METHODS AND COMPOSITIONS FOR REDUCING CLOSTRIDIUM DIFFICILE INFECTION

20260108564 ยท 2026-04-23

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to methods and compositions for reducing the risk and severity of C. difficile infection. It is based, at least in part, on the discovery that a restricted fraction of the gut microbiota, including the bacterium Clostridium scindens, contributes substantially to resistance against C. difficile infection. Without being bound by any particular theory, it is believed that this is achieved through the biosynthesis of secondary bile acids.

Claims

1-42. (canceled)

43. A composition comprising a first isolated bacteria or spores thereof being Clostridium scindens expressing an enzyme that converts a bile acid to a secondary bile acid and a second isolated bacteria or spores thereof being selected from the group consisting of Clostridium hiranonis, Clostridium hylemonae, Clostridium sordellii, and a combination thereof.

44. The composition of claim 43, wherein the composition further comprises isolated bacteria or spores thereof being selected from the group consisting of Barnesiella intestihominis, Blautia hansenii, and Pseudoflavonifractor capillosus.

45. The composition of claim 43, wherein the composition is formulated for oral or rectal administration.

46. The composition of claim 45, wherein the composition formulated for oral or rectal administration further comprises a probiotic bacterium, probiotic yeast, or a combination thereof.

47. The composition of claim 45, wherein the composition formulated for oral or rectal administration is a liquid, suspension, dried powder, tablet, capsule or food product.

48. A method for reducing the risk of Clostridium difficile infection in a subject, reducing the severity of Clostridium difficile infection in a subject, decreasing the amount of Clostridium difficile toxin in a subject, increasing resistance to Clostridium difficile infection in a subject, reducing risk of developing Clostridium difficile-associated disease in a subject, treating Clostridium difficile-associated disease in a subject, or preventing a Clostridium difficile-associated disease in a subject comprising administering, to a subject in need of such treatment, an effective amount of the composition of claim 43.

49. The method of claim 48, wherein said effective amount of the composition is effective to cause engraftment of the administered bacteria in the intestine of the subject, as determined by 16S rRNA sequencing of subject feces two days following administration.

50. The method of claim 48, wherein the composition is administered to the subject in an amount effective to inhibit proliferation of Clostridium difficile in the subject.

51. The method of claim 48, wherein the composition is administered to the subject in an amount effective to reduce one or more clinical symptoms of Clostridium difficile infection selected from the group consisting of frequency and/or volume of diarrhea; fever; abdominal cramping, pain, and/or tenderness; elevated level white blood cells in the blood; loss of serum albumin; weight loss; appearance of pseudomembrane in the intestinal and/or rectal mucosa; and combinations thereof.

52. The method of claim 48, further comprising administering to the subject, an antibiotic, an immunotherapeutic agent, an herbal remedy, a probiotic, or combinations thereof.

53. The method of claim 48, further comprising identifying the subject with the Clostridium difficile infection, or at risk for Clostridium difficile infection, comprising obtaining an intestinal microbiota sample from the subject and determining the level of one or more bacterium present in the intestinal microbiota sample that can convert a primary bile acid to a secondary bile acid; comparing the level of the one or more bacterium in the sample with a reference bacterium level; and administering the composition to the subject when the level of one or more bacterium in the sample is lower than the bacterium reference level.

54. The method of claim 48, further comprising identifying the subject with the Clostridium difficile infection, or at risk for Clostridium difficile infection, comprising obtaining an intestinal microbiota sample from the subject and determining the activity or level of 7-hydroxysteroid dehydrogenase enzyme present in the intestinal microbiota sample; comparing the activity or level of 7-hydroxysteroid dehydrogenase enzyme in the sample with a reference 7-hydroxysteroid dehydrogenase enzyme activity or level; and administering the composition to the subject when the activity or level of 7-hydroxysteroid dehydrogenase enzyme in the sample is lower than the reference 7-hydroxysteroid dehydrogenase enzyme activity or level.

55. A kit comprising the composition of claim 46.

56. The method of claim 53, wherein the one or more bacterium is selected from the group consisting of Clostridium scindens, Clostridium hiranonis, Clostridium hylemonae, Clostridium perfringens, Clostridium sordellii, Proteocatella sphenisci, Lachnospiraceae 5_1_57FAA, Clostridiales VE202-05, Clostridiales VE202-26, and combinations thereof.

57. The method of claim 53, further comprising administering an antibiotic to the subject, wherein, when the level of one or more bacterium in the sample is equal to or greater than the bacterium reference level, the antibiotic administered to the subject is not an antibiotic selected from the group consisting of a -lactam antibiotic, clindamycin, a cephalosporin, a quinolone antibiotic, levofloxacin, fluoroquinolone, a macrolide antibiotic, trimethoprim, and a sulfonamide antibiotic.

58. The method of claim 48, further comprising identifying the subject with the Clostridium difficile infection, or at risk for Clostridium difficile infection, comprising obtaining a fecal sample from the subject and quantifying the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid present in the fecal sample; comparing the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid in the fecal sample with a reference bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid level; and administering the composition to the subject when the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid in the fecal sample is lower than the reference level.

59. A method of reducing risk of developing Clostridium difficile-associated disease in a subject receiving antibiotic therapy, comprising administering, to a subject in need of such treatment, an effective amount of the composition of claim 43.

60. A method of treating Clostridium difficile-associated disease in a subject receiving antibiotic therapy, comprising administering, to a subject in need of such treatment, an effective amount of the composition of claim 43.

61. A method of preventing a Clostridium difficile-associated disease in a subject, comprising administering, to a subject in need of such treatment, an effective amount of the composition of claim 43, wherein the Clostridium difficile-associated disease is Clostridium difficile colitis or pseudomembranous colitis.

62. A method of treating a Clostridium difficile-associated disease in a subject, comprising administering, to a subject in need of such treatment, an effective amount of the composition of claim 43, wherein the Clostridium difficile-associated disease is Clostridium difficile colitis or pseudomembranous colitis.

Description

4. BRIEF DESCRIPTION OF THE FIGURES

[0026] FIG. 1A-G. Different antibiotics induce distinct changes to C. difficile infection resistance and intestinal microbiota composition. Susceptibility to C. difficile infection following 3-day exposures to clindamycin (a), ampicillin (b), or enrofloxacin (c). Correlation of C. difficile colony-forming units (CFU) and C. difficile toxin expression in the cecum following challenge (d). Changes in intestinal microbiota composition as measured by fecal sampling prior to C. difficile infection challenge at time points indicated (e, f, and g). Each stacked bar represents the mean microbiota composition of three independently-housed animals for a given timepoint and group. ****P<0.0001, Spearman (two-tailed) (d). n=3 separately-housed animals per timepoint per group. Center values (mean), error bars (s.e.m.) (a, b, c). Results were representative of two independent experiments.

[0027] FIG. 2A-C. Stability of bacterial density following antibiotic administration. (a) Strategy for determining C. difficile susceptibility duration post-antibiotic exposure (n=3 separately-housed mouse colonies per antibiotic arm) and relating infection resistance to microbiota structure. (b) Correlation of C. difficile cfu and toxin in intestinal content following infection. (c) Bacterial density in intestinal content samples (feces) was quantified by quantitative RT-PCR of 16S rRNA genes using degenerate primers obtained at timepoints indicated following three-day exposure to ampicillin (amp), clindamycin (clinda) or enrofloxacin (enro). Results were representative of two independent experiments. Center values (mean), error bars (s.e.m.).

[0028] FIG. 3A-C. Precise murine microbiota features correlate with C. difficile infection resistance. Intestinal microbiota alpha diversity (Shannon index) (a) and Beta diversity as measured by unweighted UniFrac distances (b) of intestinal microbiota from antibiotic-exposed C. difficile susceptible (n=21), resistant (n=47), and pre-antibiotic exposed (n=15) animals. Correlation of individual bacterial OTUs with susceptibility to C. difficile infection (c). ***P<0.001, Mann-Whitney (two-tailed) (a). In (c), for Any biodiversity (n=68 animals, 173 OTUs), P<0.0005 for OTUs listed; for Low biodiversity (red box) where Shannon 1 (n=16 animals, 61 OTUs), P<0.05 for all OTUs listed; Spearman (two-tailed) with Benjamini-Hochberg correction. Center values (mean), error bars (s.e.m.) (a). Results were representative of two independent experiments.

[0029] FIG. 4. Correlation of intestinal bacterial species with resistance to C. difficile infection. Relative abundance of bacterial OTUs (97% sequence identity, >0.01% relative abundance; red), organized by class, among antibiotic-exposed mice (n=68) allowed to recover for variable time intervals prior to C. difficile infection challenge with 1,000 spores. Infection susceptibility of animals was evaluated by enumeration of C. difficile CFU recovered from the ceca of animals 24-hours post-challenge (blue) by selective, quantitative culture. Results were representative of two independent experiments.

[0030] FIG. 5A-C. Native intestinal bacteria that inhibit C. difficile are conserved across murine and human microbiota. Quantification of colonization (C. difficile-negative to -positive) and clearance (C. difficile-positive to -negative) events among C. difficile-diagnosed and carrier patients included in the human microbiota interaction inference model (a). A restricted fraction of intestinal bacteria are predicted to strongly interact with C. difficile in both the human (n=24 subjects, 112 samples) and murine (n=68 subjects, 240 samples) intestinal microbiota (b). These bacterial OTUs exist in a conserved subnetwork predicted to inhibit (blue) or positively associate (red) with C. difficile (c).

[0031] FIG. 6. Allo-HSCT patient timelines and C. difficile infection status transitions. Transitions between C. difficile (tcdB-positive) colonization status in patients receiving allogeneic hematopoietic stem cell transplantation, as measured by C. difficile 16S rRNA abundance during the period of hospitalization (light gray bars). Timepoints when C. difficile colonization was determined to be positive (red diamonds) and negative (blue diamonds), and when C. difficile infection was clinically diagnosed (black dots) and metronidazole was administered (dark gray bars), are displayed relative to the time of transplant per patient.

[0032] FIG. 7A-E. Identification of bacteria conserved across human and murine intestinal microbiota predicted to inhibit C. difficile. Identification of bacterial OTUs abundant in mice (n=68) and humans (n=24) (a) that account for a minority of OTU membership (b) but the majority of the structure of the intestinal microbiota of both host species following antibiotic exposure (c). Subnetworks of abundant OTUs predicted inhibit (blue) or positively associate with (red) C. difficile in murine (d) and human (e) intestinal microbiota.

[0033] FIG. 8. Phylogenetic distribution of resistance-associated intestinal bacteria and isolates selected for adoptive transfer. The maximum likelihood phylogenetic tree (Kimura model, bootstrap of 100 replicates) was constructed using the MEGA 6.06 package from representative sequences of intestinal bacteria associated with resistance to C. difficile infection (blue), including cultured representatives subsequently used in adoptive transfer experiments (bold). The tree was rooted using intestinal bacteria associated with susceptibility to infection (red) as an out-group.

[0034] FIG. 9A-H. Adoptive transfer of resistance-associated intestinal bacteria following antibiotic exposure increases resistance to C. difficile infection. Following treatment with antibiotics and a washout period, resistance-associated intestinal bacteria or vehicle were administered to mice and subsequently challenged with 1,000 C. difficile spores (n=10 per group). Susceptibility to infection was evaluated by quantification of C. difficile CFU (a) and toxin production (b) in mouse feces 24 hours after infection challenge. Weight loss (c) and mortality (d) were monitored for 21 days post-infection challenge. Correlations of adoptively transferred bacteria engrafted with C. difficile susceptibility (e), as well as microbiota biodiversity (f) were confirmed using high throughput 16S rRNA sequencing. (g) shows C. difficile cfu 24 hours after infection challenge with individual isolates of B. hansenii, B. intestihominis, and P. capillosus, (h) shows intestinal bacterial density in feces from antibiotic-exposed mice administered suspensions containing the four bacteria (B. hansenii, B. intestihominis, P. capillosus, and C. scindens), C. scindens alone, or PBS vehicle as measured by rtPCR of 16S rRNA genes. ****P<0.0001, ***P<0.001, **P<0.01, *P<0.05, ns (not significant); Mann-Whitney (a, c (day 2, see Extended Data FIG. 8)), Spearman (two-tailed) (b) with Benjamini-Hochberg correction (e), Log-rank test for trend (d), Kruskal-Wallis with Dunn's correction (f). Center values (median (a), mean (f)), error bars (range (a), s.e.m. (f)). Results were representative of at least two independent experiments.

[0035] FIG. 10. Adoptive transfer of four-bacteria consortium or C. scindens reduces intestinal C. difficile cytotoxin load. Antibiotic-exposed mice were administered a suspension containing a 4-bacteria consortium, C. scindens, or vehicle (PBS) (n=10 per group) and subsequently challenged with 1,000 C. difficile spores. C. difficile toxin was quantitated in feces 24 hours after infection challenge using a cell-based assay. ****P<0.0001, ***P<0.001, **P<0.01, *P<0.05; Mann-Whitney (two-tailed). Center values (mean), error bars (s.e.m.). Results were representative of at least two independent experiments.

[0036] FIG. 11. Adoptive transfer of four-bacteria consortium or C. scindens protects mice from acute C. difficile-associated weight loss. Antibiotic-exposed mice were administered a suspension containing a 4-bacteria consortium, C. scindens, or vehicle (PBS) (n=10 per group) and subsequently challenged with 1,000 C. difficile spores. Animals were weighed 48 hours after infection challenge. ***P<0.001, **P<0.01; Mann-Whitney (two-tailed). Center values (mean), error bars (s.e.m.). Results were representative of at least two independent experiments.

[0037] FIG. 12. Confirmation of in vivo reconstitution of adoptively transferred bacterial isolates. Engraftment of bacterial isolates in the intestinal microbiota of antibiotic-exposed animals was confirmed by analysis of high throughput rRNA sequencing of intestinal content (feces) obtained from mice two days following adoptive transfer of B. intestihominis, P. capillosus, B. hansenii, and/or C. scindens. Numbers under group columns denote the number of mice with detectable engraftment of the given bacterium (out of 10 possible separately-housed animals per group). ****P<0.0001, ***P<0.001, ns (not significant), Mann-Whitney (two-tailed). Center values (mean), error bars (s.e.m.).

[0038] FIG. 13A-H. C. scindens-mediated C. difficile inhibition is associated with secondary bile acid synthesis and dependent on bile endogenous to intestinal content. Secondary bile acid relative abundance, as measured by enzymatic assay (a), PICRUSt-predicted abundance of secondary bile acid biosynthesis gene family members (b) of intestinal content from antibiotic-exposed C. difficile susceptible (n=21), resistant (n=47), and pre-antibiotic (n=15) animals. Correlation of resistance to C. difficile infection with abundance of secondary bile acid biosynthesis gene family members in intestinal content samples (n=6) as quantified by shotgun sequencing (gylceroltransferase F51, endogenous reference gene) (c). Restoration of the intestinal abundance of the secondary bile acid deoxycholic acid (DCA) following adoptive transfer of the 4-bacteria consortium or C. scindens alone (n=10 per group) (d). Correlation of intestinal relative abundance of C. scindens, DCA, and baiCD among antibiotic-exposed, adoptively transferred animals (n=30). Shaded region around mean DCA abundance of pre-antibiotic (abx) represents standard deviation of the mean (solid line) (e). Bile acid-dependent inhibition of C. difficile enumerated by recovery of CFU after inoculation of vegetative C. difficile into intestinal content from clindamycin-treated animals (n=6 per group) seeded with vehicle (PBS) or C. scindens (with or without cholestyramine co-incubation) (f). Bile acid dependent inhibition of C. difficile was enumerated by recovery of cfu after inoculation of vegetative C. difficile into cell-free (g) or whole (d) intestinal content harvested from C57BL/6J mice (n=5 or 6 per group), with or without pre-incubation with cholestyramine. ****P<0.0001, ***P<0.001, **P<0.01, *P<0.05; Mann-Whitney (two-tailed) (a,b,f, g,h), Spearman (two-tailed) (c,e), Kruskal-Wallis with Dunn correction (d). Center values (mean), error bars (s.e.m.). Results were representative of at least two independent experiments.

[0039] FIG. 14. Presence and absence of baiCD among bacterial isolates and intestinal microbiomes of C. difficile-susceptible and resistant animals. PCR-based detection of the 7-HSDH-encoding baiCD gene in bacterial isolates, intestinal microbiomes (feces) of animals prior to antibiotic exposure, and intestinal microbiomes (feces) of animals that, following antibiotic exposure, remained C. difficile-susceptible or recovered resistance to infection spontaneously or following adoptive transfer of bacterial isolates.

[0040] FIG. 15. Adoptive transfer of four-bacteria consortium or C. scindens restores secondary bile acid biosynthesis gene family abundance. Adoptive transfer of the 4-bacteria consortium or C. scindens alone reconstitutes abundance of the secondary bile acid biosynthesis gene family in antibiotic-exposed animals (n=10 per group) according to predictive metagenomic functional profiling using PICRUSt. ***P<0.001, *P<0.05, ns (not significant); Mann-Whitney (two-tailed). Center values (mean), error bars (s.e.m.).

[0041] FIG. 16A-I. Impacts of bacteria adoptive transfers on intestinal abundance of bile acids. Adoptive transfer of the 4-bacteria consortium or C. scindens alone restores abundance of the secondary bile acid lithocholate (LCA) in antibiotic-exposed animals (n=10 per group) compared to unreconstituted antibiotic-exposed animals (a), but does not impact ursodeoxycholate (UDCA) levels (b), taurocholic acid (TCA) levels (c), cholic acid (CA) levels (d), chenodeoxycholic acid (CDCA) levels (e), or tauro-chenodeoxycholic acid (TCDCA) levels (f). (g) and (h) show that the addition of secondary bile acids DCA (g) or LCA (h) to culture media inhibits C. difficile growth. (i) shows the retention times for bile acids quantified by HPLC-MS. ****P<0.0001, *P<0.05, ns (not significant), Kruskal-Wallis test with Dunn's correction. Center values (mean), error bars (s.e.m.).

[0042] FIG. 17. Nucleic acid sequence of the gene encoding a 7-hydroxysteroid dehydrogenase enzyme from C. scindens.

5. DETAILED DESCRIPTION OF THE INVENTION

[0043] The present invention relates to methods and compositions for reducing the risk and/or severity of C. difficile infection. For clarity of description, and not by way of limitation, this section is divided into the following subsections: [0044] (i) Recombinant cells; [0045] (ii) Therapeutic bacteria; [0046] (iii) Pharmaceutical compositions; [0047] (iv) Methods of treatment; and [0048] (v) Non-limiting embodiments of the disclosure.

[0049] The following are terms relevant to the present invention:

[0050] An individual or subject herein is a vertebrate, such as a human or non-human animal, for example, a mammal. Mammals include, but are not limited to, humans, primates, farm animals, sport animals, rodents and pets. Non-limiting examples of non-human animal subjects include rodents such as mice, rats, hamsters, and guinea pigs; rabbits; dogs; cats; sheep; pigs; goats; cattle; horses; and non-human primates such as apes and monkeys.

[0051] An effective amount of a substance as that term is used herein is that amount sufficient to effect beneficial or desired results, including clinical results, and, as such, an effective amount depends upon the context in which it is being applied. In the context of administering a composition to reduce the risk of Clostridium difficile infection and/or increase resistance to Clostridium difficile infection in a subject, and/or administering a composition to reduce the severity of Clostridium difficile infection and/or decreasing the amount of Clostridium difficile toxin in a subject, an effective amount of a composition described herein is an amount sufficient to treat and/or ameliorate a Clostridium difficile infection, as well as decrease the severity and/or reduce the likelihood of a Clostridium difficile infection. The decrease can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98% or 99% decrease in severity of Clostridium difficile infection, or likelihood of becoming infected. An effective amount can be administered in one or more administrations.

[0052] As used herein, and as well-understood in the art, treatment is an approach for obtaining beneficial or desired results, including clinical results. For purposes of this subject matter, beneficial or desired clinical results include, but are not limited to, alleviation or amelioration of one or more symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, prevention of disease, delay or slowing of disease progression, and/or amelioration or palliation of the disease state. The decrease can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98% or 99% decrease in severity of complications or symptoms. Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment.

[0053] The term expression vector is used to denote a nucleic acid molecule that is either linear or circular, into which another nucleic acid sequence fragment of appropriate size can be integrated. Such nucleic acid fragment(s) can include additional segments that provide for transcription of a gene encoded by the nucleic acid sequence fragment. The additional segments can include and are not limited to: promoters, transcription terminators, enhancers, internal ribosome entry sites, untranslated regions, polyadenylation signals, selectable markers, origins of replication and such, as known in the art. Expression vectors are often derived from plasmids, cosmids, viral vectors and yeast artificial chromosomes; vectors are often recombinant molecules containing nucleic acid sequences from several sources.

[0054] The term operably linked, when applied to nucleic acid sequences, for example in an expression vector, indicates that the sequences are arranged so that they function cooperatively in order to achieve their intended purposes, i.e., a promoter sequence allows for initiation of transcription that proceeds through a linked coding sequence as far as the termination signal.

[0055] A nucleic acid molecule is a single or double stranded covalently-linked sequence of nucleotides in which the 3 and 5 ends on each nucleotide are joined by phosphodiester bonds. The polynucleotide can be made up of deoxyribonucleotide bases or ribonucleotide bases. Polynucleotides include DNA and RNA, and can be manufactured synthetically in vitro or isolated from natural sources.

[0056] The term promoter as used herein denotes a region within a gene to which transcription factors and/or RNA polymerase can bind so as to control expression of an associated coding sequence. Promoters are commonly, but not always, located in the 5 non-coding regions of genes, upstream of the translation initiation codon. The promoter region of a gene can include one or more consensus sequences that act as recognizable binding sites for sequence specific nucleic acid binding domains of nucleic acid binding proteins. Nevertheless, such binding sites can also be located in regions outside of the promoter, for example in enhancer regions located in introns or downstream of the coding sequence.

[0057] A regulatory gene is a gene involved in controlling the expression of one or more other genes.

5.1 RECOMBINANT CELLS

[0058] The present invention provides for therapeutic compositions which increase resistance to C. difficile infection, and/or reduce the amount of C. difficile toxin, and/or inhibit proliferation and/or growth of C. difficile in a subject. Such therapeutic compositions can comprise, for example, small molecule, polypeptide, or nucleic acid molecules.

[0059] In one non-limiting embodiment, the composition comprises a recombinant cell expressing an enzyme that converts a bile salt or acid to a secondary bile acid. In a non-limiting example, the recombinant cell comprises one or more exogenous nucleic acids encoding said enzyme, wherein the one or more exogenous nucleic acids are operably linked to a promoter.

[0060] In one non-limiting embodiment, the composition comprises a recombinant cell expressing a bile acid-inducible (bai) 7/-dehydroxylation operon. In a non-limiting example, the recombinant cell comprises one or more exogenous nucleic acids encoding a bile acid-inducible (bai) 7/-dehydroxylation operon, wherein the one or more exogenous nucleic acids are operably linked to a promoter.

[0061] In certain non-limiting embodiments, a bile acid-inducible (bai) 7/-dehydroxylation operon refers to a cluster of genes encoding a protein with enzymatic activity to convert primary bile acids to secondary bile acids. For example, the protein can convert a primary bile acid such as cholic acid (CA) and/or chenodeoxycholic acid (CDCA), into secondary bile acids such as deoxycholic acid (DCA) and lithocholic acid (LCA). In certain embodiments, the protein exhibits dehydroxylation activity. In other embodiments, the protein comprises a 7-hydroxysteroid dehydrogenase. Examples of such enzymes are 7-hydroxysteroid dehydrogenase enzymes expressed by Clostridium scindens, Clostridium hiranonis, Clostridium hylemonae, Clostridium perfringens, Clostridium sordellii, Proteocatella sphenisci, Lachnospiraceae 5_1_57FAA, Clostridiales VE202-05 and Clostridiales VE202-26, as well as active fragments thereof, and recombinant forms of said enzymes.

[0062] In certain non-limiting embodiments, the 7-hydroxysteroid dehydrogenase is the C. scindens enzyme having the following amino acid sequence:

TABLE-US-00001 (SEQIDNO:1) 1 mrlkdkvilvtastrgiglaiaqacakegakvymgarnle rakarademnaaggnvkyvy 61 ndatkeetyvtmieeiieqegridvlvnnfgssnpkkdlg iantdpevfiktvninlksv 121 fiasqtavkymaengggsiinissvgglipdisqiaygts kaainyltkliavhearhni 181 renavlpgmtatdavqdnltddfrnfflkhtpiqrmglpe eiaaavvyfasddaayttgq 241 iltvsggfglatpifgdlsersdarg
as set forth in GenBank Accession No. AAB61151, which may be encoded by a nucleic acid as set forth in GenBank Accession No. M58473, and as set forth in FIG. 17 (SEQ ID NO:2). In certain non-limiting embodiments, said enzyme may be provided by a host cell, such as a bacterium, engineered to contain a nucleic acid encoding SEQ ID NO: 1 or a protein having one, two, or three conservative substitutions therein, operably linked to a constitutively or inducibly active promoter element, as described herein. In a certain non-limiting embodiment, said enzyme may be provided by a host cell, such as a bacterium, engineered to contain and express a nucleic acid comprising SEQ ID NO:2 or a nucleic acid having a sequence that is at least 90 percent, or at least 95 percent, or at least 99 percent homologous thereto (where homology may be determined using standard software such as BLAST or FASTA). In certain non-limiting embodiments, the enzyme may be one of the following, or a combination thereof: an enzyme having the amino acid sequence set forth in GenBank Accession No. EIA17829 (7-hydroxysteroid dehydrogenase from Clostridium perfringens); and/or an enzyme having the amino acid sequence as set forth in GenBank Accession No. AAA53556 (7-hydroxysteroid dehydrogenase from Clostridium sordellii).

[0063] In one non-limiting embodiment, the recombinant cell further comprises one or more exogenous nucleic acids encoding a bile salt hydrolase, antibiotic resistance gene, and/or antibiotic susceptibility gene, wherein the nucleic acids are operably linked to a promoter.

[0064] In certain embodiments, the bile salt hydrolase is a bacterial bile salt hydrolase, for example, as encoded by a bshA and/or bshb gene of Lactobacillus acidophilus (See, e.g., McAuliffe et al., Appl Environ Microbiol. 2005 August; 71(8):4925-9.). Other bile salt hydrolases are described in Begley et al., Appl Environ Microbiol. 2006 March; 72(3):1729-38.).

[0065] Without being bound to any particular theory, a conjugated bile acid is referred to as a bile salt. The production of a secondary bile acid from a bile salt involves a two-step process: 1) removal of a conjugated taurine or glycine by a bile salt hydrolase (BSH) enzyme and 2) removal of a hydroxyl group from the steroid ring by enzymes comprising an enzyme encoded by the bai-operon.

[0066] In certain embodiments, expression of the antibiotic resistance gene by the recombinant cell reduces the inhibition in growth or survival of the recombinant cell caused by exposure to an antibiotic such as, but not limited to, an antibiotic selected from the group consisting of a -lactam antibiotic, clindamycin, a cephalosporin, a quinolone antibiotic, levofloxacin, fluoroquinolone, a macrolide antibiotic, trimethoprim, and a sulfonamide antibiotic, as described herein.

[0067] In certain embodiments, expression of the antibiotic susceptibility gene by the recombinant cell increases the inhibition in growth or survival of the recombinant cell caused by exposure to an antibiotic. In certain embodiments, such antibiotics can include, but are not limited to, an antibiotic selected from the group consisting of a -lactam antibiotic, clindamycin, a cephalosporin, a quinolone antibiotic, levofloxacin, fluoroquinolone, a macrolide antibiotic, trimethoprim, and a sulfonamide antibiotic, as described herein. In other embodiments, the recombinant cell is not susceptible to the foregoing antibiotics.

[0068] In certain embodiment, the enzyme that can convert a primary bile acid to a secondary bile acid, for example, 7-hydroxysteroid dehydrogenase, can be administered directly to a subject as a therapeutic agent. If enzyme is administered in purified form, it may be administered in a liquid or solid form, optionally may be lyophilized, optionally may comprise a pharmaceutically suitable solvent and/or carrier.

[0069] In certain embodiments, compositions disclosed herein include nucleic acid sequences encoding a bile acid-inducible (bai) 7/-dehydroxylation operon, said nucleic acid sequences being part of expression vectors that express the bile acid-inducible (bai) 7/-dehydroxylation operon or functional fragments thereof in a suitable host. In certain embodiments, such nucleic acid sequences have promoters operably linked to the bile acid-inducible (bai) 7/-dehydroxylation operon coding region, said promoter being inducible or constitutive, and, optionally, tissue-specific. In certain embodiments, the promoter comprises a cytomegalovirus (CMV) promoter, or any other promoter known in the art that is effective for expressing a nucleic acid n a eukaryotic cell. For example, tissue-specific promoters as described by Atta, World J Gastroenterol. 2010 Aug. 28; 16(32):4019-4030. In other embodiments, the promoter comprises a bacterial promoter.

[0070] Delivery of nucleic acid into a subject or cell, e.g., bacterial cells of the intestinal microbiota, can be either direct, in which case the subject or cell, e.g., bacterial cells of a subject's intestinal microbiota, is directly exposed to the nucleic acid or nucleic acid-carrying vectors, or indirect, in which case, cells, e.g., a host cell, such as isolated bacterial cells of the intestinal microbiota, are first transformed with the nucleic acids in vitro, then transplanted into the subject. These two approaches are known, respectively, as in vivo or ex vivo gene therapy.

[0071] Any of the methods for gene therapy available in the art can be used according to the present disclosure. Exemplary methods are described below. For general reviews of the methods of gene therapy, see Kron and Kreppel, Curr Gene Ther 12(5):362-73 (2012); Yi et al. Curr Gene Ther 11(3):218-28 (2011); Goldspiel et al., Clinical Pharmacy 12:488-505 (1993); Wu and Wu, Biotherapy 3:87-95 (1991); Tolstoshev, Ann. Rev. Pharmacol. Toxicol. 32:573-596 (1993); Mulligan, Science 260:926-932 (1993); Morgan and Anderson, Ann. Rev. Biochem. 62:191-217 (1993); and May, TIBTECH 11(5):155-215 (1993). Methods commonly known in the art of recombinant DNA technology which can be used are described in Ausubel et al. (eds.), Current Protocols in Molecular Biology, John Wiley & Sons, NY (1993); and Kriegler, Gene Transfer and Expression, A Laboratory Manual, Stockton Press, NY (1990).

[0072] In certain non-limiting examples, the methods of the present invention involve transferring a gene to a host cell in culture by such methods as electroporation, lipofection, calcium phosphate mediated transfection, or viral infection. Usually, the method of transfer includes the transfer of a selectable marker to the host cells. The cells are then placed under selection to isolate those host cells that have taken up and are expressing the transferred gene. Those host cells are then delivered to a patient.

[0073] In certain embodiments, the nucleic acid can be introduced into cells, e.g., bacterial host cells, prior to administration in vivo of the resulting recombinant cell by any method known in the art, including but not limited to transfection, electroporation, microinjection, infection with a viral or bacteriophage vector containing the nucleic acid sequences, cell fusion, chromosome-mediated gene transfer, microcell-mediated gene transfer, spheroplast fusion, etc. Numerous techniques are known in the art for the introduction of foreign genes into cells (see, e.g., Loeffler and Behr, Meth. Enzymol. 217:599-618 (1993); Cohen et al., Meth. Enzymol. 217:618-644 (1993); Cline, Pharmac. Ther. 29:69-92m (1985)), and can be used in accordance with the present disclosure, provided that the necessary developmental and physiological functions of the recipient cells are not disrupted.

[0074] In one non-limiting embodiment, the host cells comprise Clostridium scindens, Lactobacillus, Lactococcus, Bacillus, Bifidobacterium, attenuated and non-monocytogenes Listeria strains, and combinations thereof.

[0075] The resulting recombinant cells can be delivered to a patient by various methods known in the art. The amount of cells envisioned for use depends on the desired effect, patient state, etc., and can be determined by one skilled in the art.

[0076] Recombinant cells can also be used in gene therapy, where nucleic acid sequences encoding a bile acid-inducible (bai) 7/-dehydroxylation operon are introduced into the cells such that they are expressible by the cells or their progeny, and the recombinant cells are then administered in vivo for therapeutic effect. For example, a bacterial progenitor, or stem, or other progenitor cells can be used. Any stem and/or progenitor cells which can be isolated and maintained in vitro can potentially be used (see e.g. PCT Publication WO 94/08598; Porada and Porada, J. Genet Syndr Gene Ther., May 25; S1. p11:011 (2012); Stemple and Anderson, Cell 71:973-985 (1992); Rheinwald, Meth. Cell Bio. 21A:229 (1980); and Pittelkow and Scott, Mayo Clinic Proc. 61:771 (1986)).

[0077] In certain embodiments, the terms vector and expression vector mean the vehicle by which a DNA or RNA sequence (e.g., a foreign gene) can be introduced into a host cell, so as to transform the host and promote expression (e.g., transcription and translation) of the introduced sequence. Vectors include plasmids, phages, viruses, etc.; they are discussed in greater detail below. A therapeutic vector as used herein refers to a vector which is acceptable for administration to an animal, and particularly to a human.

[0078] Vectors typically include the DNA of a transmissible agent, into which foreign DNA is inserted. A common way to insert one segment of DNA into another segment of DNA involves the use of enzymes called restriction enzymes that cleave DNA at specific sites (specific groups of nucleotides) called restriction sites. Generally, foreign DNA is inserted at one or more restriction sites of the vector DNA, and then is carried by the vector into a host cell along with the transmissible vector DNA. A segment or sequence of DNA having inserted or added DNA, such as an expression vector, can also be called a DNA construct. A common type of vector is a plasmid, which generally is a self-contained molecule of double-stranded DNA, usually of bacterial origin, that can readily accept additional (foreign) DNA and which can readily introduced into a suitable host cell. A plasmid vector often contains coding DNA and promoter DNA and has one or more restriction sites suitable for inserting foreign DNA. Coding DNA is a DNA sequence that encodes a particular amino acid sequence for a particular protein or enzyme. Promoter DNA is a DNA sequence which initiates, regulates, or otherwise mediates or controls the expression of the coding DNA. Promoter DNA and coding DNA can be from the same gene or from different genes, and can be from the same or different organisms. A large number of vectors, including plasmid and fungal vectors, have been described for replication and/or expression in a variety of eukaryotic and prokaryotic hosts. Non-limiting examples include pKK plasmids (Clonetech), pUC plasmids, pET plasmids (Novagen, Inc., Madison, Wis.), pRSET plasmids (Invitrogen, San Diego, Calif.), pCDNA3 plasmids (Invitrogen), pREP plasmids (Invitrogen), or pMAL plasmids (New England Biolabs, Beverly, Mass.), and many appropriate host cells, using methods disclosed or cited herein or otherwise known to those skilled in the relevant art. Recombinant cloning vectors will often include one or more replication systems for cloning or expression, one or more markers for selection in the host, e.g., antibiotic resistance, and one or more expression cassettes.

[0079] Suitable vectors include viruses, such as adenoviruses, adeno-associated virus (AAV), vaccinia, herpesviruses, baculoviruses and retroviruses, parvovirus, lentivirus, bacteriophages, cosmids, plasmids, fungal vectors, naked DNA, DNA lipid complexes, and other recombination vehicles typically used in the art which have been described for expression in a variety of eukaryotic and prokaryotic hosts, and can be used for gene therapy as well as for simple protein expression.

[0080] Viral vectors, especially adenoviral vectors can be complexed with a cationic amphiphile, such as a cationic lipid, polyL-lysine (PLL), and diethylaminoethyldextran (DELAE-dextran), which provide increased efficiency of viral infection of target cells (Sec, e.g., PCT/US97/21496 filed Nov. 20, 1997, incorporated herein by reference). AAV vectors, such as those disclosed in Zhong et al., J Genet Syndr Gene Ther 2013, S1-008; U.S. Pat. Nos. 5,139,941, 5,252,479 and 5,753,500 and PCT publication WO 97/09441, the disclosures of which are incorporated herein, are also useful since these vectors integrate into host chromosomes, with a minimal need for repeat administration of vector. For a review of viral vectors in gene therapy, see McConnell et al., 2004, Hum Gene Ther. 15(11):1022-33; Mccarty et al., 2004, Annu Rev Genet. 38:819-45; Mah et al., 2002, Clin. Pharmacokinet. 41(12):901-11; Scott et al., 2002, Neuromuscul. Disord. 12(Suppl 1):S23-9.

5.2 THERAPEUTIC BACTERIA

[0081] In certain non-limiting embodiments, the compositions described herein comprise one or more therapeutic bacteria, or spores thereof, for example, a C. scindens bacterium such as described in Morris et al., Clostridium scindens sp. nov., a Human Intestinal Bacterium with Desmolytic Activity on Corticoids, Int J Syst Bacteriol, October 1985, 35:478-481, and/or Krafft et al., Purification and characterization of a novel form of 20 alpha-hydroxysteroid dehydrogenase from Clostridium scindens, J. Bacteriol. June 1989, 171:2925-2932. In certain non-limiting embodiments, a C. scindens bacterium is as deposited in, and available from, the American Type Culture Collection, accession number ATCC 35704, Strain Designation VPI 13733. C. scindens 16S ribosomal RNA gene sequence is set forth in GenBank Accession No. AF262238, and C. scindens genome nucleic acid sequence from a whole genome shotgun sequencing project is set forth in GenBank Accession No. ABFY 02000000. Non-limiting examples of characteristics of C. scindens are expression of the enzymes 20 alpha-hydroxysteroid dehydrogenase, 7-beta dehydrogenase, 7 alpha-dehydroxylase, and steroid desmolase.

[0082] In certain embodiments, the therapeutic bacteria described herein can be modified, for example, by introducing one or more nucleic acids into the bacteria, thereby producing recombinant bacteria. Such nucleic acids can comprise, for example, a bile acid-inducible (bai) 7/-dehydroxylation operon, antibiotic resistance gene, antibiotic susceptibility gene, and/or a bile salt hydrolase gene, as described herein. Such recombinant bacteria can be prepared as described herein.

[0083] In certain non-limiting embodiments, C. scindens may be administered in the form of purified bacteria or spores or other progenitors thereof, or alternatively may be administered as a constituent in a mixture of types of bacteria, optionally including one or more probiotic bacterium or yeast. In certain non-limiting embodiments, C. scindens may be administered in combination with one or more of Barnesiella intestihominis (e.g., phylum Bacteroidetes, see, e.g., Buffie and Pamer, Nature Reviews Immunology 13:790-801), and/or Blautia hansenii (e.g., phylum Firmicutes, Family Lachnospiraceae, ATCC 27752), and/or Pseudoflavonifractor capillosus (e.g., phylum Firmicutes), and/or Clostridium hiranonis, and/or Clostridium hylemonae, and/or Clostridium perfringens, and/or Clostridium sordellii, and/or Proteocatella sphenisci, and/or Lachnospiraceae 5_1_57FAA, Clostridiales VE202-05 and/or Clostridiales VE202-26. In non-limiting embodiments, the present invention provides for pharmaceutical compositions comprising such forms of C. scindens and optionally additional bacteria. The bacteria may be administered in the form of a liquid, a suspension, a dried (e.g. lyophilized) powder, a tablet, a capsule, or a suppository, and may be administered orally or rectally. In certain embodiments, the bacteria can be administered in a food product, for example, a yogurt food product. In certain embodiments, a food product means a product or composition that is intended for consumption by a human or a non-human animal. Such food products include any food, feed, snack, food supplement, liquid, beverage, treat, toy (chewable and/or consumable toys), meal substitute or meal replacement.

[0084] In certain non-limiting embodiments, the present invention provides for a composition comprising an isolated Clostridium scindens bacterium. In one embodiment, the bacterium is in a formulation for administration to a subject. In other embodiments, the composition further comprises a second, third or fourth bacterium selected from the group consisting of Barnesiella intestihominis, Blautia hansenii, Pseudoflavonifractor capillosus and combinations thereof.

[0085] In other embodiments, the composition comprises one, two, three, four, five, six, seven, eight, nine, or ten or more bacteria selected from the group consisting of Clostridium scindens, Clostridium hiranonis, Clostridium hylemonae, Clostridium perfringens, Clostridium sordellii, Proteocatella sphenisci, Lachnospiraceae 5_1_57FAA, Clostridiales VE202-05, Clostridiales VE202-26, Barnesiella intestihominis, Blautia hansenii, and Pseudoflavonifractor capillosus.

[0086] In certain non-limiting embodiments, the present invention provides for a composition comprising an isolated Clostridium scindens bacterium, an isolated Barnesiella intestihominis bacterium, an isolated Blautia hansenii bacterium, and an isolated Pseudoflavonifractor capillosus bacterium.

[0087] In one specific non-limiting embodiment, said bacterium is C. scindens, but alternate or additional bacteria may be comprised in the compositions described herein, for example, bacteria which may be naturally occurring or bacteria engineered to express a bile acid-inducible (bai) 7/-dehydroxylation operon, or peptides expressed therefrom, such as, for example, an enzyme that converts a primary bile acid to a secondary bile acid, for example, 7-hydroxysteroid dehydrogenase. Specific non-limiting examples of naturally occurring bacteria other than C. scindens that may be used to provide said enzyme are Clostridium hiranonis and Clostridium hylemonae (Ridlon, J. Lipid Res. 53:66-76 (2012), Ridlon, J Lipid Res 47, 241-259 (2006)).

5.3 PHARMACEUTICAL COMPOSITIONS

[0088] In certain embodiments, the present disclosure provides for pharmaceutical compositions which include a therapeutic composition, as described herein, such as, for example, a bile acid-inducible (bai) 7/-dehydroxylation operon, and/or a recombinant cell expressing said bile acid-inducible (bai) 7/-dehydroxylation operon, and/or a therapeutic bacterium, as described herein. Such pharmaceutical compositions can further include at least one other agent, such as a stabilizing compound or additional therapeutic agent, and can be administered in any sterile, biocompatible pharmaceutical carrier, including, but not limited to, saline, buffered saline, dextrose, and water. The composition can be in a liquid or lyophilized form and includes a diluent (Tris, citrate, acetate or phosphate buffers) having various pH values and ionic strengths, solubilizer such as Tween or Polysorbate, carriers such as human serum albumin or gelatin, preservatives such as thimerosal, parabens, benzylalkonium chloride or benzyl alcohol, antioxidants such as ascorbic acid or sodium metabisulfite, and other components such as lysine or glycine. Selection of a particular composition will depend upon a number of factors, including the condition being treated, the route of administration and the pharmacokinetic parameters desired. A more extensive survey of components suitable for pharmaceutical compositions is found in Remington's Pharmaceutical Sciences, 18th ed. A. R. Gennaro, ed. Mack, Easton, PA (1980).

[0089] In certain embodiments, the methods and compositions of the present disclosure find use in treating Clostridium difficile infection. Bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acids, peptides expressed by a bile acid-inducible (bai) 7/-dehydroxylation operon, recombinant cells expressing a bile acid-inducible (bai) 7/-dehydroxylation operon, therapeutic bacteria, and/or secondary bile acids can be administered to the patient in a pharmaceutically acceptable carrier. The route of administration eventually chosen will depend upon a number of factors and can be ascertained by one skilled in the art.

[0090] In certain embodiments, the pharmaceutical compositions of the present disclosure can be formulated using pharmaceutically acceptable carriers well known in the art in dosages suitable for oral or rectal administration. Such carriers enable the pharmaceutical compositions to be formulated as tablets, pills, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral, rectal or nasal ingestion by a patient to be treated.

[0091] Pharmaceutical compositions suitable for use in the present disclosure include, in certain embodiments, compositions where the active ingredients are contained in an effective amount to achieve the intended purpose. The amount will vary from one individual to another and will depend upon a number of factors, including the overall physical condition of the patient, e.g., severity of the Clostridium difficile infection.

[0092] In certain embodiments, the compositions of the present disclosure can be administered for prophylactic and/or therapeutic treatments. For example, in alternative embodiments, pharmaceutical compositions of the present disclosure are administered in an amount sufficient to treat, prevent and/or ameliorate Clostridium difficile infection. As is well known in the medical arts, dosages for any one patient depends upon many factors, including stage of the disease or condition, the severity of the disease or condition, the patient's size, body surface area, age, the particular compound to be administered, sex, time and route of administration, general health, and interaction with other drugs being concurrently administered.

[0093] Accordingly, in certain embodiments, a bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid, peptides expressed by a bile acid-inducible (bai) 7/-dehydroxylation operon, recombinant cells expressing a bile acid-inducible (bai) 7/-dehydroxylation operon, therapeutic bacteria, and/or secondary bile acid can be administered to a patient alone, or in combination with one or more other drugs, nucleotide sequences, lifestyle changes, etc. used in the treatment or prevention of Clostridium difficile infection, or symptoms thereof, or in pharmaceutical compositions where it is mixed with excipient(s) or other pharmaceutically acceptable carriers.

[0094] Single or multiple administrations of formulations can be given depending on the dosage and frequency as required and tolerated by the patient. In certain embodiments, the formulations should provide a sufficient quantity of active agent to effectively treat, prevent or ameliorate the Clostridium difficile infection, or symptoms or complications thereof as described herein.

5.4 METHODS OF TREATMENT

[0095] In certain non-limiting embodiments, the present invention provides for a method of reducing the risk of C. difficile infection and/or improving resistance to C. difficile infection, and/or reducing the severity of C. difficile infection and/or decreasing the amount of C. difficile toxin, comprising administering, to a subject in need of such treatment, an effective amount of a composition described herein, for example, a recombinant cell and/or a composition comprising one or more therapeutic bacteria, for example, Clostridium scindens optionally in combination with one or more of Barnesiella intestihominis, Blautia hansenii, and Pseudoflavonifractor capillosus. In certain embodiments, the method of reducing the severity or risk of C. difficile infection comprises reducing the severity or risk of a C. difficile-associated disease, as described herein.

[0096] Subjects in need of such treatment or compositions include subjects who are either at risk for developing C. difficile infection and/or subjects who have existing C. difficile infection.

[0097] Subjects at risk for C. difficile infection include individuals who are or have been treated with an antibiotic; individuals who are very young (juvenile) or who are old (geriatric, e.g. humans aged 65 years or older); individuals suffering from an inflammatory bowel disease or condition (including human inflammatory bowel disease IBD and Crohn's Disease); individuals who are hospitalized or in a long-term care facility or who have been, in the past 2, 3, 4, 5, or 6 weeks, hospitalized or in a long-term care facility; individuals with cancer including those undergoing anti-cancer treatment and/or stem cell or bone marrow transplant recipients; individuals who have previously suffered C. difficile infection, and individuals undergoing immunosuppressive therapy or with an otherwise compromised immune system (e.g. subjects infected with an immunodeficiency causing retrovirus such as HIV, FIV, FLV, etc.).

[0098] Non-limiting examples of antibiotics associated with risk of C. difficile infection include -lactam antibiotics such as penicillin, ampicillin, and amoxicillin; clindamycin; cephalosporins such as but not limited to cefixime; quinolone antibiotics such as ciprofloxacin, levofloxacin and fluoroquinolone; macrolide antibiotics; trimethoprim; or sulfonamide antibiotics. In one specific non-limiting embodiment, the antibiotic is not enrofloxacin.

[0099] C. difficile infection, as that term is used herein, is distinct from the mere presence of the bacterium or C. difficile spores in the host gastrointestinal tract; infection is indicated by the presence of one or more symptom, such as intestinal tenderness, pain, and/or cramping; diarrhea for example watery diarrhea occurring at least 3, at least 5, or at least 8 times per day; blood or pus in stool or diarrhea; fever; loss of appetite; and/or nausea; and/or one or more clinical sign such as an elevated white blood cell count, decreased serum albumin, and/or the appearance of pseudomembrane in the intestinal and/or rectal mucosa. In a specific, non-limiting embodiment, C. difficile infection in a human may be manifested (in the case of a serious infection) by a fever of at least 38.3 C., a white blood cell count of greater than 15,000 cells/mm.sup.3, serum albumin less than 2.5 g/dl, and age greater than 60 years (Zar et al., Clin. Infect. Dis. 45:302-307, 2007).

[0100] In certain non-limiting embodiments, a C. difficile-associated disease refers to any disease involving unwanted growth, toxin production, or tissue invasion in the bowel by C. difficile. C. difficile-associated diseases are well known in medicine and specifically include antibiotic-associated diarrhea (also known as C. difficile colitis), pseudomembranous colitis, and C. difficile-associated toxic megacolon. C. difficile colitis generally refers to profuse, watery diarrheal illness associated with the presence of at least one C. difficile toxin. Pseudomembranous colitis refers to a severe form of C. difficile colitis further characterized by bloody diarrhea, fever, and bowel wall invasion by C. difficile. The appearance of pseudomembranes on the surface of the colon or rectum is diagnostic of the condition. The pseudomembranes are composed principally of inflammatory debris and white blood cells.

[0101] In certain non-limiting embodiments, the present invention provides for a method for reducing the risk of C. difficile infection and/or improving resistance to C. difficile infection, comprising administering, to a subject in need of such treatment, an effective amount of a composition or therapeutic bacteria described herein, for example, C. scindens bacteria.

[0102] An effective amount of a composition or therapeutic bacteria described herein, for example, C. scindens, is an amount which increases resistance to C. difficile infection, reduces the amount of C. difficile toxin, and/or inhibits proliferation and/or growth of C. difficile in a subject. In certain non-limiting embodiments, an effective amount of C. scindens bacteria is at least 10.sup.5 bacteria, or at least 10.sup.6 bacteria, or at least 10.sup.7 bacteria, or at least 10.sup.8 bacteria, or at least 10.sup.9 bacteria.

[0103] In certain non-limiting embodiments, the present invention provides for a method for reducing the severity of C. difficile infection, and/or decreasing the amount of C. difficile toxin, and/or reducing the risk of C. difficile infection, and/or improving resistance to C. difficile infection, comprising administering, to a subject in need of such treatment, an effective amount of a composition described herein, for example, a recombinant cell or a therapeutic bacteria such as a C. scindens bacteria.

[0104] Reducing the severity of C. difficile infection refers to an amelioration in the clinical symptoms or signs of infection, for example, but not by way of limitation, one or more of the following: a decrease in the frequency or volume of diarrhea; a decrease in fever; a decrease in abdominal cramping, pain, and/or tenderness; a reduction in white blood cells in the blood; an increase in serum albumin; weight maintenance or gain; and a decrease the appearance of pseudomembrane in the intestinal and/or rectal mucosa.

[0105] In certain non-limiting embodiments, the present invention provides for a method of reducing the severity of C. difficile infection, and/or decreasing the amount of C. difficile toxin, and/or reducing the risk of C. difficile infection, and/or improving resistance to C. difficile infection, comprising administering, to a subject in need of such treatment, an effective amount of an enzyme of C. scindens (see Ridlon, J. Lipid Res. 54:2437-2449 (2013)).

[0106] In certain non-limiting embodiments, the present invention provides for a method for reducing the severity of C. difficile infection, and/or decreasing the amount of C. difficile toxin, and/or reducing the risk of C. difficile infection, and/or improving resistance to C. difficile infection, comprising administering, to a subject in need of such treatment, an effective amount of an enzyme that converts a bile acid to a secondary bile acid.

[0107] In certain non-limiting embodiments, the present invention provides for a method for reducing the severity of C. difficile infection, and/or decreasing the amount of C. difficile toxin, and/or reducing the risk of C. difficile infection, and/or improving resistance to C. difficile infection, comprising administering, to a subject in need of such treatment, an effective amount of a bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid, peptides expressed by a bile acid-inducible (bai) 7/-dehydroxylation operon, recombinant cells expressing a bile acid-inducible (bai) 7/-dehydroxylation operon, therapeutic bacteria, and/or secondary bile acid. In certain non-limiting embodiments, the compositions of the present invention are administered in purified form. In certain non-limiting embodiments, the compositions are contained in and/or produced in the subject by a bacterium or a mixture of bacteria.

[0108] In certain non-limiting embodiments, the present invention provides for a method for reducing the severity of C. difficile infection, and/or decreasing the amount of C. difficile toxin, and/or reducing the risk of C. difficile infection, and/or improving resistance to C. difficile infection, comprising administering, to a subject in need of such treatment, an effective amount of a secondary bile acid. Non-limiting examples of secondary bile acids which may be used include deoxycholic acid, lithocholic acid, or a combination thereof.

[0109] In one non-limiting embodiment, the present disclosure provides for a method for decreasing the severity of one or more symptoms of an intestinal disorder comprising administering, to a subject in need of such treatment, an effective amount of one or more of a recombinant cell; composition comprising one or more therapeutic bacteria; and an agent selected from the group consisting of an enzyme that converts a bile acid to a secondary bile acid, a secondary bile acid, purified bacteria or spores thereof expressing an enzyme that converts a bile acid to a secondary bile acid, and combinations thereof, as described herein. In certain embodiments, the symptoms are selected from the group consisting of frequency and/or volume of diarrhea; fever; abdominal cramping, pain, and/or tenderness; white blood cells in the blood; loss of serum albumin; weight loss; appearance of pseudomembrane in the intestinal and/or rectal mucosa; and combinations thereof.

[0110] A subject treated according to the invention may be concurrently or sequentially treated with one or more agent that reduces the risk of and/or ameliorates C. difficile infection, for example, but not limited to, one or more antibiotic for example, but not limited to, vancomycin, metronidazole, and/or fidaxomicin; an immunotherapeutic agent such as an anti-toxin antibody; an herbal remedy such as Puerariae radix, Scutellariae radix, Rhizoma coptidis, garlic, or one or more extract thereof; and/or a probiotic remedy including for example, but not limited to, Lactobacillus acidophilus, Lactobacillus casei, Bifidobacteria, Streptococcus thermophiles, and/or Saccharomyces boulardii. In certain non-limiting embodiments, the treatment does not further comprise administration of cholestyramine.

[0111] The present disclosure also provides for methods of diagnosing or identifying a subject with a C. difficile infection, or at risk for C. difficile infection.

[0112] In certain embodiments, such methods comprise determining the level of one more bacterium present in an intestinal microbiota sample of a subject that can convert a primary bile acid to a secondary bile acid, for example, C. scindens, wherein the subject is diagnosed or identified as having a C. difficile infection, or at risk for C. difficile infection, when the level or amount of the one or more bacterium in the subject's microbiota is lower than a bacterium reference level. In one embodiment, a bacterium reference level is a level of bacterium, for example, C. scindens or any other bacteria that can convert a primary bile acid to a secondary bile acid, present in intestinal microbiota, a level below which is indicative of C. difficile infection, or risk of C. difficile infection, as determined by a medical doctor or person of skill in the art. In one non-limiting example, such a reference level can be the level of said bacterium in the microbiota of a subject who does not have a C. difficile infection, or at risk for C. difficile infection.

[0113] In other embodiments, such methods comprise determining the activity or level of 7-hydroxysteroid dehydrogenase enzyme present in the intestinal microbiota of a subject, wherein the subject is diagnosed or identified as having a C. difficile infection, or at risk for C. difficile infection, when the activity or level of 7-hydroxysteroid dehydrogenase enzyme in the subject's microbiota is lower than a 7-hydroxysteroid dehydrogenase enzyme reference level. In one embodiment, a 7-hydroxysteroid dehydrogenase enzyme reference level is an activity or level of 7-hydroxysteroid dehydrogenase enzyme present in intestinal microbiota, a level or activity below which is indicative of C. difficile infection, or risk of C. difficile infection, as determined by a medical doctor or person of skill in the art. In one non-limiting example, such a reference level can be the activity or level of 7-hydroxysteroid dehydrogenase in the microbiota of a subject who does not have a C. difficile infection, or at risk for C. difficile infection.

[0114] In other embodiments, such methods comprise quantifying the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid present in a fecal sample of a subject, wherein the subject is diagnosed or identified as having a C. difficile infection, or at risk for C. difficile infection, when the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid present in the fecal sample is lower than a bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid reference level. In one embodiment, a bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid reference level is the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid present in a fecal sample, a level below which is indicative of C. difficile infection, or risk of C. difficile infection, as determined by a medical doctor or person of skill in the art. In one non-limiting example, such a reference level can be the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid present in a fecal sample of a subject who does not have a C. difficile infection, or at risk for C. difficile infection. In certain embodiments, the level of nucleic acid is quantified using metagenomic sequencing, quantitative PCR, or any other method known in the art for quantifying nucleic acid in a sample.

[0115] In certain embodiments, when the level or activity of the one more bacterium present in an intestinal microbiota sample of a subject that can convert a primary bile acid to a secondary bile acid, the 7-hydroxysteroid dehydrogenase enzyme in the subject's microbiota, and/or the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid present in the fecal sample is above their respective reference levels, the subject is not administered an antibiotic selected from the group consisting of a -lactam antibiotic, clindamycin, a cephalosporin, a quinolone antibiotic, levofloxacin, fluoroquinolone, a macrolide antibiotic, trimethoprim, and a sulfonamide antibiotic.

5.5 NON-LIMITING EMBODIMENTS OF THE DISCLOSURE

[0116] As described herein, the present disclosure provides for compositions and methods for reducing the severity and/or risk of Clostridium difficile infection.

[0117] In one non-limiting embodiment, the present disclosure provides a recombinant cell expressing a bile acid-inducible (bai) 7/-dehydroxylation operon, wherein the recombinant cell comprises one or more exogenous nucleic acids encoding a bile acid-inducible (bai) 7/-dehydroxylation operon, wherein the one or more exogenous nucleic acids are operably linked to a promoter. In certain embodiments, the recombinant cell further comprises one or more nucleic acids encoding a bile salt hydrolase, antibiotic resistance protein, and/or antibiotic susceptibility protein.

[0118] In one example, the one or more exogenous nucleic acids comprises a baiCD gene encoding a 7-hydroxysteroid dehydrogenase enzyme.

[0119] In other embodiments, the 7-hydroxysteroid dehydrogenase is a bacterial 7-hydroxysteroid dehydrogenase, wherein the bacteria is selected from the group consisting of Clostridium scindens, Clostridium hiranonis, Clostridium hylemonae, Clostridium perfringens, Clostridium sordellii, Proteocatella sphenisci, Lachnospiraceae 5_1_57FAA, Clostridiales VE202-26, Clostridiales VE202-05 and combinations thereof.

[0120] In certain embodiments, the recombinant cell is a bacterium or spore thereof, for example, a bacterium selected from the group consisting of Clostridium scindens, Lactobacillus, Lactococcus, Bacillus, Bifidobacterium, and attenuated and non-monocytogenes Listeria strains.

[0121] In certain non-limiting embodiments, the bile acid-inducible (bai) 7/-dehydroxylation operon is expressed by the recombinant cell in an amount sufficient to transform a primary bile acid to a secondary bile acid by 7/-dehydroxylation.

[0122] In one non-limiting embodiment, the present disclosure provides for a composition comprising an isolated Clostridium scindens bacterium, wherein the bacterium is in a formulation for administration to a subject. In certain embodiments, the composition further comprises a second bacterium selected from the group consisting of Barnesiella intestihominis, Blautia hansenii, Pseudoflavonifractor capillosus and combinations thereof. In certain embodiments, the composition comprises one or more, two or more, three or more, or four of the foregoing bacteria.

[0123] In one embodiment, the recombinant cell or compositions described herein are formulated for oral or rectal administration, and can optionally further comprise a probiotic bacterium, probiotic yeast, or a combination thereof.

[0124] In one example, the formulation for oral or rectal administration is a liquid, suspension, dried powder, tablet, capsule or food product.

[0125] The present disclosure also provides for a method for reducing the risk of Clostridium difficile infection and/or increasing resistance to Clostridium difficile infection in a subject, comprising administering, to a subject in need of such treatment, an effective amount of a recombinant cell and/or composition as described herein.

[0126] The present disclosure also provides for a method for reducing the severity of Clostridium difficile infection and/or decreasing the amount of Clostridium difficile toxin in a subject, comprising administering, to a subject in need of such treatment, an effective amount of a recombinant cell and/or composition as described herein.

[0127] The present disclosure also provides for a method for reducing the risk of Clostridium difficile infection and/or increasing resistance to Clostridium difficile infection in a subject, comprising administering, to a subject in need thereof, an effective amount of an agent selected from the group consisting of an enzyme that converts a bile acid to a secondary bile acid, a secondary bile acid, purified bacteria or spores thereof expressing an enzyme that converts a bile acid to a secondary bile acid, and combinations thereof.

[0128] The present disclosure also provides for a method for reducing the severity of Clostridium difficile infection and/or decreasing the amount of Clostridium difficile toxin in a subject, comprising administering, to a subject in need thereof, an effective amount of an agent selected from the group consisting of an enzyme that converts a bile acid to a secondary bile acid, a secondary bile acid, purified bacteria or spores thereof expressing an enzyme that converts a bile acid to a secondary bile acid, and combinations thereof.

[0129] The present disclosure also provides for a method for decreasing the severity of a symptom of an intestinal disorder comprising administering, to a subject in need of such treatment, an effective amount of one or more of a recombinant cell or composition described herein, and an agent selected from the group consisting of an enzyme that converts a bile acid to a secondary bile acid, a secondary bile acid, purified bacteria or spores thereof expressing an enzyme that converts a bile acid to a secondary bile acid, and combinations thereof, wherein the symptom is selected from the group consisting of frequency and/or volume of diarrhea; fever; abdominal cramping, pain, and/or tenderness; white blood cells in the blood; loss of serum albumin; weight loss; appearance of pseudomembrane in the intestinal and/or rectal mucosa; and combinations thereof.

[0130] In one example, the enzyme that converts a bile salt to a secondary bile acid is a 7-hydroxysteroid dehydrogenase enzyme.

[0131] In another example, the recombinant cell, composition or agent can be administered to the subject in an amount effective to inhibit proliferation of Clostridium difficile in the subject.

[0132] In yet other examples, the recombinant cell, composition or agent is administered to the subject in an amount effective to reduce one or more clinical symptoms of Clostridium difficile infection selected from the group consisting of frequency and/or volume of diarrhea; fever; abdominal cramping, pain, and/or tenderness; white blood cells in the blood; loss of serum albumin; weight loss; appearance of pseudomembrane in the intestinal and/or rectal mucosa; and combinations thereof.

[0133] In certain embodiments, the composition administered to a subject comprises a purified bacterium or spore thereof selected from the group consisting of Clostridium scindens, Clostridium hiranonis, Clostridium hylemonae, Clostridium perfringens, Clostridium sordellii, Proteocatella sphenisci, Lachnospiraceae 5_1_57FAA, Clostridiales VE202-26, Clostridiales VE202-05 and combinations thereof.

[0134] In one example, the bacterium is a purified Clostridium scindens bacterium.

[0135] In other examples, the composition further comprises a second bacterium selected from the group consisting of Barnesiella intestihominis, Blautia hansenii, Pseudoflavonifractor capillosus, and combinations thereof.

[0136] In other examples, the composition is a secondary bile acid, for example, a secondary bile acid selected from the group consisting of deoxycholic acid, lithocholic acid, and a combination thereof.

[0137] In certain embodiments, the methods described herein further comprise administering to the subject, an antibiotic, an immunotherapeutic agent, an herbal remedy, a probiotic, or combinations thereof.

[0138] In one non-limiting embodiment, the methods described herein, further comprise identifying a subject with a Clostridium difficile infection, or at risk for Clostridium difficile infection, comprising obtaining an intestinal microbiota sample from a subject and determining the level of one or more bacterium present in the intestinal microbiota sample; comparing the level of the one or more bacterium in the sample with a reference bacterium level; and administering the recombinant cell, composition or agent to the subject when the level of one or more bacterium in the sample is lower than the bacterium reference level. In certain embodiments, the one or more bacterium is selected from the group consisting of Clostridium scindens, Clostridium hiranonis, Clostridium hylemonae, Clostridium perfringens, Clostridium sordellii, Proteocatella sphenisci, Lachnospiraceae 5_1_57FAA, Clostridiales VE202-05, Clostridiales VE202-26, and combinations thereof. In certain embodiments, the method further comprising administering an antibiotic to the subject, wherein, when the level of the one or more bacterium in the sample is equal to or greater than the bacterium reference level, the antibiotic administered to the subject is not an antibiotic selected from the group consisting of a -lactam antibiotic, clindamycin, a cephalosporin, a quinolone antibiotic, levofloxacin, fluoroquinolone, a macrolide antibiotic, trimethoprim, and a sulfonamide antibiotic.

[0139] In other non-limiting embodiments, the methods described herein further comprise identifying a subject with a Clostridium difficile infection, or at risk for Clostridium difficile infection, comprising obtaining an intestinal microbiota sample from a subject and determining the activity or level of 7-hydroxysteroid dehydrogenase enzyme present in the intestinal microbiota sample; comparing the activity or level of 7-hydroxysteroid dehydrogenase enzyme in the sample with a reference 7-hydroxysteroid dehydrogenase enzyme activity or level; and administering the recombinant cell, composition or agent to the subject when the activity or level of 7-hydroxysteroid dehydrogenase enzyme in the sample is lower than the reference 7-hydroxysteroid dehydrogenase enzyme activity or level.

[0140] The present disclosure also provides for a method of diagnosing a subject with a Clostridium difficile infection, or at risk for Clostridium difficile infection, comprising obtaining an intestinal microbiota sample from a subject and determining the level of one or more bacterium present in the intestinal microbiota sample; comparing the level of one or more bacterium in the sample with a reference bacterium level; and diagnosing the subject as having a Clostridium difficile infection, or at risk for Clostridium difficile infection, when the level of the one or more bacterium in the sample is lower than the bacterium reference level. In certain embodiments, the one or more bacterium is selected from the group consisting of Clostridium scindens, Clostridium hiranonis, Clostridium hylemonae, Clostridium perfringens, Clostridium sordellii, Proteocatella sphenisci, Lachnospiraceae 5_1_57FAA, Clostridiales VE202-05, Clostridiales VE202-26, and combinations thereof. In certain embodiments, the method further comprising administering an antibiotic to the subject, wherein, when the level of the one or more bacterium in the sample is equal to or greater than the bacterium reference level, the antibiotic administered to the subject is not an antibiotic selected from the group consisting of a -lactam antibiotic, clindamycin, a cephalosporin, a quinolone antibiotic, levofloxacin, fluoroquinolone, a macrolide antibiotic, trimethoprim, and a sulfonamide antibiotic.

[0141] In other embodiments, the present disclosure provides for a method of diagnosing a subject with a Clostridium difficile infection, or at risk for Clostridium difficile infection, comprising obtaining an intestinal microbiota sample from a subject and determining the activity or level of 7-hydroxysteroid dehydrogenase enzyme present in the intestinal microbiota sample; comparing the activity or level of 7-hydroxysteroid dehydrogenase enzyme in the sample with a reference 7-hydroxysteroid dehydrogenase enzyme activity or level; and diagnosing the subject as having a Clostridium difficile infection, or at risk for Clostridium difficile infection, when the activity or level of 7-hydroxysteroid dehydrogenase enzyme in the sample is lower than the reference 7-hydroxysteroid dehydrogenase enzyme activity or level.

[0142] In other non-limiting embodiments, the methods described herein further comprise identifying a subject with a Clostridium difficile infection, or at risk for Clostridium difficile infection, comprising obtaining a fecal sample from a subject and quantifying the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid present in the fecal sample; comparing the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid in the fecal sample with a reference bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid level; and administering the recombinant cell, composition or agent to the subject when the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid in the fecal sample is lower than the reference level.

[0143] In other embodiments, the present disclosure provides for a method of diagnosing a subject with a Clostridium difficile infection, or at risk for Clostridium difficile infection, comprising obtaining a fecal sample from a subject and quantifying the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid present in the fecal sample; comparing the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid present in the fecal sample with a reference bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid level; and diagnosing the subject as having a Clostridium difficile infection, or at risk for Clostridium difficile infection, when the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid present in the fecal sample is lower than the reference level.

[0144] In certain non-limiting embodiments, the methods described herein further comprise administering an antibiotic to the subject, wherein, when the level of one or more bacterium in the sample is equal to or greater than the bacterium reference level; when the activity or level of 7-hydroxysteroid dehydrogenase enzyme in the sample is greater than the reference 7-hydroxysteroid dehydrogenase enzyme activity or level; or when the level of bile acid-inducible (bai) 7/-dehydroxylation operon nucleic acid present in the fecal sample is greater than the reference level; wherein the antibiotic administered to the subject is not an antibiotic selected from the group consisting of a -lactam antibiotic, clindamycin, a cephalosporin, a quinolone antibiotic, levofloxacin, fluoroquinolone, a macrolide antibiotic, trimethoprim, and a sulfonamide antibiotic.

[0145] In other non-limiting embodiments, the present disclosure provides for a method of reducing risk of developing Clostridium difficile-associated disease in a subject receiving antibiotic therapy, comprising administering, to a subject in need of such treatment, an effective amount of a recombinant cell or composition described herein.

[0146] In other embodiments, the present disclosure provides for a method of preventing or treating Clostridium difficile-associated disease in a subject comprising administering, to a subject in need of such treatment, an effective amount of a recombinant cell or composition described herein. In certain embodiments, the Clostridium difficile-associated disease is Clostridium difficile colitis or pseudomembranous colitis. In certain embodiments, the subject is, has or will receive antibiotic therapy

[0147] The present disclosure also provides for a kit comprising the recombinant cell, and/or agent, and/or therapeutic composition described herein.

6. EXAMPLE

[0148] The presently disclosed subject matter will be better understood by reference to the following Example, which is provided as exemplary of the invention, and not by way of limitation.

6. EXAMPLE: NATIVE INTESTINAL BACTERIA AUGMENT RESISTANCE TO C. DIFFICILE INFECTION THROUGH SECONDARY BILE ACID BIOSYNTHESIS

[0149] As demonstrated by the experiments described below, and utilizing mouse models of C. difficile infection and a cohort of infection-susceptible patients, we have characterized and modeled the dynamics of microbiome composition and infection resistance in mice and humans. After leveraging this information to precisely identify native intestinal bacteria associated with infection resistance, we developed a murine bacterial transfer model informed by Koch's postulates, FMT protocols, and bioinformatic approaches to confirm that as few as one species of resistance-associated bacterium, Clostridium scindens, could mitigate C. difficile infection and associated disease. Finally, we present evidence that C. scindens enhances C. difficile resistance by chemically transforming host-produced bile salts, suggesting approaches to improve the identification and treatment of C. difficile-susceptible individuals.

6.1 VARIANCE OF ANTIBIOTIC IMPACTS

[0150] The use of multiple different antibiotic classes is associated with C. difficile infection in hospital settings (Rupnik, Nat Rev Microbiol 7, 526-536 (2009); Surawicz, Nat Rev Gastroenterol Hepatol 8, 330-339 (2011)), but the kinetics of infection susceptibility following antibiotic use is not well described. We characterized the impact of agents with diverse antimicrobial spectra on C. difficile infection resistance by treating independently-housed colonies of C57BL/6J mice with one of three antibiotic classes for three days and challenging mice from these colonies with 1000 C. difficile spores (VPI10463) at five intervals throughout a 21-day period following antibiotic cessation. Susceptibility was determined by enumeration of C. difficile from the large intestine of animals sacrificed 24 hours after challenge.

[0151] Consistent with previous findings (Buffie 2012), treatment with the C. difficile-associated lincosaminde antibiotic clindamycin resulted in increased infection susceptibility for the entire 21-day period post-antibiotic in at least one of six colonies (FIG. 1A). In contrast, treatment with the -lactam (ampicillin) resulted in a relatively short-lived period of susceptibility, with all three ampicillin-treated colonies recovering resistance to infection by day 10 post-antibiotic (FIG. 1B). Treatment with enrofloxacin did not increase susceptibility to C. difficile infection (FIG. 1C), perhaps reflecting the resistance of the mouse colonies to this antibiotic. C. difficile toxin expression correlated significantly with C. difficile abundance in the intestine (FIG. 2b). FIG. 2a shows the strategy for determining C. difficile susceptibility during post-antibiotic exposure. Quantitative RT-PCR of total 16S indicated that none of the antibiotic regimens resulted in substantial decreases in bacterial density (FIG. 2C). Quantification of C. difficile toxin expression in the supernatant from large intestine content correlated strongly with C. difficile abundance, confirming the infection virulence (FIG. 1D). Longitudinal characterization of the intestinal microbiota by 454 pyrosequencing of the bacterial 16S V1-3 region before (FIGS. 1E-G) and after C. difficile challenge revealed that the three antibiotics had diverse impacts on the bacterial phylotype composition as well.

6.2 RESISTANCE-ASSOCIATED MOUSE MICROBIOTA

[0152] We exploited the variance in intestinal bacterial composition and infection susceptibility among mice treated with different antibiotics to determine relationships between C. difficile inhibition and intestinal microbiota structure. A prior study of 10 human patients correlated C. difficile infection with reduced alpha diversity (i.e. diversity within individuals) of the intestinal microbiota .sup.38, and a separate study associated recovery of alpha diversity with the clearance of C. difficile using a murine infection model .sup.35. Consistent with these findings, we found that decreased alpha diversity correlated with susceptibility to infection while the alpha diversity of resistant samples was comparable to pre-treatment microbiota (FIG. 3a).

[0153] Considering beta diversity (i.e. diversity between individuals) of microbiota samples, we found that clindamycin and ampicillin administration induced distinct but overlapping microbiota changes associated with infection susceptibility as indicated by the time-resolved trajectories in unweighted UniFrac.sup.39 principal coordinate plots. Following antibiotic-mediated perturbation, recovery of infection resistance correlated with return to a common coordinate space shared by pre-treatment samples (with unperturbed microbiota) (FIG. 3b). However, these resistance- and susceptibility-associated coordinate spaces overlapped and did not completely resolve seven animals with respect to infection susceptibility. These exceptions generally corresponded to animals transitioning from susceptible to resistant states at early timepoints post-antibiotic and harbored microbiota with low alpha diversity. Interestingly, like beta diversity measured by UniFrac distances, microbiota alpha diversity correlated poorly with infection resistance during this early period following antibiotic exposure, suggesting that recovery of more precise microbiota features (e.g. individual taxa) resulted in enhanced infection resistance.

[0154] We correlated resistance with individual bacterial species abundances, corresponding to operational taxonomic units (OTUs) grouped at 97% 16S sequence identity (FIG. 4), and discovered that 11 bacterial OTUs correlated strongly with infection resistance (FIG. 3 c). These OTUs represent a small fraction of the microbiota membership (6%) and were comprised primarily by Clostridium cluster XIVa, including the OTU with the strongest resistance correlation, Clostridium scindens. Importantly, C. scindens was also one of two OTUs correlated with resistance among animals harboring low-biodiversity microbiota (FIG. 3a, red box) that nevertheless remained resistant to C. difficile (FIG. 3c).

6.3 INTER-SPECIES C. DIFFICILE RESISTANCE

[0155] To assess the relevance of specific bacterial species to C. difficile resistance in humans, we extended our study to a cohort of patients undergoing allogeneic hematopoeitic stem cell transplantation (allo-HSCT). The majority of these patients have been diagnosed with a hematological malignancy and receive conditioning with high doses of chemotherapy and/or total body irradiation as well as various antibiotics during the course of their transplantation, especially while neutropenic and immunodeficient (Table 1). They incur reduced microbiota biodiversity, which is associated with increased risk of bacterial blood stream infections .sup.40 as well as C. difficile infection.sup.41. In contrast to carefully-controlled animal studies, temporal variation in antibiotic administration and sampling times among patients complicates the study of relationships between microbiota composition and susceptibility to infection.

[0156] To address these challenges and evaluate resistance associations of intestinal OTUs in a C. difficile-colonized allo-HSCT patient cohort, we employed a recently developed systems biology approach .sup.42, which integrates antibiotic delivery schedules and time-resolved microbiota sequencing data to mathematically model the contributions of antibiotic sensitivity, bacterial growth rates, and bacteria-bacteria interactions to intestinal microbiota composition dynamics. This model in turn enables the inference of native intestinal bacterial populations that inhibit C. difficile. For our analysis we included allo-HSCT patients with fecal samples PCR-positive for C. difficile 16S and C. difficile toxin B (tcdB) within 7 days post-stem cell infusion (n=24), including 12 patients clinically diagnosed with C. difficile infection and 12 patients that were discovered to be transient C. difficile carriers by retrospective testing (FIG. 5a, FIG. 6, Table 1), with full information on antibiotic treatment, fecal microbiota composition (from 16S rRNA pyrosequencing), as well as total and C. difficile-specific 16S rRNA copies per gram of stool. In parallel, we applied this same modeling approach to our murine C. difficile susceptibility timecourse study. To facilitate comparisons across the mouse and patient datasets, we clustered murine and human microbiota together to define OTUs (97% sequence similarity) and identified 36 phylogenetically diverse OTUs abundant in both mouse and human datasets (>0.01% mean relative abundance) (FIG. 7a, b) that together accounted for a majority of both the human and mouse microbiota structure (FIG. 7c).

[0157] Application of the inference method to the murine dataset identified 9 OTUs displaying strong inhibition against C. difficile (FIG. 5b), including 5 OTUs correlated with resistance in our previous analyses (FIG. 3c). A comparison of the normalized interaction networks from the human (FIG. 7d) and the murine models (FIG. 7e) revealed some differences in the interactions among OTUs. Despite these differences, the human model identified two OTUs strongly inhibiting C. difficile that were also among the C. difficile-inhibitory OTUs identified in the murine model (FIG. 5b, c). The OTU that displayed the strongest C. difficile inhibition was C. scindens, the OTU with the strongest resistance correlations identified in our murine infection susceptibility study (FIG. 3c). Additionally, in both the murine and human models, Blautia was predicted to inhibit (albeit different OTUs), and one OTU was predicted to positively interact with C. difficile. Overall these comparisons indicate that while there are differences in microbiota membership across host species, there may be conserved bacterial species, and perhaps underlying microbial ecology principles, that govern microbiota-mediated resistance against C. difficile infection.

6.4 RATIONAL RESTORATION OF INFECTION RESISTANCE

[0158] To evaluate whether the relationships we identified between native intestinal bacteria and C. difficile infection resistance were causal, we developed a protocol informed by Koch's postulates and bioinformatic approaches to adoptively transfer resistance-associated bacteria. Drawing from our in-house collection and public repositories, we identified and cultured a phylogenetically diverse consortium of four intestinal bacterial isolates with species-level 16S homology to OTUs that were correlated with infection resistance and predicted to inhibit C. difficile in our mouse and human analyses (FIG. 7). This 4-bacteria consortium included Barnesiella intestihominis (OTU 9), Blautia hansenii (OTU 39), Pseudoflavonifractor capillosus (OTU 32) and C. scindens (OTU 6) (FIG. 8). Following antibiotic administration.sup.43 and a two-day antibiotic washout period, 10 separately-housed mice were administered a suspension containing the 4-bacteria consortium or vehicle (PBS) once daily for two days prior to a C. difficile infection challenge (1,000 spores). Additionally, since C. scindens had the strongest resistance correlation in mice (including animals harboring low-biodiversity intestinal microbiota) (FIG. 3c) and was conserved in the human microbiota as the strongest C. difficile inhibitor (FIG. 5b), we administered a suspension containing only this bacterium in a third arm.

[0159] Adoptive transfer of the 4-bacteria consortium ameliorated C. difficile infection (FIG. 9a, b, FIG. 10) as well as associated weight loss (FIG. 9c, FIG. 11) and mortality (FIG. 9d) significantly compared to control. Transfer of the three isolates (B. hansenii, B. intestihominis, and P. capillosus) individually however, did not significantly enhance infection resistance (FIG. 9g). Remarkably, transfer of C. scindens alone was also able to significantly mitigate C. difficile infection by these metrics (FIG. 9a, b, c, d, FIGS. 10, 11). Engraftment of the adoptively transferred bacteria was confirmed (FIG. 12) by their 16S sequence homology to the input suspension as well as the native intestinal bacteria associated with resistance in our initial C. difficile susceptibility timecourse experiments (FIGS. 3,5), thus fulfilling Koch's criteria for establishing causal relationships (albeit between a microbe and a beneficial health outcome rather than a disease, in this case). Additionally, engraftment of C. scindens across all experiment arms correlated significantly with C. difficile infection resistance (FIG. 9c), accounting for a substantial amount of the variability in protection observed among the mice administered C. scindens, suggesting that improving the efficiency of bacterial engraftment may enhance the protective effects of the adoptive transfer. Importantly, adoptive transfer and engraftment of bacteria was precise and did not produce significant changes in the overall microbiota structure that resulted in increased microbiota biodiversity or density compared to control (FIG. 9f,h).

6.5 BILE ACID-DEPENDENT INFECTION RESISTANCE

[0160] Microbiota-derived products can inhibit intestinal pathogens through host-dependent and direct antimicrobial mechanisms, but the bacterial source of most protective products remains undefined. For example, some secondary bile acids can inhibit C. difficile in vitro.sup.44 and are abundant in the intestines of mice and humans .sup.45, but the precise origin of these compounds and their relative contribution to C. difficile inhibition in vivo remains unclear. Noting that C. scindens expresses enzymes crucial for secondary bile acid synthesis .sup.46 that are uncommon among intestinal bacteria .sup.47, we hypothesized that the C. difficile-protective effects of C. scindens may be associated with and dependent upon this rare biosynthetic capacity.

[0161] Biochemical quantification of bile acid species indicated that recovery of secondary bile acids correlated with C. difficile resistance following antibiotic exposure (FIG. 13a). Using the computational approach PICRUSt.sup.48 to infer the abundance of gene families in bacterial communities from our initial murine intestinal microbiota 16S sequencing (FIGS. 1, 3), we found that increased abundance of the secondary bile acid biosynthesis gene family was correlated significantly with C. difficile resistance (FIG. 13b). To confirm the predictive metagenomic results, we subjected intestinal content samples from a representative subset of the same antibiotic-exposed animals to shotgun metagenomic sequencing and targeted quantification of secondary bile acid biosynthesis gene family members. These included bile salt hydrolases and genes comprising the bile acid-inducible (bai) 7/-dehydroxylation operon possessed by C. scindens. Our analysis revealed that abundance of the bai operon was correlated significantly with resistance to C. difficile infection (FIG. 13c) while the bile salt hydrolases (BSHs) were not, consistent with reports indicating that BSH-encoding genes are widely distributed among intestinal bacterial species while an extremely small fraction of the microbiota is estimated to possess a complete secondary bile acid synthesis pathway.sup.47.

[0162] Using a PCR-based assay for baiCD.sup.49, the gene encoding the 7-hydroxysteroid dehydrogenase enzyme critical for converting primary bile acids to secondary species, we confirmed the presence of this gene in the intestinal microbiomes of animals prior to antibiotic exposure and following recovery of C. difficile resistance, as well as its absence among antibiotic-exposed animals who had not recovered resistance (FIG. 14). We also confirmed that mice receiving the 4-bacterium consortium or C. scindens alone, but not those receiving vehicle (PBS), harbored a baiCD+ microbiome. Predictive metagenomic analysis also indicated that the secondary bile acid biosynthesis gene family abundance was restored to pre-antibiotic administration levels in antibiotic-exposed animals that received the 4-bacteria consortium or C. scindens, but not in those that received vehicle (PBS) (FIG. 15). We confirmed that adoptive transfer of the consortium or C. scindens alone restored relative abundance of the secondary bile acids lithocholate (LCA) (FIG. 16a) as well as deoxycholate (DCA) (FIG. 13d), a species previously shown to inhibit C. difficile in vitro.sup.44, and both of which inhibit C. difficile in a dose-dependent fashion (FIG. 16g,h) Notably, this increased synthesis of secondary bile acids does not significantly reduce primary substrates, such as ursodeoxycholate (UDCA) (FIG. 16b), a species associated with host health benefits.sup.50, or significantly alter the abundance of primary bile acids taurocholic acid (TCA), cholic acid (CA), chenodeoxycholic acid (CDCA), and tauro-chenodeoxycholic acid (TCDCA) (FIG. 16c,d,e,f).

[0163] We also evaluated the bile acid-dependence of C. scindens-mediated C. difficile inhibition using a murine ex vivo model of adoptive transfer and infection. Pre-incubation of intestinal content from antibiotic-naive animals with cholestyramine, a bile acid sequestrant, permitted C. difficile growth (FIG. 13g,h). Recapitulating in vivo findings, adoptive transfer of C. scindens significantly inhibited C. difficile in the intestinal content from antibiotic-exposed mice. Critically, this effect was neutralized when intestinal content was pre-incubated with the bile acid-sequestrant cholestyramine (FIG. 13f), indicating that C. scindens-mediated inhibition of C. difficile is dependent upon accessing and modifying bile salts endogenous to the intestinal metabolome.

6.6 CONCLUSIONS

[0164] Taken together, we offer evidence that a small fraction of the murine and human intestinal microbiota, as precise as a single bacterial species, confers resistance against C. difficile through its relatively rare capacity to synthesize C. difficile-inhibiting metabolites from host-derived bile salts. The conservation of this finding across host species is underscored by our use of a human intestinal microbiota-derived C. scindens isolate to augment C. difficile inhibition in murine in vivo and ex vivo systems, and emphasizes the therapeutic and diagnostic potential of these findings. Surveys of the intestinal microbiota indicate that the high activity bile acid 7-dehydroxylating bacteria are among of a group of cluster XIVa Clostridia closely related to one another.sup.47,51,52 and the OTUs identified in this study, suggesting that either the genes or the organisms themselves may serve as specific, functionally meaningful biomarkers in individuals at risk for C. difficile infection. Additionally, this suggests that other bacteria with 16S homology to C. scindens and OTUs identified in this study, many of which have been shown or predicted to possess genes critical for secondary bile acid synthesis.sup.51, may also similarly contribute to C. difficile inhibition. The phylogenetic similarity of these Clostridia can present challenges when assigning taxonomy.sup.53-56, highlighting the importance of integrating functional genomic (e.g. secondary bile acid synthesis genes) and metabolomic (e.g. secondary bile acid species) interrogation with 16S rRNA profiling when screening and validating intestinal microbes of interest, as we have done in this study.

[0165] Intriguingly, recent metabolomic studies indicate that a broad range of intestinal metabolites are altered during antibiotic treatment.sup.57,58 and that FMT can restore secondary bile acids to physiological levels concurrent with resolution of recurrent C. difficile infection in afflicted patients .sup.58, suggesting that replenishment of secondary bile acids and/or the bacteria that synthesize them (such as C. scindens) contributes to the therapeutic efficacy of FMT. Inadvertent modulation of the intestinal bile acid pool may also contribute to the observed benefits.sup.59 of anion exchange resins (ex. cholestyramine) as adjunctive therapy for recurrent C. difficile infection, as such resins can sequester primary bile acids that promote C. difficile spore germination.sup.60. However, some strains of C. difficile are not dependent upon bile salts for germination.sup.61, and germination inhibitors.sup.62 are not effective across all strains either.sup.61. Thus, broadly sequestering the bile pool would theoretically reduce germinants for some C. difficile strains, but would also neutralize secondary bile acids, sometimes disproportionately.sup.63, effectively disinhibiting vegetative C. difficile growth. Since C. scindens consumes primary bile salts as substrate (e.g. decreasing C. difficile spore germinants) in the synthesis of secondary bile acids (e.g. increasing vegetative C. difficile inhibitors), remodeling bile species proportions in this fashion may exploit the therapeutic potential of bile modulation better than broad neutralization using sequestrants.

[0166] Direct manipulation of intestinal bile acids may be effective for treatment and prevention of C. difficile infection, but caution is warranted since some bile species, including secondary bile acids, have been implicated in the promotion of cholesterol gallstone disease and gastrointestinal cancers.sup.64. Other bile species, such as UDCA, may ameliorate or protect against such diseases.sup.50, and remain at physiological levels in antibiotic-exposed animals reconstituted with C. scindens in our study. In these regards, such potent microbiome-mediated chemistry may be therapeutically optimal when driven by the bacteria of origin; other aspects of C. scindens physiology and ecology may be critical to ensure secondary bile acid is synthesized, targeted, and otherwise regulated to ensure effective pathogen colonization resistance while avoiding pathological imbalances. Knowledge of these mechanisms, coupled with an appreciation for the ecological context of those microbes responsible, will facilitate amplification of natural microbiota-mediated pathogen resistance in individuals at risk for C. difficile infection.

REFERENCES

[0167] 1. Turnbaugh, P. J., Hamady, M., Yatsunenko, T., Cantarel, B. L., et al. A core gut microbiome in obese and lean twins. Nature 457, 480-484 (2009). [0168] 2. Koeth, R. A., Wang, Z., Levison, B. S., Buffa, J. A., et al. Intestinal microbiota metabolism of l-carnitine, a nutrient in red meat, promotes atherosclerosis. Nat Med (2013). [0169] 3. Rakoff-Nahoum, S., Paglino, J., Eslami-Varzaneh, F., Edberg, S. & Medzhitov, R. Recognition of commensal microflora by toll-like receptors is required for intestinal homeostasis. Cell 118, 229-241 (2004). [0170] 4. Ivanov, I. I., Atarashi, K., Manel, N., Brodie, E. L., et al. Induction of intestinal Th17 cells by segmented filamentous bacteria. Cell 139, 485-498 (2009). [0171] 5. Chung, H., Pamp, S. J., Hill, J. A., Surana, N. K., et al. Gut immune maturation depends on colonization with a host-specific microbiota. Cell 149, 1578-1593 (2012). [0172] 6. Diehl, G. E., Longman, R. S., Zhang, J. X., Breart, B., et al. Microbiota restricts trafficking of bacteria to mesenteric lymph nodes by CX(3)CR1(hi) cells. Nature 494, 116-120 (2013). [0173] 7. Duan, J., Chung, H., Troy, E. & Kasper, D. L. Microbial colonization drives expansion of IL-1 receptor 1-expressing and IL-17-producing gamma/delta T cells. Cell Host Microbe 7, 140-150 (2010). [0174] 8. Farache, J., Koren, I., Milo, I., Gurevich, I., et al. Luminal Bacteria Recruit CD103(+) Dendritic Cells into the Intestinal Epithelium to Sample Bacterial Antigens for Presentation. Immunity 38, 581-595 (2013). [0175] 9. Olszak, T., An, D., Zeissig, S., Vera, M. P., et al. Microbial exposure during early life has persistent effects on natural killer T cell function. Science 336, 489-493 (2012). [0176] 10. Wingender, G., Stepniak, D., Krebs, P., Lin, L., et al. Intestinal microbes affect phenotypes and functions of invariant natural killer T cells in mice. Gastroenterology 143, 418-428 (2012). [0177] 11. Hand, T. W., Dos Santos, L. M., Bouladoux, N., Molloy, M. J., et al. Acute gastrointestinal infection induces long-lived microbiota-specific T cell responses. Science 337, 1553-1556 (2012). [0178] 12. Hill, D. A., Siracusa, M. C., Abt, M. C., Kim, B. S., et al. Commensal bacteria-derived signals regulate basophil hematopoiesis and allergic inflammation. Nat Med 18, 538-546 (2012). [0179] 13. Lathrop, S. K., Bloom, S. M., Rao, S. M., Nutsch, K., et al. Peripheral education of the immune system by colonic commensal microbiota. Nature 478, 250-254 (2011). [0180] 14. Macpherson, A. J. & Uhr, T. Induction of protective IgA by intestinal dendritic cells carrying commensal bacteria. Science 303, 1662-1665 (2004). [0181] 15. Basler, M., Ho, B. T. & Mekalanos, J. J. Tit-for-tat: type VI secretion system counterattack during bacterial cell-cell interactions. Cell 152, 884-894 (2013). [0182] 16. Basler, M., Pilhofer, M., Henderson, G. P., Jensen, G. J. & Mekalanos, J. J. Type VI secretion requires a dynamic contractile phage tail-like structure. Nature 483, 182-186 (2012). [0183] 17. Rea, M. C., Dobson, A., O'Sullivan, O., Crispie, F., et al. Effect of broad- and narrow-spectrum antimicrobials on Clostridium difficile and microbial diversity in a model of the distal colon. Proc Natl Acad Sci USA 108 Suppl 1, 4639-4644 (2011). [0184] 18. Rea, M. C., Sit, C. S., Clayton, E., O'Connor, P. M., et al. Thuricin C D, a posttranslationally modified bacteriocin with a narrow spectrum of activity against Clostridium difficile. Proc Natl Acad Sci USA 107, 9352-9357 (2010). [0185] 19. Abt, M. C., Osborne, L. C., Monticelli, L. A., Doering, T. A., et al. Commensal bacteria calibrate the activation threshold of innate antiviral immunity. Immunity 37, 158-170 (2012). [0186] 20. Huse, S. M., Dethlefsen, L., Huber, J. A., Mark Welch, D., et al. Exploring microbial diversity and taxonomy using SSU rRNA hypervariable tag sequencing. PLoS Genet 4, e1000255 (2008). [0187] 21. Dethlefsen, L. & Relman, D. A. Incomplete recovery and individualized responses of the human distal gut microbiota to repeated antibiotic perturbation. Proc Natl Acad Sci USA 108 Suppl 1, 4554-4561 (2011). [0188] 22. Buffie, C. G., Jarchum, I., Equinda, M., Lipuma, L., et al. Profound alterations of intestinal microbiota following a single dose of clindamycin results in sustained susceptibility to Clostridium difficile-induced colitis. Infect Immun 80, 62-73 (2012). [0189] 23. Brandl, K., Plitas, G., Mihu, C. N., Ubeda, C., et al. Vancomycin-resistant enterococci exploit antibiotic-induced innate immune deficits. Nature 455, 804-807 (2008). [0190] 24. Ubeda, C., Taur, Y., Jenq, R. R., Equinda, M. J., et al. Vancomycin-resistant Enterococcus domination of intestinal microbiota is enabled by antibiotic treatment in mice and precedes bloodstream invasion in humans. J Clin Invest 120, 4332-4341 (2010). [0191] 25. Ferreira, R. B., Gill, N., Willing, B. P., Antunes, L. C., et al. The intestinal microbiota plays a role in Salmonella-induced colitis independent of pathogen colonization. PLoS One 6, e20338 (2011). [0192] 26. Rupnik, M., Wilcox, M. H. & Gerding, D. N. Clostridium difficile infection: new developments in epidemiology and pathogenesis. Nat Rev Microbiol 7, 526-536 (2009). [0193] 27. Kyne, L., Hamel, M. B., Polavaram, R. & Kelly, C. P. Health care costs and mortality associated with nosocomial diarrhea due to Clostridium difficile. Clin Infect Dis 34, 346-353 (2002). [0194] 28. Zilberberg, M. D., Shorr, A. F. & Kollef, M. H. Increase in adult Clostridium difficile-related hospitalizations and case-fatality rate, United States, 2000-2005. Emerg Infect Dis 14, 929-931 (2008). [0195] 29. Surawicz, C. M. & Alexander, J. Treatment of refractory and recurrent Clostridium difficile infection. Nat Rev Gastroenterol Hepatol 8, 330-339 (2011). [0196] 30. Marsh, J. W., Arora, R., Schlackman, J. L., Shutt, K. A., et al. Association of relapse of Clostridium difficile disease with BI/NAP1/027. J Clin Microbiol 50, 4078-4082 (2012). [0197] 31. Bakken, J. S., Borody, T., Brandt, L. J., Brill, J. V., et al. Treating Clostridium difficile infection with fecal microbiota transplantation. Clin Gastroenterol Hepatol 9, 1044-1049 (2011). [0198] 32. van Nood, E., Vrieze, A., Nieuwdorp, M., Fuentes, S., et al. Duodenal infusion of donor feces for recurrent Clostridium difficile. N Engl J Med 368, 407-415 (2013). [0199] 33. Pamer, E. G. Fecal microbiota transplantation: effectiveness, complexities, and lingering concerns. Mucosal Immunol 7, 210-214 (2014). [0200] 34. Reeves, A. E., Theriot, C. M., Bergin, I. L., Huffnagle, G. B., et al. The interplay between microbiome dynamics and pathogen dynamics in a murine model of Clostridium difficile
Infection. Gut Microbes 2, 145-158 (2011). [0201] 35. Lawley, T. D., Clare, S., Walker, A. W., Stares, M. D., et al. Targeted restoration of the intestinal microbiota with a simple, defined bacteriotherapy resolves relapsing Clostridium difficile disease in mice. PLoS Pathog 8, e1002995 (2012). [0202] 36. Petrof, E. O., Gloor, G. B., Vanner, S. J., Weese, S. J., et al. Stool substitute transplant therapy for the eradication of Clostridium difficile infection: RePOOPulating the gut. Microbiome 1, 3 (2013). [0203] 37. Hamilton, M. J., Weingarden, A. R., Unno, T., Khoruts, A. & Sadowsky, M. J. High-throughput DNA sequence analysis reveals stable engraftment of gut microbiota following transplantation of previously frozen fecal bacteria. Gut Microbes 4, 125-135 (2013). [0204] 38. Chang, J. Y., Antonopoulos, D. A., Kalra, A., Tonelli, A., et al. Decreased diversity of the fecal Microbiome in recurrent Clostridium difficile-associated diarrhea. J Infect Dis 197, 435-438 (2008). [0205] 39. Lozupone, C. & Knight, R. UniFrac: a new phylogenetic method for comparing microbial communities. Appl Environ Microbiol 71, 8228-8235 (2005). [0206] 40. Taur, Y., Xavier, J. B., Lipuma, L., Ubeda, C., et al. Intestinal domination and the risk of bacteremia in patients undergoing allogeneic hematopoietic stem cell transplantation. Clin Infect Dis 55, 905-914 (2012). [0207] 41. Kinnebrew, M. A., Lee, Y. J., Jenq, R. R., Lipuma, L., et al. Early Clostridium difficile Infection during Allogeneic Hematopoietic Stem Cell Transplantation. PLoS One 9, e90158 (2014). [0208] 42. Stein, R. R., Bucci, V., Toussaint, N. C., Buffie, C. G., et al. Ecological modeling from time-series inference: insight into dynamics and stability of intestinal microbiota. PLoS Comput Biol 9, e1003388 (2013). [0209] 43. Chen, X., Katchar, K., Goldsmith, J. D., Nanthakumar, N., et al. A mouse model of Clostridium difficile-associated disease. Gastroenterology 135, 1984-1992 (2008). [0210] 44. Sorg, J. A. & Sonenshein, A. L. Bile salts and glycine as cogerminants for Clostridium difficile spores. J Bacteriol 190, 2505-2512 (2008). [0211] 45. de Aguiar Vallim, T. Q., Tarling, E. J. & Edwards, P. A. Pleiotropic roles of bile acids in metabolism. Cell Metab 17, 657-669 (2013). [0212] 46. Kang, D. J., Ridlon, J. M., Moore, D. R., Barnes, S. & Hylemon, P. B. Clostridium scindens baiCD and baiH genes encode stereo-specific 7alpha/7beta-hydroxy-3-oxo-delta4-cholenoic acid oxidoreductases. Biochim Biophys Acta 1781, 16-25 (2008). [0213] 47. Ridlon, J. M., Kang, D. J. & Hylemon, P. B. Bile salt biotransformations by human intestinal bacteria. J Lipid Res 47, 241-259 (2006). [0214] 48. Langille, M. G., Zaneveld, J., Caporaso, J. G., McDonald, D., et al. Predictive functional profiling of microbial communities using 16S rRNA marker gene sequences. Nat Biotechnol 31, 814-821 (2013). [0215] 49. Wells, J. E., Williams, K. B., Whitehead, T. R., Heuman, D. M. & Hylemon, P. B. Development and application of a polymerase chain reaction assay for the detection and enumeration of bile acid 7-dehydroxylating bacteria in human feces. Clinica Chimica Acta 331, 127-134 (2003). [0216] 50. Barrasa, J. I., Olmo, N., Lizarbe, M. A. & Turnay, J. Bile acids in the colon, from healthy to cytotoxic molecules. Toxicol In Vitro 27, 964-977 (2013). [0217] 51. Kitahara, M., Takamine, F., Imamura, T. & Benno, Y. Assignment of Eubacterium sp. VPI 12708 and related strains with high bile acid 7alpha-dehydroxylating activity to Clostridium scindens and proposal of Clostridium hylemonae sp. nov., isolated from human faeces. Int J Syst Evol Microbiol 50 Pt 3, 971-978 (2000). [0218] 52. Wells, E. & Hylemon, B. Identification and Characterization of a Bile Acid 7alpha-Dehydroxylation Operon in Clostridium sp. Strain TO-931, a Highly Active 7alpha-Dehydroxylating Strain Isolated from Human Feces. Applied and Environmental Microbiology 66, 1107-1113 (2000). [0219] 53. Collins, M. D., Lawson, P. A., Willems, A., Cordoba, J. J., et al. The phylogeny of the genus Clostridium: proposal of five new genera and eleven new species combinations. Int J Syst Bacteriol 44, 812-826 (1994). [0220] 54. Liu, C., Finegold, S. M., Song, Y. & Lawson, P. A. Reclassification of Clostridium coccoides, Ruminococcus hansenii, Ruminococcus hydrogenotrophicus, Ruminococcus luti, Ruminococcus productus and Ruminococcus schinkii as Blautia coccoides gen. nov., comb. nov., Blautia hansenii comb. nov., Blautia hydrogenotrophica comb. nov., Blautia luti comb. nov., Blautia producta comb. nov., Blautia schinkii comb. nov. and description of Blautia wexlerae sp. nov., isolated from human faeces. Int J Syst Evol Microbiol 58, 1896-1902 (2008). [0221] 55. Carlier, J. P., Bedora-Faure, M., K'ouas, G., Alauzet, C. & Mory, F. Proposal to unify Clostridium orbiscindens Winter et al. 1991 and Eubacterium plautii (Sguin 1928) Hofstad and Aasjord 1982, with description of Flavonifractor plautii gen. nov., comb. nov., and reassignment of Bacteroides capillosus to Pseudoflavonifractor capillosus gen. nov., comb. nov. Int J Syst Evol Microbiol 60, 585-590 (2010). [0222] 56. Yutin, N. & Galperin, M. Y. A genomic update on clostridial phylogeny: Gram-negative spore formers and other misplaced clostridia. Environ Microbiol 15, 2631-2641 (2013). [0223] 57. Theriot, C. M., Koenigsknecht, M. J., Carlson, P. E., Hatton, G. E., et al. Antibiotic-induced shifts in the mouse gut microbiome and metabolome increase susceptibility to Clostridium difficile infection. Nature Communications 5, (2014). [0224] 58. Weingarden, A. R., Chen, C., Bobr, A., Yao, D., et al. Microbiota transplantation restores normal fecal bile acid composition in recurrent Clostridium difficile infection. Am J Physiol Gastrointest Liver Physiol 306, G310-G319 (2014). [0225] 59. Louie, T. J., Peppe, J., Watt, C. K., Johnson, D., et al. Tolevamer, a novel nonantibiotic polymer, compared with vancomycin in the treatment of mild to moderately severe Clostridium difficile-associated diarrhea. Clin Infect Dis 43, 411-420 (2006). [0226] 60. Giel, J. L., Sorg, J. A., Sonenshein, A. L. & Zhu, J. Metabolism of bile salts in mice influences spore germination in Clostridium difficile. PLoS One 5, e8740 (2010). [0227] 61. Heeg, D., Burns, D. A., Cartman, S. T. & Minton, N. P. Spores of Clostridium difficile clinical isolates display a diverse germination response to bile salts. PLoS One 7, e32381 (2012). [0228] 62. Sorg, J. A. & Sonenshein, A. L. Chenodeoxycholate is an inhibitor of Clostridium difficile spore germination. J Bacteriol 191, 1115-1117 (2009). [0229] 63. Out, C., Groen, A. K. & Brufau, G. Bile acid sequestrants: more than simple resins. Curr Opin Lipidol 23, 43-55 (2012). [0230] 64. Bernstein, H., Bernstein, C., Payne, C. M., Dvorakova, K. & Garewal, H. Bile acids as carcinogens in human gastrointestinal cancers. Mutat Res 589, 47-65 (2005). [0231] 65. Edgar, R. C., Haas, B. J., Clemente, J. C., Quince, C. & Knight, R. UCHIME improves sensitivity and speed of chimera detection. Bioinformatics 27, 2194-2200 (2011). [0232] 66. Schloss, P. D., Westcott, S. L., Ryabin, T., Hall, J. R., et al. Introducing mothur: open-source, platform-independent, community-supported software for describing and comparing microbial communities. Appl Environ Microbiol 75, 7537-7541 (2009). [0233] 67. Human Microbiome Project Consortium Structure, function and diversity of the healthy human microbiome. Nature 486, 207-214 (2012). [0234] 68. Caporaso, J. G., Lauber, C. L., Walters, W. A., Berg-Lyons, D., et al. Ultra-high-throughput microbial community analysis on the Illumina HiSeq and MiSeq platforms. ISME J 6, 1621-1624 (2012). [0235] 69. Ubeda, C., Bucci, V., Caballero, S., Djukovic, A., et al. Intestinal microbiota containing Barnesiella cures vancomycin-resistant Enterococcus faecium colonization. Infect Immun 81, 965-973 (2013). [0236] 70. Sheneman, L., Evans, J. & Foster, J. A. Clearcut: a fast implementation of relaxed neighbor joining. Bioinformatics 22, 2823-2824 (2006).

[0237] 71 JG Caporaso, J Kuczynski, J Stombaugh, K Bittinger, F D Bushman, E K Costello, N Fierer, A G Pea, J K Goodrich, J I Gordon, G A Huttley, S T Kelley, D Knights, J E Koenig, R E Ley, C A Lozupone, D McDonald, B D Muegge, M Pirrung, J Reeder, J R Sevinsky, P J Turnbaugh, W A Walters, J Widmann, T Yatsunenko, J Zaneveld, R Knight, QIIME allows analysis of high-throughput community sequencing data., Nat Methods. 2010 May; 7(5):335-6. [0238] 72. Hall, B. G. Building phylogenetic trees from molecular data with MEGA. Mol Biol Evol 30, 1229-1235 (2013). [0239] 73. Zhao, Y., Tang, H. & Ye, Y. RAPSearch2: a fast and memory-efficient protein similarity search tool for next-generation sequencing data. Bioinformatics 28, 125-126 (2012). [0240] 74. Cohen, J. Statistical power analysis for the behavioral sciences (Routledge, Hillsdale, NJ, 1988). [0241] 75. Stein, R. R., Bucci, V., Toussaint, N. C., Buffie, C. G., et al. Ecological modeling from time-series inference: insight into dynamics and stability of intestinal microbiota. PLoS Comput Biol 9, e1003388 (2013). [0242] 76. Bartlett J G, Chang T W, Gurwith M et al., 1978. Antibiotic-associated pseudomembranous colitis due to toxin-producing clostridia. N. Engl. J. Med. 298:531-534. [0243] 77 Buffie and Pamer, 2013. Microbiota-mediated colonization resistance against intestinal pathogens. Nature Reviews Immunology 13:790-801. [0244] 78. Chen X and Lamont J T, 2013. Overview of Clostridium difficile infection: implications for China. Gastroenterology Report 1:153-158. [0245] 79. Ridlon J M et al., 2013. Clostridium scindens: a human gut microbe with a high potential to convert glucocorticoids into androgens. J. Lipid Res. 54:2437-2449. [0246] 80. Ridlon J M and Hylemon P B, 2012. Identification and characterization of two bile-acid coenzyme A transferases from Clostridium scindens, a bile acid 7-dehydroxylating intestinal bacterium. J. Lipid Res. 53:66-76. [0247] 81. Ridlon J M et al., 2006. Bile salt biotransformations by Human Intestinal bacteria. J. Lipid Res. 47:241-259. [0248] 82. Zar F A, Bakkanagari S R et al., 2007. A comparison of vancomycin and metronidazole for the treatment of Clostridium difficile-associated diarrhea, stratified by disease severity. Clin. Infect. Dis. 45:302-307.

[0249] Various references and sequence accession numbers are cited herein, the contents of which are hereby incorporated by reference in their entireties.