAATGTAACATCAGAGATTTTGAGACACGGGCCAGAGCTGCA CBA-GFPplasmid SEQIDNO:395 TCGCGCGTTTCGGTGATGACGGTCGAGGTGAGCCCCACGTTCTGCTTCACTCTCCCC ATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTATTTATTTTTTAATTATTTTGTGC AGCGATGGGGGCGGGGGGGGGGGGGGGGCGCGCGCCAGGCGGGGCGGGGCGGGG CGAGGGGGGGGCGGGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGC GCGCTCCGAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAA GCGAAGCGCGCGGCGGGCGGGAGTCGCTGCGACGCTGCCTTCGCCCCGTGCCCCGC TCCGCCGCCGCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAG GTGAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTTAATGA CGGCTTGTTTCTTTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCGGGAGGGCCCT TTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGTGTGTGTGTGCGTGGGGAGCG CCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGCGGGCGCGGCGCGGGGC TTTGTGCGCTCCGCAGTGTGCGCGAGGGGAGCGCGGCCGGGGGCGGTGCCCCGCGG TGCGGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGG GGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCCC TCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTACGGGGCGTG GCGCGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGG GGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGG AGCGCCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATC GTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTG GGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGC AGGAAGGAAATGGGCGGGGAGGGCCTTCGTGCGTCGCCGCGCCGCCGTCCCCTTCT CCCTCTCCAGCCTCGGGGCTGTCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGG GCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACC ATGTTCATGCCTTCTTCTTTTTCCTACAGCTCCTGGGCAACGTGCTGGTTATTGTGCT GTCTCATCATTTTGGCAAAACCGGTCTCGAAGGCCTGCAGGCGGCCGCCGCCACCGC CACCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCG AGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGC GATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCC GTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGTGCTTCAGCCGC TACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTAC GTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGA GGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACT TCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCAC AACGTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAAGGTGAACTTCAAGAT CCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACA CCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGT CCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTC GTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAATCCATGGC CCAACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAATT TCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCAAACTCATCAA TGTATCTTATCATGTCTGGATCTCGTTAACTCGAGGGATCCATCGATGTCGACTGCA GAGGCCTGCATGCAAGCTTGGTGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATT GTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCC TGGGGTGCCTAATGAGTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCT TTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGCGCGGG GAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCGCTGCG CTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTT ATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAA AAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCC CCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGG ACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCC GACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCT TTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTG GGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTAT CGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGT AACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTG GCCTAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCC AGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTG GTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTC AAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAAACTCAC GTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTTAA ATTAAAAATGAAGTTTTAAATCAAGCCCAATCTGAATAATGTTACAACCAATTAACC AATTCTGATTAGAAAAACTCATCGAGCATCAAATGAAACTGCAATTTATTCATATCA GGATTATCAATACCATATTTTTGAAAAAGCCGTTTCTGTAATGAAGGAGAAAACTCA CCGAGGCAGTTCCATAGGATGGCAAGATCCTGGTATCGGTCTGCGATTCCGACTCGT CCAACATCAATACAACCTATTAATTTCCCCTCGTCAAAAATAAGGTTATCAAGTGAG AAATCACCATGAGTGACGACTGAATCCGGTGAGAATGGCAAAAGTTTATGCATTTCT TTCCAGACTTGTTCAACAGGCCAGCCATTACGCTCGTCATCAAAATCACTCGCATCA ACCAAACCGTTATTCATTCGTGATTGCGCCTGAGCGAGACGAAATACGCGATCGCTG TTAAAAGGACAATTACAAACAGGAATCGAATGCAACCGGCGCAGGAACACTGCCAG CGCATCAACAATATTTTCACCTGAATCAGGATATTCTTCTAATACCTGGAATGCTGTT TTTCCGGGGATCGCAGTGGTGAGTAACCATGCATCATCAGGAGTACGGATAAAATG CTTGATGGTCGGAAGAGGCATAAATTCCGTCAGCCAGTTTAGTCTGACCATCTCATC TGTAACATCATTGGCAACGCTACCTTTGCCATGTTTCAGAAACAACTCTGGCGCATC GGGCTTCCCATACAAGCGATAGATTGTCGCACCTGATTGCCCGACATTATCGCGAGC CCATTTATACCCATATAAATCAGCATCCATGTTGGAATTTAATCGCGGCCTCGACGT TTCCCGTTGAATATGGCTCATAACACCCCTTGTATTACTGTTTATGTAAGCAGACAGT TTTATTGTTCATGATGATATATTTTTATCTTGTGCAATGTAACATCAGAGATTTTGAG ACACGGGCCAGAGCTGCA CBA-Luciferaseplasmid SEQIDNO:396 TCGCGCGTTTCGGTGATGACGGTCGAGGTGAGCCCCACGTTCTGCTTCACTCTCCCC ATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTATTTATTTTTTAATTATTTTGTGC AGCGATGGGGGCGGGGGGGGGGGGGGGGCGCGCGCCAGGCGGGGGGGGCGGGG CGAGGGGCGGGGCGGGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCAGAGCGGC GCGCTCCGAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAA GCGAAGCGCGCGGCGGGCGGGAGTCGCTGCGACGCTGCCTTCGCCCCGTGCCCCGC TCCGCCGCCGCCTCGCGCCGCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAG GTGAGCGGGCGGGACGGCCCTTCTCCTCCGGGCTGTAATTAGCGCTTGGTTTAATGA CGGCTTGTTTCTTTTCTGTGGCTGCGTGAAAGCCTTGAGGGGCTCCGGGAGGGCCCT TTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGTGTGTGTGTGCGTGGGGAGCG CCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGCGGGCGCGGCGCGGGGC TTTGTGCGCTCCGCAGTGTGCGCGAGGGGAGCGCGGCCGGGGGCGGTGCCCCGCGG TGCGGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGG GGTGAGCAGGGGGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCCC TCCCCGAGTTGCTGAGCACGGCCCGGCTTCGGGTGCGGGGCTCCGTACGGGGCGTG GCGCGGGGCTCGCCGTGCCGGGCGGGGGGTGGCGGCAGGTGGGGGTGCCGGGCGG GGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGAGGGGCGCGGCGGCCCCCGG AGCGCCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTTTATGGTAATC GTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTGTGCGGAGCCGAAATCTG GGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCGGGGCGAAGCGGTGCGGCGCCGGC AGGAAGGAAATGGGCGGGGAGGGCCTTCGTGCGTCGCCGCGCCGCCGTCCCCTTCT CCCTCTCCAGCCTCGGGGCTGTCCGCGGGGGGACGGCTGCCTTCGGGGGGGACGGG GCAGGGCGGGGTTCGGCTTCTGGCGTGTGACCGGCGGCTCTAGAGCCTCTGCTAACC ATGTTCATGCCTTCTTCTTTTTCCTACAGCTCCTGGGCAACGTGCTGGTTATTGTGCT GTCTCATCATTTTGGCAAAACCGGTCTCGAAGGCCTGCAGGCGGCCGCCGCCACCGC CACCATGGAAGACGCCAAAAACATAAAGAAAGGCCCGGCGCCATTCTATCCGCTGG AAGATGGAACCGCTGGAGAGCAACTGCATAAGGCTATGAAGAGATACGCCCTGGTT CCTGGAACAATTGCTTTTACAGATGCACATATCGAGGTGGACATCACTTACGCTGAG TACTTCGAAATGTCCGTTCGGTTGGCAGAAGCTATGAAACGATATGGGCTGAATACA AATCACAGAATCGTCGTATGCAGTGAAAACTCTCTTCAATTCTTTATGCCGGTGTTG GGCGCGTTATTTATCGGAGTTGCAGTTGCGCCCGCGAACGACATTTATAATGAACGT GAATTGCTCAACAGTATGGGCATTTCGCAGCCTACCGTGGTGTTCGTTTCCAAAAAG GGGTTGCAAAAAATTTTGAACGTGCAAAAAAAGCTCCCAATCATCCAAAAAATTAT TATCATGGATTCTAAAACGGATTACCAGGGATTTCAGTCGATGTACACGTTCGTCAC ATCTCATCTACCTCCCGGTTTTAATGAATACGATTTTGTGCCAGAGTCCTTCGATAGG GACAAGACAATTGCACTGATCATGAACTCCTCTGGATCTACTGGTCTGCCTAAAGGT GTCGCTCTGCCTCATAGAACTGCCTGCGTGAGATTCTCGCATGCCAGAGATCCTATT TTTGGCAATCAAATCATTCCGGATACTGCGATTTTAAGTGTTGTTCCATTCCATCACG GTTTTGGAATGTTTACTACACTCGGATATTTGATATGTGGATTTCGAGTCGTCTTAAT GTATAGATTTGAAGAAGAGCTGTTTCTGAGGAGCCTTCAGGATTACAAGATTCAAAG TGCGCTGCTGGTGCCAACCCTATTCTCCTTCTTCGCCAAAAGCACTCTGATTGACAA ATACGATTTATCTAATTTACACGAAATTGCTTCTGGTGGCGCTCCCCTCTCTAAGGAA GTCGGGGAAGCGGTTGCCAAGAGGTTCCATCTGCCAGGTATCAGGCAAGGATATGG GCTCACTGAGACTACATCAGCTATTCTGATTACACCCGAGGGGGATGATAAACCGG GCGCGGTCGGTAAAGTTGTTCCATTTTTTGAAGCGAAGGTTGTGGATCTGGATACCG GGAAAACGCTGGGCGTTAATCAAAGAGGCGAACTGTGTGTGAGAGGTCCTATGATT ATGTCCGGTTATGTAAACAATCCGGAAGCGACCAACGCCTTGATTGACAAGGATGG ATGGCTACATTCTGGAGACATAGCTTACTGGGACGAAGACGAACACTTCTTCATCGT TGACCGCCTGAAGTCTCTGATTAAGTACAAAGGCTATCAGGTGGCTCCCGCTGAATT GGAATCCATCTTGCTCCAACACCCCAACATCTTCGACGCAGGTGTCGCAGGTCTTCC CGACGATGACGCCGGTGAACTTCCCGCCGCCGTTGTTGTTTTGGAGCACGGAAAGAC GATGACGGAAAAAGAGATCGTGGATTACGTCGCCAGTCAAGTAACAACCGCGAAAA AGTTGCGCGGAGGAGTTGTGTTTGTGGACGAAGTACCGAAAGGTCTTACCGGAAAA CTCGACGCAAGAAAAATCAGAGAGATCCTCATAAAGGCCAAGAAGGGCGGAAAGA TCGCCGTGTAATCCATGGCCCAACTTGTTTATTGCAGCTTATAATGGTTACAAATAA AGCAATAGCATCACAAATTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGT GGTTTGTCCAAACTCATCAATGTATCTTATCATGTCTGGATCTCGTTAACTCGAGGGA TCCATCGATGTCGACTGCAGAGGCCTGCATGCAAGCTTGGTGTAATCATGGTCATAG CTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGA AGCATAAAGTGTAAAGCCTGGGGTGCCTAATGAGTGAGCTAACTCACATTAATTGC GTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATG AATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTC GCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTC AAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGT GAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTT TTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAG GTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCC TCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCC TTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTA GGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTG CGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCC ACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTA CAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGAACAGTATTTGGTA TCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCG GCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGC GCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTC AGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATC TTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAAGCCCAATCTGAATA ATGTTACAACCAATTAACCAATTCTGATTAGAAAAACTCATCGAGCATCAAATGAAA CTGCAATTTATTCATATCAGGATTATCAATACCATATTTTTGAAAAAGCCGTTTCTGT AATGAAGGAGAAAACTCACCGAGGCAGTTCCATAGGATGGCAAGATCCTGGTATCG GTCTGCGATTCCGACTCGTCCAACATCAATACAACCTATTAATTTCCCCTCGTCAAA AATAAGGTTATCAAGTGAGAAATCACCATGAGTGACGACTGAATCCGGTGAGAATG GCAAAAGTTTATGCATTTCTTTCCAGACTTGTTCAACAGGCCAGCCATTACGCTCGTC ATCAAAATCACTCGCATCAACCAAACCGTTATTCATTCGTGATTGCGCCTGAGCGAG ACGAAATACGCGATCGCTGTTAAAAGGACAATTACAAACAGGAATCGAATGCAACC GGCGCAGGAACACTGCCAGCGCATCAACAATATTTTCACCTGAATCAGGATATTCTT CTAATACCTGGAATGCTGTTTTTCCGGGGATCGCAGTGGTGAGTAACCATGCATCAT CAGGAGTACGGATAAAATGCTTGATGGTCGGAAGAGGCATAAATTCCGTCAGCCAG TTTAGTCTGACCATCTCATCTGTAACATCATTGGCAACGCTACCTTTGCCATGTTTCA GAAACAACTCTGGCGCATCGGGCTTCCCATACAAGCGATAGATTGTCGCACCTGATT GCCCGACATTATCGCGAGCCCATTTATACCCATATAAATCAGCATCCATGTTGGAAT TTAATCGCGGCCTCGACGTTTCCCGTTGAATATGGCTCATAACACCCCTTGTATTACT GTTTATGTAAGCAGACAGTTTTATTGTTCATGATGATATATTTTTATCTTGTGCAATG TAACATCAGAGATTTTGAGACACGGGCCAGAGCTGCA
INCORPORATION BY REFERENCE
(339) The publications and patents referenced in this application have been incorporated in their entirety.
Non-Patent Literature
(340) 1. Lai, Y, Yue, Y and Duan, D Evidence for the failure of adeno-associated virus serotype 5 to package a viral genome 8.2 kb. (2010). Mol Ther 18:75-79. 2. Smith R.H. Adeno-associated virus integration: virus versus vector. Gene Ther. 2008; 15:817-822. 3. Fitzpatrick Z., Leborgne C, Barbon E., et al. Influence of Pre-existing Anti-capsid Neutralizing and Binding Antibodies on AAV Vector Transduction. Mol Ther Methods Clin Dev. 2018 Jun. 15; 9:119-129. 4. Guerra-Crespo M, Charli JL, Rosales-Garcia VH, Pedraza-Alva G, Perez-Martinez L. Polyethylenimine improves the transfection efficiency of primary cultures of post-mitotic rat fetal hypothalamic neurons. J Neurosci Methods. 2003; 127 (2): 179-92. 5. Sutapa Barua and Samir Mitragotri. Challenges associated with Penetration of Nanoparticles across Cell and Tissue Barriers: A Review of Current Status and Future Prospects. Nano today. 2014. 9 (2): 223-243. 6. Zabner, J., Fasbender, A.J., Moninger, T., Poellinger, D. A., and Welsh, M.J. Cellular and molecular barriers to gene transfer by a cationic lipid. J. Biol. Chem. (1995) 270:18997-19007. 7. Templeton NS, Senzer N (2011) Optimization of Non-Viral Gene Therapeutics Using Bilamellar Invaginated Vesicles. J Genet Syndr Gene Ther S5: 002 8. Wilke, M., Fortunati, E., van den Broek, M., Hoogeveen, A. T., and Scholte, B.J. Efficacy of a peptide-based gene delivery system depends on mitotic activity. Gene Ther. (1996) 3:1133-1142. 9. Ge Liu, DeShan Li, Murali K Pasumarthy, et al. 2003. Nanoparticles of Compacted DNA Transfect Postmitotic Cells. The Journal of Biological Chemistry. Vol. 278, No. 35, Issue of August 29, pp. 32578-32586 10. Michael W. Konstan, Pamela B. D., Jefferey S. W., Kathleen A. H., Robert C. S., Laura J. H. M., Tomasz H. K., Susannah L. H., Tamara L. F., Christopher R. G., Sharon M. O., Jennifer M. P., Osman M., Assem G. Z., Robert C. M., and Mark J. C. Compacted DNA Nanoparticles Administered to the Nasal Mucosa of Cystic Fibrosis Subjects Are Safe and Demonstrate Partial to Complete Cystic Fibrosis Transmembrane Regulator Reconstitution. 2004. Human Gene Therapy. 15:1255-1269 11. D'Souza SE, Ginsberg MH, Plow F. Arginyl-glycyl-aspartic acid (RGD): a cell adhesion motif. Trends Biochem Sci. 1991 July; 16 (7): 246-50. 12. Christian Hinderer, Nathan Katz, Elizabeth L. Buza, Cecilia Dyer, Tamara Goode, Peter Bell, Laura K. Richman, and James M. Wilson. Severe Toxicity in Nonhuman Primates and Piglets Following High-Dose Intravenous Administration of an Adeno-Associated Virus Vector Expressing Human SMN. 2018. Human Gene Therapy. Vol 29. No 3. 13. Wodrich H, Henaff D, Jammart B, Segura-Morales C, Seelmeir S, et al. (2010) A Capsid-Encoded PPxY-Motif Facilitates Adenovirus Entry. PLOS Pathog 6 (3): e1000808. 14. Kailash N. Pandey. Functional roles of short sequence motifs in the endocytosis of membrane receptors. Frontiers in Bioscience 14, 5339-5360 Jun. 1, 2009 15. Claire Sunyach, Angela Jen, Juelin Deng, Kathleen T. Fitzgerald, Yveline Frobert, Jacques Grassi, Mary W. McCaffrey, Roger Morris. The mechanism of internalization of glycosylphosphatidylinositol-anchored prion protein. The EMBO Journal Vol. 22 No. 14. pp. 3591+3601, 2003 16. Modesto Redrejo-Rodrguez, Daniel Muoz-Espn, Isabel Holguera, Mario Menca, and Margarita Salas. Functional eukaryotic nuclear localization signals are widespread in terminal proteins of bacteriophages. PNAS. 2012. Vol 109. No 45. 18482-18487. 17. Chee Kai Chan and David A Jans. Enhancement of Polylysine-Mediated Transferrinfection by Nuclear Localization Sequences: Polylysine Does Not Function as a Nuclear Localization Sequence. Human Gene Therapy. Vol 10. No 10. 1999. 18. Jans DA, Moll T, Nasmyth K, Jans P. Cyclin-dependent kinase site-regulated signal-dependent nuclear localization of the SW15 yeast transcription factor in mammalian cells. J Biol Chem. 1995 Jul. 21; 270 (29): 17064-7. 19. Kirchhausen T, 1999. Adaptors for clathrin-mediated traffic. Annu Rev Cell Dev. 1999; 15:705-32. 20. Stephanie VandeVondele Janos Voros, Jeffrey A. Hubbell. RGD-Grafted Poly-L-lysine-graft (polyethylene glycol) Copolymers Block Non-specific Protein Adsorption While Promoting Cell Adhesion. Biotechnology and Bioengineering, Vol. 82, No. 7, 2003 21. L. Feuz et al.: Small-angle neutron scattering of PLL grafted PEG molecular brushes. Eur. Phys. J. E 23, 237-245 (2007). 22. Sun Tian, Qingsheng Huang, Ying Fang, Jianhua Wu. (2011) FurinDB: a database of 20-residue furin cleavage site motifs, substrates and their associated drugs. International Journal of Molecular Sciences., 12, 1060-1065. 23. Najjar K, Erazo-Oliveras A, Pellois J. Delivery of proteins, peptides or cell-impermeable small molecules into live cells by incubation with the endosomolytic reagent of TAT. J Vis Exp. 2015; 103 24. Tashiro K, Sephel G. C., Weeks B., Sasaki, M., Martin, G. R., Kleinman, H. K. et al. 1989. A synthetic peptide containing the IKVAVA sequence form the A chain of Laminin mediates cell attachment, migration and neurite growth. J. Biol Chem. 264, 16174-16182. 25. Graf, J., Iwamoto, Y., Sasaki, M., Martin, G. R., Kleinman, H. K., Robey, F. A., et al. 1987. Identification of the major epithelial-cell attachment site (yigsr) in the b1-chain of Laminin. J. Invest. Dermatol., 88, 491. 26. Mishra, A., Gordon, V., Yang, L., Coridan, R. and Wong, G. (2008) HIV TAT forms pores in membranes by inducing saddle-splay curvature: potential role of bidentate hydrogen bonding. Angew. Chem., Int. Ed. 47, 2986-2989. 27. Rothbard, J.B., Jessop, T. C. and Wender, P.A. (2005) Adaptive translocation: the 28. role of hydrogen bonding and membrane potential in the uptake of guanidinium-rich transporters into cells. Adv. Drug Deliv. Rev. 57, 495-504. 29. Yuxin Chen, Michael T. Guarnieri Adriana I. Vasil, Michael L. Vasil, Colin T. Mant, and Robert S. Hodges. Role of Peptide Hydrophobicity in the Mechanism of Action of-Helical Antimicrobial Peptides. 2007. Antimicrobial Agents and Chemotherapy, April 2007, p. 1398-1406 30. Wu Z, Simister N E. Tryptophan- and dileucine-based endocytosis signals in the neonatal Fc receptor. J Biol Chem. 2001. eb 16; 276 (7): 5240-7. Epub 2000 Nov. 28. 31. John P. H. Thng, Rohyun Sung, Ming Ye Michael J. Hendzel. H.sub.1 family histones in the nucleus control of binding and localization by the C-terminal domain. J. Biol. Chem. 2005; 280:27809-27814 32. Cardin AD, Weintraub HJ (1989) Molecular modeling of protein-glycosamino-glycan interactions. Arteriosclerosis 9:21-32. 33. Torrent M, Nogue s MV, Andreu D, Boix E (2012) The CPC Clip Motif: A Conserved Structural Signature for Heparin-Binding Proteins. PLOS ONE 7 (8): e42692. doi: 10.1371/journal.pone.0042692 34. Nelson C. Di Paolo, Oleksandr Kalyuzhniy, and Dmitry M. Shayakhmetov. Fiber Shaft-Chimeric Adenovirus Vectors Lacking the KKTK Motif Efficiently Infect Liver Cells In Vivo. Journal of Virology, November 2007, p. 12249-12259 35. Laetitia Jean, Charlotte Mizon, William J. Larsen, Jacques Mizon and Jean-Philippe Salier. Unmasking a hyaluronan-binding site of the BX7B type in the H.sub.3 heavy chain of the inter--inhibitor family. Eur. J. Biochem. 268, 544+553 (2001) 36. Kokona Kouzi-Koliakos, George G. Koliakos, EffieC. Tsilibary, Leo T. Furcht S, and Aristidis S. Charonis. Mapping of Three Major Heparin-binding Sites on Laminin and Identification of a Novel Heparin-binding Site on theB1 Chain. The Journal of Biological Chemistry. 1989. Vol 264. No 30. 37. Joji lida, Alexandra M. L. Meijne, Theodore R. Oegema, Jr., Ted A. Yednock, Nicholas L. Kovach, Leo T. Furcht, and James B. McCarthy. A Role of Chondroitin Sulfate Glycosaminoglycan Binding Site in a4 1 Integrin-mediated Melanoma Cell Adhesion. The Journal of Biological Chemistry273, 5955-5962. 38. Melissa S. Maginnis, J. Craig Forrest, Sarah A. Kopecky-Bromberg, S. Kent Dickeson, Samuel A. Santoro, Mary M. Zutter, Glen R. Nemerow, Jeffrey M. Bergelson, and Terence S. Dermody. Betal Integrin Mediates Internalization of Mammalian Reovirus. Journal of Virology, March 2006, p. 2760-277 39. Alfred A. Reszka, Yokichi Hayashi, and Alan E Horwitz. Identification of Amino Acid Sequences in the Integrin/31 Cytoplasmic Domain Implicated in Cytoskeletal Association. The Journal of CeU Biology, Volume 117, Number 6, June 1992 1321-1330 40. Kusakawa T, Simakami T, Kaneko S, Yoshioka K, Murakami S. Functional interaction of hepatitis C Virus NS5B with Nucleolin GAR domain. J Biochemistry. 2007. Jun 141 (6) 917-27 41. C. Graham Knight, Laurence F. Morton, Anthony R. Peachey, Danny S. Tuckwell, Richard W. Farndale, and Michael J. Barnes. The Collagen-binding A-domains of Integrins al1 and a2B1Recognize the Same Specific Amino Acid Sequence, GFOGER, in Native (Triple-helical) Collagens. The Journal of Biological Chemistry. 2000. Vol 275. No. 1 42. Kalthoff C, Alves J, Urbanke C, Knorr R, Ungewickell EJ. (2002). Unusual structural organization of the endocytic proteins AP180 and epsin 1. J Biol Chem 277:8209-8216 43. Igor Beitia Ortiz de Zarate, Lilia Cantero-Aguilar, Magalie Longo, Clarisse Berlioz-Torrent, and Flore Rozenberg. Contribution of Endocytic Motifs in the Cytoplasmic Tail of Herpes Simplex Virus Type 1 Glycoprotein B to Virus Replication and Cell-Cell Fusion. Journal of Virology, December 2007, p. 13889-13903 44. Shaynoor Dramsi, Sophie Magnet, Sophie Davison, Michel Arthur. Covalent attachment of proteins to peptidoglycan. FEMS Microbiol Rev32 (2008) 307-320 45. Olli Pentikainen, Anna-Marja Hoffren, Johanna Ivaska, Jarmo Kapyla, Tommi Nyronen, Jyrki Heino, and Mark S. Johnson. RKKH Peptides from the Snake Venom Metalloproteinase of Bothrops jararaca Bind Near the Metal Ion-dependent Adhesion Site of the Human Integrin a2 I-domain. The Journal of Biological Chemistry. 274, 31493-31505. 46. Thomas Brand. The Popeye Domain Containing Genes and Their Function as CAMP Effector Proteins in Striated Muscle. J.Cardiovasc.Dev.Dis. 2018,5,18 47. Asch AS, Silbiger S, Heimer E, Nachman RL. Thrombospondin sequence motif (CSVTCG) is responsible for CD36 binding. Biochemical and biophysical research communications. Feb. 14 1992; 182 (3): 1208-1217. 48. Nora B Caberoy, Yixiong Zhoul and Wei Li. Tubby and tubby-like protein 1 are new MerTK ligands for phagocytosis. The EMBO Journal (2010) 29, 3898-3910 49. Chi-Yi Yu, Zhenhua Yuan, Zhongren Cao, Bing Wang, Chunping Qiao, Juan Li, Xiao Xiao. A muscle-targeting peptide displayed on AAV2 improves muscle tropism upon systemic delivery. Gene Ther. 2009 August; 16 (8): 953-962 50. H Buning, M U Ried, L Perabo, F M Gerner, NA Huttner, J Enssle and M Hallekn. Receptor targeting of adeno-associated virus vectors. Gene Therapy (2003) 10, 1142-1151. 51. Wischnjow A, Sarko D, Janzer M, Kaufman C, Beijer B, Brings S, Haberkorn U, Larbig G, Kubelbeck A, Mier W. Bioconjugate Chem. 2016; 27:1050-1057. 52. Lorraine M. Work, Hildegard Buning, Ela Hunt, Stuart A. Nicklin, Laura Denby, Nicola Britton, Kristen Leike, Margarete Odenthal, Uta Drebber, Michael Hallek, and Andrew H. Baker. Vascular Bed-Targeted in Vivo Gene Delivery Using Tropism-Modified Adeno-associated Viruses. Molecular Therapy. Vol. 13, No. 4, April 2006 53. Lorraine M. Work, Stuart A. Nicklin, Nick J. R. Brain, Kate L Dishart, Dan J. Von Seggern, Michael Hallek, Hildegard Buning and Andrew H. Baker. Development of Efficient Viral Vectors Selective for Vascular Smooth Muscle Cells. Molecular Therapy Vol. 9, No. 2, February 2004 54. Wadih Arap, Renata Pasqualini, Erkki Ruoslahti. Cancer Treatment by Targeted Drug Delivery to Tumor Vasculature in a Mouse Model. Science. 16 Jan. 1998: Vol. 279, Issue 5349, pp. 377-380 55. Dale D. Hunter, Brenda E. Porter, Joseph W. Mock, Steven R Adams, John R Merlie, and Joshua R. Sanes. Primary Sequence of a Motor Neuron-Selective Adhesive Site in the Synaptic Basal Lamina Protein S-Laminin. Cell, Vol. 59, 905-913, Dec. 1, 1989, 56. Eric Anderson, Sandra Maday, Jeff Sfakianos, Michael Hull, Bettina Winckler, David Sheff, Heike Flsch, and Ira Mellman. Transcytosis of NgCAM in epithelial cells reflects differential signal recognition on the endocytic and secretory pathways. The Journal of Cell Biology, Vol. 170, No. 4, Aug. 15, 2005 595-605 57. Matthew J. Bottomley. Structures of protein domains that create or recognize histone modifications., EMBO reports 5, 464-469 (2004). 58. Dahlin-Huppe K, Berglund EO., Ranscht B, Stallcup WB. Mutational analysis of the L1 neuronal cell adhesion molecule identifies membrane-proximal amino acids of the cytoplasmic domain that are required for cytoskeletal anchorage. Mol Cell Neurosci. 1997; 9 (2): 144-56. 59. P Zheng, J Eastman, S V Pol, and S W. Pimplikar. PAT1, a microtubule-interacting protein, recognizes the basolateral sorting signal of amyloid precursor protein Proc. Natl. Acad. Sci. USA. Vol. 95, pp. 14745-14750, December 1998 60. Daniel J.-F. Chinnapen, Himani Chinnapen, David Saslowsky, and Wayne I. Lencer. Rafting with cholera toxin: endocytosis and tra/cking from plasma membrane to ER. FEMS Microbiol Lett. 2007 January; 266 (2): 129-137. 61. D. Gowanlock R. Tervo, Bum-Yeol Hwang, Sarada Viswanathan, Loren L. Looger, David V. Schaffer, Alla Y. Karpova. A Designer AAV Variant Permits Efficient Retrograde Access to Projection Neurons. 2016, Neuron 92, 372-382 62. K Inabe, M Nishizawa, S Tajima, K Ikuta, and Y Aida. The YXXL sequences of a transmembrane protein of bovine leukemia virus are required for viral entry and incorporation of viral envelope protein into virions. J. Virol. 1999 February; 73 (2): 1293-301. 63. Ton-That, H., and O. Schneewind. 2003. Assembly of pili on the surface of C. diphtheriae. Mol. Microbiol.50:1429-1438. 64. Aravind Asokan, Julie B. Hamra, Lakshmanan Govindasamy, Mavis Agbandje-McKenna, and Richard J. Samulski. Adeno-Associated Virus Type 2 Contains an Integrin alpha 5 betal Binding Domain Essential for Viral Cell Entry. Journal of Virology, September 2006, p. 8961-8969 65. Ji-Seon Park, Dong-Hou Kim, Seung-Yong Yoon. Regulation of amyloid precursor protein processing by its KFERQ motif. BMB Rep. 2016; 49 (6): 337-342 66. Kobayashi M, Shimomura A, Hagiwara M, Kawakami K. Phosphorylation of ATF-1 enhancesits DNA binding and transcription of the Na,K-ATPase alpha 1 subunit gene promoter. Nucleic Acids Res. 1997; 25 (4): 877-882. doi: 10.1093/nar/25.4.877 67. Marie-Anne Robin, Subbuswamy K. Prabu, Haider Raza, Hindupur K. Anandatheerthavarada, and Narayan G. Avadhani. Phosphorylation Enhances Mitochondrial Targeting of GSTA4-4 through Increased Affinity for Binding to Cytoplasmic Hsp70. THE JOURNAL OF BIOLOGICAL CHEMISTRY. Vol. 278, No. 21, Issue of May 23, pp. 18960-18970, 2003. 68. Rossetto D, Avvakumov N, Ct J. Histone phosphorylation: a chromatin modification involved in diverse nuclear events. Epigenetics. 2012; 7 (10): 1098-1108. doi: 10.4161/epi.21975 69. Ojida, A., Mito-Oka, Y., Inoue, M. A., & Hamachi, I. (2002). First artificial receptors and chemosensors toward phosphorylated peptide in aqueous solution. Journal of the American Chemical Society, 124 (22), 6256-6258. 70. Anai, T., Nakata, E., Koshi, Y., Ojida, A., & Hamachi, I. (2007). Design of a hybrid biosensor for enhanced phosphopeptide recognition based on a phosphoprotein binding domain coupled with a fluorescent chemosensor. Journal of the American Chemical Society, 129 (19), 6232-6239. 71. Somers WS1, Tang J, Shaw GD, Camphausen RT. Insights into the molecular basis of leukocyte tethering and rolling revealed by structures of P- and E-selectin bound to SLe (X) and PSGL-1. Cell. 2000 Oct. 27; 103 (3): 467-79. 72. Farzan M., Mirzabekov T., Kolchinsky P., Wyatt R., Cayabyab M., Gerard N.P., Gerard C., Sodroski J., Choe H. Tyrosine sulfation of the amino terminus of CCR5 facilitates HIV-1 entry. Cell 96:667-676 (1999) 73. Gelb, M. H., Scholten, J. D., & Sebolt-Leopold, J. S. (1998). Protein prenylation: from discovery to prospects for cancer treatment. Current opinion in chemical biology, 2 (1), 40-48.
(341) 74. Xie, F., Li, P., Gong, J., Zhang, J., & Ma, J. (2015). The bisphosphonate zoledronic acid effectively targets lung cancer cells by inhibition of protein prenylation. Biochemical and biophysical research communications, 467 (4), 664-669.
(342) 75. Ochocki JD, Mullen DG, Wattenberg EV, Distefano MD. Evaluation of a cell penetrating prenylated peptide lacking an intrinsic fluorophore via in situ click reaction. Bioorg Med Chem Lett. 2011; 21 (17): 4998-5001. doi: 10.1016/j.bmcl.2011.04.138 76. Hosseini V, Dani C, Geranmayeh MH, Mohammadzadeh F, Nazari Soltan Ahmad S, Darabi M. Wnt lipidation: Roles in trafficking, modulation, and function. J Cell Physiol. 2019; 234 (6): 8040-8054. doi: 10.1002/jcp.27570 77. Walsh, C. T., Garneau-Tsodikova, S., & Gatto Jr, G. J. (2005). Protein posttranslational modifications: the chemistry of proteome diversifications. Angewandte Chemie International Edition, 44 (45), 7342-7372. 78. Shi, S. P., Chen, X., Xu, H. D., & Qiu, J. D. (2015). PredHydroxy: computational prediction of protein hydroxylation site locations based on the primary structure. Molecular BioSystems, 11 (3), 819-825. 79. Bartels MF, Winterhalter P R, Yu J, Liu Y, Lommel M, Mhrlen F, et al. (2016) Protein OMannosylation in the Murine Brain: Occurrence of Mono-O-Mannosyl Glycans and Identification of New Substrates. PLOS ONE 11 (11): e0166119.
(343) TABLE-US-00023 Publication Publication number date Author Assignee Title U S. Pat. No. 6,506,890 B1 Jan. 14, 2003 Mark J. C Mark J Method of nucleic acid compaction et al Cooper et al US20100203627 A1 Aug. 12, 2010 Mark J. C Copernicus Long term in vivo transgene et al Therapeutics expression US20110035819 A1 Feb. 10, 2011 Mark J. C Copernicus Codon optimized CFTR et al Therapeutics WO2011017313 A1 Feb. 10, 2011 Mark J Copernicus Method of administering non-viral Cooper Therapeutics nucleic acid vectors to the eye U.S. Pat. No. 9,486,540 (B2) Nov. 8, 2016 Harmon Copernicus Methods for delivery to the central 2016 Nov. 8 Bredan, Therapeutics nervous system of nucleic acid and nanoparticles to treat central Waszczak nervous system disorders Barbara WO2008137066 (A1) Nov. 13, 2008 Naash Univ Use of compacted nucleic acids Muna I, Oklahoma, nanoparticles in non-viral and Copernicus treatments of ocular diseases. Mark J. C Therapeutics WO1997030731A2 Aug. 28, 1997 Lollo Immune Method of preparing Charles P. Response polynucleotide-carrier complexes et. al. Corp Inc. for delivery to cells WO1998046274A2 Oct. 22, 1998 Burgess Avanti Polar Cationic polymers for nucleic Stephen Lipids Inc, Lipids, Inc. acid transfection W et. al. UAB Research Foundation EP1031626A1 Aug. 30, 2000 Erbacher Qiagen Method for stabilising and/or Christoph GmbH isolating nucleic acids et al. US2014134232 (A1) May 15, 2014 Boulikas Regulon Inc. Encapsulation of Teni Plasmid DNA (Lipogenes(TM)) and Therapeutic Agents with Nuclear Localization Signal/Fusogenic Peptide Conjugates into Targeted Liposome Complexes U.S. Pat. No. 5,844,107 Dec. 1, 1998 Richard, Case Compacted nucleic acids and their WH. et. al. Western delivery to cells Reserve Uni U.S. Pat. No. 5,166,320 Nov. 24, 1992 Wu G. Y Univ Carrier system and method for the and Wu C. Connecticut introduction of genes into H. mammalian cells US2017258933 (A1) Sep. 14, 2017 Jean- Texas A & Compositions and methods for the Phillipe P. M Univ Sys delivery of molecules into live cells US2017057997 (A1) Mar. 2, 2017 Je-Min C. IUCF-HYU 1. Cell penetrating peptide and et al. method for delivering biologically active substance using same