HIV-1 antibodies
12612449 ยท 2026-04-28
Assignee
Inventors
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
International classification
Abstract
The invention relates to antigen binding sites, antibodies and fragments thereof, as well as compositions, kits and uses thereof for the treatment, attenuation and/or prevention of human immunodeficiency virus type 1 (HIV-1).
Claims
1. An antibody or antigen binding fragment thereof for binding human immunodeficiency virus type 1 (HIV-1), wherein the antibody or antigen binding fragment thereof comprises: a) a heavy chain complementarity determining region 1 (CDRH1) set forth in SEQ ID NO: 1, a CDRH2 set forth in SEQ ID NO: 2, a CDRH3 set forth in SEQ ID NO: 3, a light chain complementarity determining region 1 (CDRL1) set forth in SEQ ID NO: 39, a CDRL2 set forth in SEQ ID NO: 40, and a CDRL3 set forth in SEQ ID NO: 41; b) a CDRH1 set forth in SEQ ID NO: 1, a CDRH2 set forth in SEQ ID NO: 2, a CDRH3 set forth in SEQ ID NO: 3, a CDRL1 set forth in SEQ ID NO: 74, a CDRL2 set forth in SEQ ID NO: 75, and a CDRL3 set forth in SEQ ID NO: 76; c) a CDRH1 set forth in SEQ ID NO: 1, a CDRH2 set forth in SEQ ID NO: 2, a CDRH3 set forth in SEQ ID NO: 3, a CDRL1 set forth in SEQ ID NO: 83, a CDRL2 set forth in SEQ ID NO: 84, and a CDRL3 set forth in SEQ ID NO: 85; d) a CDRH1 set forth in SEQ ID NO: 87, a CDRH2 set forth in SEQ ID NO: 88, a CDRH3 set forth in SEQ ID NO: 89, a CDRL1 set forth in SEQ ID NO: 131, a CDRL2 set forth in SEQ ID NO: 132, and a CDRL3 set forth in SEQ ID NO: 133; e) a CDRH1 set forth in SEQ ID NO: 87, a CDRH2 set forth in SEQ ID NO: 88, a CDRH3 set forth in SEQ ID NO: 89, a CDRL1 set forth in SEQ ID NO: 131, a CDRL2 set forth in SEQ ID NO: 132, and a CDRL3 set forth in SEQ ID NO: 76; f) a CDRH1 set forth in SEQ ID NO: 87, a CDRH2 set forth in SEQ ID NO: 88, a CDRH3 set forth in SEQ ID NO: 89, a CDRL1 set forth in SEQ ID NO: 131, a CDRL2 set forth in SEQ ID NO: 132, and a CDRL3 set forth in SEQ ID NO: 85; g) a CDRH1 set forth in SEQ ID NO: 17, a CDRH2 set forth in SEQ ID NO: 18, a CDRH3 set forth in SEQ ID NO: 19, a CDRL1 set forth in SEQ ID NO: 39, a CDRL2 set forth in SEQ ID NO: 40, and a CDRL3 set forth in SEQ ID NO: 41; h) a CDRH1 set forth in SEQ ID NO: 17, a CDRH2 set forth in SEQ ID NO: 18, a CDRH3 set forth in SEQ ID NO: 19, a CDRL1 set forth in SEQ ID NO: 74, a CDRL2 set forth in SEQ ID NO: 75, and a CDRL3 set forth in SEQ ID NO: 76; i) a CDRH1 set forth in SEQ ID NO: 17, a CDRH2 set forth in SEQ ID NO: 18, a CDRH3 set forth in SEQ ID NO: 19, a CDRL1 set forth in SEQ ID NO: 83, a CDRL2 set forth in SEQ ID NO: 84, and a CDRL3 set forth in SEQ ID NO: 85; j) a CDRH1 set forth in SEQ ID NO: 101, a CDRH2 set forth in SEQ ID NO: 102, a CDRH3 set forth in SEQ ID NO: 103, a CDRL1 set forth in SEQ ID NO: 131, a CDRL2 set forth in SEQ ID NO: 132, and a CDRL3 set forth in SEQ ID NO: 133; k) a CDRH1 set forth in SEQ ID NO: 101, a CDRH2 set forth in SEQ ID NO: 102, a CDRH3 set forth in SEQ ID NO: 103, a CDRL1 set forth in SEQ ID NO: 131, a CDRL2 set forth in SEQ ID NO: 132, and a CDRL3 set forth in SEQ ID NO: 76; l) a CDRH1 set forth in SEQ ID NO: 101, a CDRH2 set forth in SEQ ID NO: 102, a CDRH3 set forth in SEQ ID NO: 103, a CDRL1 set forth in SEQ ID NO: 131, a CDRL2 set forth in SEQ ID NO: 132, and a CDRL3 set forth in SEQ ID NO: 85; m) a CDRH1 set forth in SEQ ID NO: 33, a CDRH2 set forth in SEQ ID NO: 34, a CDRH3 set forth in SEQ ID NO: 35, a CDRL1 set forth in SEQ ID NO: 39, a CDRL2 set forth in SEQ ID NO: 40, and a CDRL3 set forth in SEQ ID NO: 41; n) a CDRH1 set forth in SEQ ID NO: 33, a CDRH2 set forth in SEQ ID NO: 34, a CDRH3 set forth in SEQ ID NO: 35, a CDRL1 set forth in SEQ ID NO: 74, a CDRL2 set forth in SEQ ID NO: 75, and a CDRL3 set forth in SEQ ID NO: 76; o) a CDRH1 set forth in SEQ ID NO: 33, a CDRH2 set forth in SEQ ID NO: 34, a CDRH3 set forth in SEQ ID NO: 35, a CDRL1 set forth in SEQ ID NO: 83, a CDRL2 set forth in SEQ ID NO: 84, and a CDRL3 set forth in SEQ ID NO: 85; p) a CDRH1 set forth in SEQ ID NO: 115, a CDRH2 set forth in SEQ ID NO: 116, a CDRH3 set forth in SEQ ID NO: 117, a CDRL1 set forth in SEQ ID NO: 131, a CDRL2 set forth in SEQ ID NO: 132, and a CDRL3 set forth in SEQ ID NO: 133; q) a CDRH1 set forth in SEQ ID NO: 115, a CDRH2 set forth in SEQ ID NO: 116, a CDRH3 set forth in SEQ ID NO: 117, a CDRL1 set forth in SEQ ID NO: 131, a CDRL2 set forth in SEQ ID NO: 132, and a CDRL3 set forth in SEQ ID NO: 76; or r) a CDRH1 set forth in SEQ ID NO: 115, a CDRH2 set forth in SEQ ID NO: 116, a CDRH3 set forth in SEQ ID NO: 117, a CDRL1 set forth in SEQ ID NO: 131, a CDRL2 set forth in SEQ ID NO: 132, and a CDRL3 set forth in SEQ ID NO: 85.
2. The antibody or antigen binding fragment thereof of claim 1, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region set forth in SEQ ID NO: 15, and a light chain variable region set forth in SEQ ID NO: 63 or 73.
3. The antibody or antigen binding fragment thereof of claim 1, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region set forth in SEQ ID NO: 31, and a light chain variable region set forth in SEQ ID NO: 63 or 73.
4. The antibody or antigen binding fragment thereof of claim 1, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region set forth in SEQ ID NO: 61, and a light chain variable region set forth in SEQ ID NO: 63 or 73.
5. A fusion protein comprising an antibody or antigen binding fragment thereof according to claim 1.
6. A conjugate in the form of an antibody or antigen binding fragment thereof according to claim 1, conjugated to a label or a cytotoxic agent.
7. A nucleic acid encoding an antibody or antigen binding fragment thereof according to claim 1.
8. A cell comprising a nucleic acid according to claim 7.
9. A pharmaceutical composition comprising an antibody or antigen binding fragment thereof according to claim 1 and a pharmaceutically acceptable carrier, diluent, or excipient.
10. A method for treating, inhibiting, or neutralising a human immunodeficiency virus type-1 (HIV-1) infection in a subject in need thereof, or increasing survival of a subject, comprising administering an effective amount of the antibody or antigen binding fragment thereof of claim 1 to a subject, thereby treating, inhibiting, or neutralising a HIV-1 infection, or increasing survival in the subject in need thereof.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
DETAILED DESCRIPTION OF THE EMBODIMENTS
(15) It will be understood that the invention disclosed and defined in this specification extends to all alternative combinations of two or more of the individual features mentioned or evident from the text or drawings. All of these different combinations constitute various alternative aspects of the invention.
(16) Further aspects of the present invention and further embodiments of the aspects described in the preceding paragraphs will become apparent from the following description, given by way of example and with reference to the accompanying drawings.
(17) Reference will now be made in detail to certain embodiments of the invention. While the invention will be described in conjunction with the embodiments, it will be understood that the intention is not to limit the invention to those embodiments. On the contrary, the invention is intended to coverall alternatives, modifications, and equivalents, which may be included within the scope of the present invention as defined by the claims.
(18) The inventors have herein generated a new therapeutic approach to the treatment of HIV-1 infection based on the generation of broadly neutralising antibodies (BrNAbs) against the HIV-1 Env protein. In particular, the inventors have generated antigen binding sites based on bovine BrNAbs which have higher potency than human BrNAbs due to their long finger-like CDRH3 regions that make intimate contact with conserved deeply recessed target sites on the Env protein.
(19) The antigen binding sites and antibodies developed herein are associated with one or more, or all, of the following technical advantages: They are broadly neutralising HIV-1 antibodies which are capable of neutralizing multiple HIV-1 viral strains by targeting conserved epitopes of the HIV-1 Env protein. They may comprise a human constant region and a bovine variable region, which provides utility for use in humans. They have high affinity binding to a number of variants of the Env gp120 monomer and trimer on infectious virion and infected cells. They have been shown to have up to 50 fold better potency than the commercially available therapeutic antibodies that are used for the treatment of HIV-1 infection, including antibody VRC01. They are capable of binding to multiple forms of HIV-1 Env including monomeric gp120, uncleaved gp140 and SOSIP gp140. They are capable of binding to the Env trimer ConM SOSIP, which has a consensus sequence common to all HIV-1 group M isolates. They can neutralise the HIV-1 virus at lower concentrations than other HIV-1 antibodies, as shown by IC.sub.50 values. They are not polyreactive or autoreactive, unlike antibody VRC01, highlighting their safety as anti-HIV therapeutics. Their activity is not dependent on the light chain variable region, as the use of different light chain variable regions as in conjunction with heavy chain variable regions of the invention shown herein retains antibody function.
(20) The above advantages are significant in so far as they demonstrate that the antigen binding sites and antibodies described herein hold utility in the prevention, attenuation, treatment, neutralisation and/or inhibition of HIV-1 infection.
General
(21) Throughout this specification, unless specifically stated otherwise or the context requires otherwise, reference to a single step, composition of matter, group of steps or group of compositions of matter shall be taken to encompass one and a plurality (i.e. one or more) of those steps, compositions of matter, groups of steps or groups of compositions of matter. Thus, as used herein, the singular forms a, an and the include plural aspects, and vice versa, unless the context clearly dictates otherwise. For example, reference to a includes a single as well as two or more; reference to an includes a single as well as two or more; reference to the includes a single as well as two or more and so forth.
(22) Those skilled in the art will appreciate that the present invention is susceptible to variations and modifications other than those specifically described. It is to be understood that the invention includes all such variations and modifications. The invention also includes all of the steps, features, compositions and compounds referred to or indicated in this specification, individually or collectively, and any and all combinations or any two or more of said steps or features.
(23) One skilled in the art will recognize many methods and materials similar or equivalent to those described herein, which could be used in the practice of the present invention. The present invention is in no way limited to the methods and materials described.
(24) All of the patents and publications referred to herein are incorporated by reference in their entirety.
(25) The present invention is not to be limited in scope by the specific examples described herein, which are intended for the purpose of exemplification only. Functionally-equivalent products, compositions and methods are clearly within the scope of the present invention.
(26) Any example or embodiment of the present invention herein shall be taken to apply mutatis mutandis to any other example or embodiment of the invention unless specifically stated otherwise.
(27) Unless specifically defined otherwise, all technical and scientific terms used herein shall be taken to have the same meaning as commonly understood by one of ordinary skill in the art (for example, in cell culture, molecular genetics, immunology, immunohistochemistry, protein chemistry, and biochemistry).
(28) Unless otherwise indicated, the recombinant protein, cell culture, and immunological techniques utilized in the present disclosure are standard procedures, well known to those skilled in the art. Such techniques are described and explained throughout the literature in sources such as, J. Perbal, A Practical Guide to Molecular Cloning, John Wiley and Sons (1984), J. Sambrook et al. Molecular Cloning: A Laboratory Manual, Cold Spring Harbour Laboratory Press (1989), T. A. Brown (editor), Essential Molecular Biology: A Practical Approach, Volumes 1 and 2, IRL Press (1991), D. M. Glover and B. D. Hames (editors), DNA Cloning: A Practical Approach, Volumes 1-4, IRL Press (1995 and 1996), and F. M. Ausubel et al. (editors), Current Protocols in Molecular Biology, Greene Pub. Associates and Wiley-Interscience (1988, including all updates until present), Ed Harlow and David Lane (editors) Antibodies: A Laboratory Manual, Cold Spring Harbour Laboratory, (1988), and J. E. Coligan et al. (editors) Current Protocols in Immunology, John Wiley & Sons (including all updates until present).
(29) The description and definitions of variable regions and parts thereof, immunoglobulins, antibodies and fragments thereof herein may be further clarified by the discussion in Kabat Sequences of Proteins of Immunological Interest, National Institutes of Health, Bethesda, Md., 1987 and 1991, Bork et al., J Mol. Biol. 242, 309-320, 1994, Chothia and Lesk J. Mol Biol. 196:901-917, 1987, Chothia et al. Nature 342, 877-883, 1989 and/or or Al-Lazikani et al., J Mol Biol 273, 927-948, 1997.
(30) The term and/or, e.g., X and/or Y shall be understood to mean either X and Y or X or Y and shall be taken to provide explicit support for both meanings or for either meaning.
(31) As used herein the term derived from shall be taken to indicate that a specified integer may be obtained from a particular source albeit not necessarily directly from that source.
(32) Reference herein to a range of, e.g., residues, will be understood to be inclusive. For example, reference to a region comprising amino acids 56 to 65 will be understood in an inclusive manner, i.e., the region comprises a sequence of amino acids as numbered 56, 57, 58, 59, 60, 61, 62, 63, 64 and 65 in a specified sequence.
Selected Definitions
(33) The term human immunodeficiency virus type 1 or HIV-1 as provided herein includes any of the HIV-1 naturally occurring forms, homologs or variants that maintain the activity of HIV-1 (e.g., within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to the native protein). In some embodiments, variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring form.
(34) The term isolated protein or isolated polypeptide is a protein or polypeptide that by virtue of its origin or source of derivation is not associated with naturally-associated components that accompany it in its native state; is substantially free of other proteins from the same source. A protein may be rendered substantially free of naturally associated components or substantially purified by isolation, using protein purification techniques known in the art. By substantially purified is meant the protein is substantially free of contaminating agents, e.g., at least about 70% or 75% or 80% or 85% or 90% or 95% or 96% or 97% or 98% or 99% free of contaminating agents.
(35) The term recombinant shall be understood to mean the product of artificial genetic recombination. Accordingly, in the context of a recombinant protein comprising an antibody antigen binding domain, this term does not encompass an antibody naturally-occurring within a subject's body that is the product of natural recombination that occurs during B cell maturation. However, if such an antibody is isolated, it is to be considered an isolated protein comprising an antibody antigen binding domain. Similarly, if nucleic acid encoding the protein is isolated and expressed using recombinant means, the resulting protein is a recombinant protein comprising an antibody antigen binding domain. A recombinant protein also encompasses a protein expressed by artificial recombinant means when it is within a cell, tissue or subject, e.g., in which it is expressed.
(36) The term protein shall be taken to include a single polypeptide chain, i.e., a series of contiguous amino acids linked by peptide bonds or a series of polypeptide chains covalently or non-covalently linked to one another (i.e., a polypeptide complex). For example, the series of polypeptide chains can be covalently linked using a suitable chemical or a disulphide bond. Examples of non-covalent bonds include hydrogen bonds, ionic bonds, Van der Waals forces, and hydrophobic interactions.
(37) The term polypeptide or polypeptide chain will be understood from the foregoing paragraph to mean a series of contiguous amino acids linked by peptide bonds.
(38) As used herein, the term antigen binding site is used interchangeably with antigen binding domain and shall be taken to mean a region of an antibody that is capable of specifically binding to an antigen, i.e., a VH or a VL or an Fv comprising both a VH and a VL. The antigen binding domain need not be in the context of an entire antibody, e.g., it can be in isolation (e.g., a domain antibody) or in another form, e.g., as described herein, such as a scFv.
(39) For the purposes for the present disclosure, the term antibody includes a protein capable of specifically binding to one or a few closely related antigens (e.g., those present in HIV-1) by virtue of an antigen binding domain contained within a Fv. This term includes four chain antibodies (e.g., two light chains and two heavy chains), recombinant or modified antibodies (e.g., chimeric antibodies, humanized antibodies, human antibodies, CDR-grafted antibodies, primatized antibodies, de-immunized antibodies, synhumanized antibodies, half-antibodies, bispecific antibodies). An antibody generally comprises constant domains, which can be arranged into a constant region or constant fragment or fragment crystallizable (Fc). Exemplary forms of antibodies comprise a four-chain structure as their basic unit. Full-length antibodies comprise two heavy chains (50 to 70 kD) covalently linked and two light chains (23 kDa each). A light chain generally comprises a variable region (if present) and a constant domain and in mammals is either a light chain or a light chain. A heavy chain generally comprises a variable region and one or two constant domain(s) linked by a hinge region to additional constant domain(s).
(40) Heavy chains of mammals are of one of the following types , , , , or . Each light chain is also covalently linked to one of the heavy chains. For example, the two heavy chains and the heavy and light chains are held together by inter-chain disulfide bonds and by non-covalent interactions. The number of inter-chain disulfide bonds can vary among different types of antibodies. Each chain has an N-terminal variable region (VH or VL wherein each are 110 amino acids in length) and one or more constant domains at the C-terminus. The constant domain of the light chain (CL which is 110 amino acids in length) is aligned with and disulfide bonded to the first constant domain of the heavy chain (CH1 which is 330 to 440 amino acids in length). The light chain variable region is aligned with the variable region of the heavy chain. The antibody heavy chain can comprise 2 or more additional CH domains (such as, CH2, CH3 and the like) and can comprise a hinge region between the CH1 and CH2 constant domains. Antibodies can be of any type (e.g., IgG, IgE, IgM, IgD, IgA, and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass. In one example, the antibody is a murine (mouse or rat) antibody or a primate (such as, human) antibody. In one example, the antibody is humanized, synhumanized, chimeric, CDR-grafted or deimmunized.
(41) The terms full-length antibody, intact antibody or whole antibody are used interchangeably to refer to an antibody in its substantially intact form, as opposed to an antigen binding fragment of an antibody. Specifically, whole antibodies include those with heavy and light chains including an Fc region. The constant domains may be wild-type sequence constant domains (e.g., human wild-type sequence constant domains) or amino acid sequence variants thereof.
(42) As used herein, variable region refers to the portions of the light and/or heavy chains of an antibody as defined herein that is capable of specifically binding to an antigen and, includes amino acid sequences of complementarity determining regions (CDRs); i.e., CDR1, CDR2, and CDR3, and framework regions (FRs). For example, the variable region comprises three or four FRs (e.g., FR1, FR2, FR3 and optionally FR4) together with three CDRs. VH refers to the variable region of the heavy chain. VL refers to the variable region of the light chain.
(43) As used herein, the term complementarity determining regions (syn. CDRs; i.e., CDR1, CDR2, and CDR3) refers to the amino acid residues of an antibody variable region the presence of which are major contributors to specific antigen binding. Each variable region domain (VH or VL) typically has three CDRs identified as CDR1, CDR2 and CDR3. The CDRs of VH are also referred to herein as CDR H1, CDR H2 and CDR H3, respectively, wherein CDR H1 corresponds to CDR 1 of VH, CDR H2 corresponds to CDR 2 of VH and CDR H3 corresponds to CDR 3 of VH. Likewise, the CDRs of VL are referred to herein as CDR L1, CDR L2 and CDR L3, respectively, wherein CDR L1 corresponds to CDR 1 of VL, CDR L2 corresponds to CDR 2 of VL and CDR L3 corresponds to CDR 3 of VL.
(44) Framework regions (FRs) are those variable region residues other than the CDR residues. The FRs of VH are also referred to herein as FR H1, FR H2, FR H3 and FR H4, respectively, wherein FR H1 corresponds to FR1 of VH, FR H2 corresponds to FR2 of VH, FR H3 corresponds to FR3 of VH and FR H4 corresponds to FR4 of VH. Likewise, the FRs of VL are referred to herein as FR L1, FR L2, FR L3 and FR L4, respectively, wherein FR L1 corresponds to FR1 of VL, FR L2 corresponds to FR2 of VL, FR L3 corresponds to FR3 of VL and FR L4 corresponds to FR4 of VL.
(45) As used herein, the term Fv shall be taken to mean any protein, whether comprised of multiple polypeptides or a single polypeptide, in which a VL and a VH associate and form a complex having an antigen binding domain, i.e., capable of specifically binding to an antigen. The VH and the VL which form the antigen binding domain can be in a single polypeptide chain or in different polypeptide chains. Furthermore, an Fv of the invention (as well as any protein of the invention) may have multiple antigen binding domains which may or may not bind the same antigen. This term shall be understood to encompass fragments directly derived from an antibody as well as proteins corresponding to such a fragment produced using recombinant means. In some examples, the VH is not linked to a heavy chain constant domain (CH) 1 and/or the VL is not linked to a light chain constant domain (CL).
(46) Exemplary Fv containing polypeptides or proteins include a Fab fragment, a Fab fragment, a F(ab) fragment, a scFv, a diabody, a triabody, a tetrabody or higher order complex, or any of the foregoing linked to a constant region or domain thereof, e.g., CH2 or CH3 domain, e.g., a minibody. A Fab fragment consists of a monovalent antigen-binding fragment of an immunoglobulin, and can be produced by digestion of a whole antibody with the enzyme papain, to yield a fragment consisting of an intact light chain and a portion of a heavy chain or can be produced using recombinant means. A Fab fragment of an antibody can be obtained by treating a whole antibody with pepsin, followed by reduction, to yield a molecule consisting of an intact light chain and a portion of a heavy chain comprising a VH and a single constant domain. Two Fab fragments are obtained per antibody treated in this manner. A Fab fragment can also be produced by recombinant means.
(47) A F(ab)2 fragment of an antibody consists of a dimer of two Fab fragments held together by two disulfide bonds, and is obtained by treating a whole antibody molecule with the enzyme pepsin, without subsequent reduction. A Fab2 fragment is a recombinant fragment comprising two Fab fragments linked using, for example a leucine zipper or a CH3 domain. A single chain Fv or scFv is a recombinant molecule containing the variable region fragment (Fv) of an antibody in which the variable region of the light chain and the variable region of the heavy chain are covalently linked by a suitable, flexible polypeptide linker. The linker may be a one or more amino acids or a disulphide bond.
(48) As used herein, the term binds in reference to the interaction of an antigen binding site or an antigen binding domain thereof with an antigen means that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the antigen. For example, an antibody recognizes and binds to a specific protein structure rather than to proteins generally. If an antibody binds to epitope A, the presence of a molecule containing epitope A (or free, unlabelled A), in a reaction containing labelled A and the protein, will reduce the amount of labelled A bound to the antibody.
(49) As used herein, the term specifically binds or binds specifically shall be taken to mean that an antigen binding site of the invention reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular antigen or cell expressing same than it does with alternative antigens or cells. For example, an antigen binding site binds to the Env protein of HIV-1 with materially greater affinity (e.g., 1.5 fold or 2 fold or 5 fold or 10 fold or 20 fold or 40 fold or 60 fold or 80 fold to 100 fold or 150 fold or 200 fold) than other known antigen binding sites. In an example of the present invention, an antigen binding site that specifically binds to HIV-1 with an affinity at least 1.5 fold or 2 fold or greater (e.g., 5 fold or 10 fold or 20 fold r 50 fold or 100 fold or 200 fold) than it does to another type of HIV, such as HIV-2. Generally, but not necessarily, reference to binding means specific binding, and each term shall be understood to provide explicit support for the other term.
(50) As used herein, the term does not detectably bind shall be understood to mean that an antigen binding site, e.g., an antibody, binds to a candidate antigen at a level less than 10%, or 8% or 6% or 5% above background. The background can be the level of binding signal detected in the absence of the protein and/or in the presence of a negative control protein (e.g., an isotype control antibody) and/or the level of binding detected in the presence of a negative control antigen. The level of binding is detected using biosensor analysis (e.g. Biacore) in which the antigen binding site is immobilized and contacted with an antigen.
(51) As used herein, the term epitope (syn. antigenic determinant) shall be understood to mean a region of HIV-1 (eg the HIV-1 Env protein) to which an antigen binding site comprising an antigen binding domain of an antibody binds. Unless otherwise defined, this term is not necessarily limited to the specific residues or structure to which the antigen binding site makes contact. For example, this term includes the region spanning amino acids contacted by the antigen binding site and 5-10 (or more) or 2-5 or 1-3 amino acids outside of this region. In some examples, the epitope comprises a series of discontinuous amino acids that are positioned close to one another when antigen binding site is folded, i.e., a conformational epitope. The skilled artisan will also be aware that the term epitope is not limited to peptides or polypeptides. For example, the term epitope includes chemically active surface groupings of molecules such as sugar side chains, phosphoryl side chains, or sulfonyl side chains, and, in certain examples, may have specific three dimensional structural characteristics, and/or specific charge characteristics.
(52) The term monoclonal antibody as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations that include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies. The modifier monoclonal is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies useful in the present invention may be prepared according to the methods described herein or by methods known in the art including by the hybridoma methodology described by Kohler et al., Nature, 256:495 (1975). Alternatively, they may be made using recombinant DNA methods in bacterial, eukaryotic animal or plant cells (see, e.g., U.S. Pat. No. 4,816,567). The monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature, 352:624-628 (1991) and Marks et al., J. Mol. Biol., 222:581-597 (1991), for example.
(53) The monoclonal antibodies herein include chimeric antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)).
(54) The present invention provides variable region antigen-binding sequences derived from bovine antibodies. Accordingly, chimeric antibodies of primary interest herein include antibodies having one or more bovine antigen binding sequences (e.g., CDRs) and containing one or more sequences derived from a human antibody, e.g., an FR or C region sequence. In addition, chimeric antibodies of primary interest herein include those comprising a bovine variable region antigen binding sequence of one antibody class or subclass and another sequence, e.g., FR or C region sequence, derived from another antibody class or subclass, preferably human.
(55) A humanized antibody is generally considered to be a human antibody that has one or more amino acid residues introduced into it from a source that is non-human. These nonhuman amino acid residues are often referred to as import residues, which are typically taken from an import variable region. Humanization is traditionally performed following the method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Reichmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting import hypervariable region sequences for the corresponding sequences of a human antibody.
(56) Accordingly, such humanized antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567) wherein substantially less than an intact human variable region has been substituted by the corresponding sequence from a non-human species.
(57) An antibody fragment comprises a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab, F(ab)2, and Fv fragments; diabodies; linear antibodies (see U.S. Pat. No. 5,641,870; Zapata et al., Protein Eng. 8(10): 1057-1062 [1995]); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
(58) The phrase functional fragment or analog of an antibody is a fragment or analog that retains binding ability when compared with the full-length antibody.
(59) A neutralizing antibody as described herein is one that can neutralize the ability of the HIV-1 virus to initiate and/or perpetuate an infection in a host (ie a human) and/or in target cells in vitro. It will be understood that the antigen binding sites described herein can neutralize viral infectivity in a number of ways. They may interfere with virion binding to receptors, block virus uptake into cells, prevent uncoating of the viral genomes in endosomes, or cause aggregation of virus particles.
(60) It will be understood that the term broadly neutralizing antibodies (BrNAbs) refers to neutralizing antibodies that neutralize more than one HIV-1 virus species (from diverse clades and different strains within a clade), which may be demonstrated in any neutralization assay known in the art or described herein. It is generally understood that BrNAbs are unique in that they target conserved epitopes of the virus, and whilst the virus may mutate, the targeted epitopes will still exist. A broadly neutralizing antibody may neutralize at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more different strains of HIV-1, the strains belonging to the same or different clades. A broad neutralizing antibody may neutralize multiple HIV-1 species belonging to at least 2, 3, 4, 5, or 6 different clades including clades A, B, C, AC, G, CRF07_BC and CRF01_AE.
(61) As used herein, the terms preventing, prevent or prevention include administering an antigen binding site of the invention to thereby stop or hinder the development of at least one symptom of HIV-1. This term also encompasses treatment of a subject in remission to prevent or hinder relapse.
(62) As used herein, the terms treating, treat or treatment include administering an antigen binding site described herein to thereby reduce or eliminate at least one symptom of HIV-1.
(63) As used herein, the term subject shall be taken to mean any animal, preferably humans.
(64) BG505.SOSIP is a structural and antigenic mimic of the closed state of mature prefusion Env, It is a soluble gp140 molecule that is a derivative of the clade A HIV-1 strain BG505, with a number of stabilizing mutations that allow for proper structural and antigenic mimicry of the closed state of mature prefusion Env. Specifically, BG505.SOSIP is truncated at residue 664 in gp41 and includes the trimer-stabilizing gp120-gp41 disulfide bridge between residues 501 and 605 (termed SOS) and an Ile-to-Pro mutation at gp41 residue 559 (termed IP), as well as a Thr-to-Asn mutation at residue 332 to introduce a glycosylation site and a modification of the native .sub.508REKR.sub.511 furin cleavage site to six Arg residues for improved cleavage.
(65) The AD8.SOSIP.6R.644 protein incorporates a similar set of mutations utilized in BG505.SOSIP. AD8.SOSIP.6R.644 was derived from the Env sequence of NL(AD8) (Freed E O, et al (1995). J Virol 69:3949-54) and a soluble gp140 protein was generated by truncating the MPER, TM and CT from residue 664 (HXB-2 numbering used here and subsequently). Introduction of A501C, I559P, and T605C substitutions were used to stabilize the gp140 in the closed state, and the wild-type cleavage site (R508EKR) was replaced with six arginine residues to facilitate more efficient cleavage. A C-terminal linker and 6His tag (ASGSGHHHHHH) were introduced to facilitate purification of the protein.
(66) Antibodies
(67) In one example, an antigen binding site as described herein according to any example is an antibody.
(68) Methods for generating antibodies are known in the art and/or described in Harlow and Lane (editors) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, (1988). Generally, in such methods HIV-1 or a region thereof (e.g., an extracellular region) or immunogenic fragment or epitope thereof or a cell expressing and displaying same (i.e., an immunogen), optionally formulated with any suitable or desired carrier, adjuvant, or pharmaceutically acceptable excipient, is administered to a non-human animal, preferably a cow. The immunogen may be administered intranasally, intramuscularly, subcutaneously, intravenously, intradermally, intraperitoneally, or by other known route.
(69) The production of polyclonal antibodies may be monitored by sampling blood of the immunized animal at various points following immunization. One or more further immunizations may be given, if required to achieve a desired antibody titer. The process of boosting and titering is repeated until a suitable titer is achieved. When a desired level of immunogenicity is obtained, the immunized animal is bled and the serum isolated and stored, and/or the animal is used to generate monoclonal antibodies (mAbs).
(70) Monoclonal antibodies are one exemplary form of antibody contemplated by the present invention. The term monoclonal antibody or mAb refers to a homogeneous antibody population capable of binding to the same antigen(s), for example, to the same epitope within the antigen. This term is not intended to be limited with regard to the source of the antibody or the manner in which it is made.
(71) For the production of mAbs any one of a number of known techniques may be used, such as, for example, the procedure exemplified in U.S. Pat. No. 4,196,265 or Harlow and Lane (1988), supra.
(72) In one example, mAbs may be generated as described previously in Haydarchi et al (2016) mAbs, 9:3, pp Pages 550-566 or Tiller et al (2008) J Immunol Methods, January 1; 329(1-2): 112-124 whereby single HIV-specific B cells were sorted, followed by single cell RT-PCR and cloning.
(73) In another example, a suitable animal such as a cow is immunized with an immunogen under conditions sufficient to stimulate antibody producing cells. Following immunization, somatic cells with the potential for producing antibodies, specifically B lymphocytes (B cells), are selected for use in the mAb generating protocol. These cells may be obtained from biopsies of spleens, tonsils or lymph nodes, or from a peripheral blood sample.
(74) Hybrids are amplified by culture in a selective medium comprising an agent that blocks the de novo synthesis of nucleotides in the tissue culture media. Exemplary agents are aminopterin, methotrexate and azaserine.
(75) The amplified hybridomas are subjected to a functional selection for antibody specificity and/or titer, such as, for example, by flow cytometry and/or immunohistochemistry and/or immunoassay (e.g. radioimmunoassay, enzyme immunoassay, cytotoxicity assay, plaque assay, dot immunoassay, and the like).
(76) Alternatively, ABL-MYC technology (NeoClone, Madison WI 53713, USA) is used to produce cell lines secreting MAbs (e.g., as described in Largaespada et al, J. Immunol. Methods. 197: 85-95, 1996). Antibodies can also be produced or isolated by screening a display library, e.g., a phage display library, e.g., as described in U.S. Pat. No. 6,300,064 and/or U.S. Pat. No. 5,885,793.
(77) The antibody of the present invention may be a synthetic antibody. For example, the antibody is a chimeric antibody, a humanized antibody, a human antibody synhumanized antibody, primatized antibody or a de-immunized antibody.
(78) Antibody Binding Domain Containing Proteins
(79) Single-Domain Antibodies
(80) In some examples, a protein of the invention is or comprises a single-domain antibody (which is used interchangeably with the term domain antibody or dAb). A single-domain antibody is a single polypeptide chain comprising all or a portion of the heavy chain variable region of an antibody. In certain examples, a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, MA; see, e.g., U.S. Pat. No. 6,248,516).
(81) Diabodies, Triabodies, Tetrabodies
(82) In some examples, a protein of the invention is or comprises a diabody, triabody, tetrabody or higher order protein complex such as those described in WO98/044001 and/or WO94/007921.
(83) For example, a diabody is a protein comprising two associated polypeptide chains, each polypeptide chain comprising the structure V.sub.L-X-V.sub.H or V.sub.H-X-V.sub.L, wherein V.sub.L is an antibody light chain variable region, V.sub.H is an antibody heavy chain variable region, X is a linker comprising insufficient residues to permit the V.sub.H and V.sub.L in a single polypeptide chain to associate (or form an Fv) or is absent, and wherein the V.sub.H of one polypeptide chain binds to a V.sub.L of the other polypeptide chain to form an antigen binding domain, i.e., to form a Fv molecule capable of specifically binding to one or more antigens. The V.sub.L and V.sub.H can be the same in each polypeptide chain or the V.sub.L and V.sub.H can be different in each polypeptide chain so as to form a bispecific diabody (i.e., comprising two Fvs having different specificity).
(84) Single Chain Fv (scFv)
(85) A skilled person will be aware that scFvs comprise V.sub.H and V.sub.L regions in a single polypeptide chain and a polypeptide linker between the V.sub.H and V.sub.L which enables the scFv to form the desired structure for antigen binding (i.e., for the V.sub.H and V.sub.L of the single polypeptide chain to associate with one another to form a Fv). For example, the linker comprises in excess of 12 amino acid residues with (Gly.sub.4Ser).sub.3 being one of the more favored linkers for a scFv.
(86) The present invention also contemplates a disulfide stabilized Fv (or diFv or dsFv), in which a single cysteine residue is introduced into a FR of V.sub.H and a FR of V.sub.L and the cysteine residues linked by a disulfide bond to yield a stable Fv.
(87) Alternatively, or in addition, the present invention encompasses a dimeric scFv, i.e., a protein comprising two scFv molecules linked by a non-covalent or covalent linkage, e.g., by a leucine zipper domain (e.g., derived from Fos or Jun). Alternatively, two scFvs are linked by a peptide linker of sufficient length to permit both scFvs to form and to bind to an antigen, e.g., as described in US20060263367.
(88) Heavy Chain Antibodies
(89) Heavy chain antibodies differ structurally from many other forms of antibodies, in so far as they comprise a heavy chain, but do not comprise a light chain. Accordingly, these antibodies are also referred to as heavy chain only antibodies. Heavy chain antibodies are found in, for example, camelids and cartilaginous fish (also called IgNAR).
(90) Other Antibodies and Proteins Comprising Antigen Binding Domains Thereof
(91) The present invention also contemplates other antibodies and proteins comprising antigen-binding domains thereof, such as: (i) key and hole bispecific proteins as described in U.S. Pat. No. 5,731,168; (ii) heteroconjugate proteins, e.g., as described in U.S. Pat. No. 4,676,980; (iii) heteroconjugate proteins produced using a chemical cross-linker, e.g., as described in U.S. Pat. No. 4,676,980; and (iv) Fab.sub.3 (e.g., as described in EP19930302894).
Light Chains
(92) It will be understood that the antigen binding sites or antibodies described herein may utilise any light chain including, but not limited to, those exemplified herein in the examples.
(93) The heavy chain CDRs (CDRH1-CDRH3) of the antigen binding sites or antibodies described herein have been tested with a number of different light chain variable regions including those defined by SEQ ID NOs:63 and 73 which contain different complementarity determining regions. The data herein, including
(94) A skilled person will understand the minimal features required in a suitable light chain for use in accordance with the invention. For instance, ultra-long CDR3s are shown to have restricted light chain pairings (Saini et al., 2003) that may specifically provide a structural framework for supporting ultra-long CDRH3 (Wang et al., Cell 153, 1379-1393 (2013). There appears to be a selective pressure for the use of three V1 genes (V1x and two new V1d and V1e genes) in IgM with unusually long CDR3H (Saini et al., Int. Immunol., 15 (2003), pp. 845-853).
(95) Mutations to Proteins
(96) The present invention also provides an antigen binding site or a nucleic acid encoding same having at least 80% identity to a sequence disclosed herein. In one example, an antigen binding site or nucleic acid of the invention comprises sequence at least about 85% or 90% or 95% or 97% or 98% or 99% identical to a sequence disclosed herein.
(97) Alternatively, or additionally, the antigen binding site comprises a CDR (e.g., three CDRs) at least about 80% or 85% or 90% or 95% or 97% or 98% or 99% identical to CDR(s) of a V.sub.H or V.sub.L as described herein according to any example.
(98) In another example, a nucleic acid of the invention comprises a sequence at least about 80% or 85% or 90% or 95% or 97% or 98% or 99% identical to a sequence encoding an antigen binding site having a function as described herein according to any example. The present invention also encompasses nucleic acids encoding an antigen binding site of the invention, which differs from a sequence exemplified herein as a result of degeneracy of the genetic code.
(99) The percentage of identity of a nucleic acid or polypeptide is determined by GAP (Needleman and Wunsch. Mol. Biol. 48, 443-453, 1970) analysis (GCG program) with a gap creation penalty=5, and a gap extension penalty=0.3. The query sequence is at least 50 residues in length, and the GAP analysis aligns the two sequences over a region of at least 50 residues. For example, the query sequence is at least 100 residues in length and the GAP analysis aligns the two sequences over a region of at least 100 residues. For example, the two sequences are aligned over their entire length.
(100) The present invention also contemplates a nucleic acid that hybridizes under stringent hybridization conditions to a nucleic acid encoding an antigen binding site described herein. A moderate stringency is defined herein as being a hybridization and/or washing carried out in 2SSC buffer, 0.1% (w/v) SDS at a temperature in the range 45 C. to 65 C., or equivalent conditions. A high stringency is defined herein as being a hybridization and/or wash carried out in 0.1SSC buffer, 0.1% (w/v) SDS, or lower salt concentration, and at a temperature of at least 65 C., or equivalent conditions. Reference herein to a particular level of stringency encompasses equivalent conditions using wash/hybridization solutions other than SSC known to those skilled in the art. For example, methods for calculating the temperature at which the strands of a double stranded nucleic acid will dissociate (also known as melting temperature, or Tm) are known in the art. A temperature that is similar to (e.g., within 5 C. or within 10 C.) or equal to the Tm of a nucleic acid is considered to be high stringency. Medium stringency is to be considered to be within 10 C. to 20 C. or 10 C. to 15 C. of the calculated Tm of the nucleic acid.
(101) The present invention also contemplates mutant forms of an antigen binding site of the invention comprising one or more conservative amino acid substitutions compared to a sequence set forth herein. In some examples, the antigen binding site comprises 10 or fewer, e.g., 9 or 8 or 7 or 6 or 5 or 4 or 3 or 2 or 1 conservative amino acid substitutions. A conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain and/or hydropathicity and/or hydrophilicity.
(102) Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), -branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Hydropathic indices are described, for example in Kyte and Doolittle J. Mol. Biol., 157:105-132, 1982 and hydrophylic indices are described in, e.g., U.S. Pat. No. 4,554,101.
(103) The present invention also contemplates non-conservative amino acid changes. For example, of particular interest are substitutions of charged amino acids with another charged amino acid and with neutral or positively charged amino acids. In some examples, the antigen binding site comprises 10 or fewer, e.g., 9 or 8 or 7 or 6 or 5 or 4 or 3 or 2 or 1 non-conservative amino acid substitutions.
(104) In one example, the mutation(s) occur within a FR of an antigen binding domain of an antigen binding site of the invention. In another example, the mutation(s) occur within a CDR of an antigen binding site of the invention.
(105) Exemplary methods for producing mutant forms of an antigen binding site include: mutagenesis of DNA (Thie et al., Methods Mol. Biol. 525: 309-322, 2009) or RNA (Kopsidas et al., Immunol. Lett. 107:163-168, 2006; Kopsidas et al. BMC Biotechnology, 7:1 8, 2007; and WO1999/058661); introducing a nucleic acid encoding the polypeptide into a mutator cell, e.g., XL-1Red, XL-mutS and XL-mutS-Kanr bacterial cells (Stratagene); DNA shuffling, e.g., as disclosed in Stemmer, Nature 370: 389-91, 1994; and site directed mutagenesis, e.g., as described in Dieffenbach (ed) and Dveksler (ed) (In: PCR Primer: A Laboratory Manual, Cold Spring Harbor Laboratories, NY, 1995).
(106) Exemplary methods for determining biological activity of the mutant antigen binding sites of the invention will be apparent to the skilled artisan and/or described herein, e.g., antigen binding. For example, methods for determining antigen binding, competitive inhibition of binding, affinity, association, dissociation and therapeutic efficacy are described herein.
(107) Constant Regions
(108) The present invention encompasses antigen binding sites and/or antibodies described herein comprising a constant region of an antibody. This includes antigen binding fragments of an antibody fused to an Fc.
(109) Sequences of constant regions useful for producing the proteins of the present invention may be obtained from a number of different sources. In some examples, the constant region or portion thereof of the protein is derived from a human antibody. The constant region or portion thereof may be derived from any antibody class, including IgM, IgG, IgD, IgA and IgE, and any antibody isotype, including IgG1, IgG2, IgG3 and IgG4. In one example, the constant region is human isotype IgG4 or a stabilized IgG4 constant region.
(110) In one example, the Fc region of the constant region has a reduced ability to induce effector function, e.g., compared to a native or wild-type human IgG1 or IgG3 Fc region. In one example, the effector function is antibody-dependent cell-mediated cytotoxicity (ADCC) and/or antibody-dependent cell-mediated phagocytosis (ADCP) and/or complement-dependent cytotoxicity (CDC). Methods for assessing the level of effector function of an Fc region containing protein are known in the art and/or described herein.
(111) In one example, the Fc region is an IgG4 Fc region (i.e., from an IgG4 constant region), e.g., a human IgG4 Fc region. Sequences of suitable IgG4 Fc regions will be apparent to the skilled person and/or available in publically available databases (e.g., available from National Center for Biotechnology Information).
(112) In one example, the constant region is a stabilized IgG4 constant region. The term stabilized IgG4 constant region will be understood to mean an IgG4 constant region that has been modified to reduce Fab arm exchange or the propensity to undergo Fab arm exchange or formation of a half-antibody or a propensity to form a half antibody. Fab arm exchange refers to a type of protein modification for human IgG4, in which an IgG4 heavy chain and attached light chain (half-molecule) is swapped for a heavy-light chain pair from another IgG4 molecule. Thus, IgG4 molecules may acquire two distinct Fab arms recognizing two distinct antigens (resulting in bispecific molecules). Fab arm exchange occurs naturally in vivo and can be induced in vitro by purified blood cells or reducing agents such as reduced glutathione. A half antibody forms when an IgG4 antibody dissociates to form two molecules each containing a single heavy chain and a single light chain.
(113) In one example, a stabilized IgG4 constant region comprises a proline at position 241 of the hinge region according to the system of Kabat (Kabat et al., Sequences of Proteins of Immunological Interest Washington DC United States Department of Health and Human Services, 1987 and/or 1991). This position corresponds to position 228 of the hinge region according to the EU numbering system (Kabat et al., Sequences of Proteins of Immunological Interest Washington DC United States Department of Health and Human Services, 2001 and Edelman et al., Proc. Natl. Acad. USA, 63, 78-85, 1969). In human IgG4, this residue is generally a serine. Following substitution of the serine for proline, the IgG4 hinge region comprises a sequence CPPC. In this regard, the skilled person will be aware that the hinge region is a proline-rich portion of an antibody heavy chain constant region that links the Fc and Fab regions that confers mobility on the two Fab arms of an antibody. The hinge region includes cysteine residues which are involved in inter-heavy chain disulfide bonds. It is generally defined as stretching from Glu226 to Pro243 of human IgG1 according to the numbering system of Kabat. Hinge regions of other IgG isotypes may be aligned with the IgG1 sequence by placing the first and last cysteine residues forming inter-heavy chain disulphide (SS) bonds in the same positions (see for example WO2010/080538).
(114) Additional examples of stabilized IgG4 antibodies are antibodies in which arginine at position 409 in a heavy chain constant region of human IgG4 (according to the EU numbering system) is substituted with lysine, threonine, methionine, or leucine (e.g., as described in WO2006/033386). The Fc region of the constant region may additionally or alternatively comprise a residue selected from the group consisting of: alanine, valine, glycine, isoleucine and leucine at the position corresponding to 405 (according to the EU numbering system). Optionally, the hinge region comprises a proline at position 241 (i.e., a CPPC sequence) (as described above).
(115) In another example, the Fc region is a region modified to have reduced effector function, i.e., a non-immunostimulatory Fc region. For example, the Fc region is an IgG1 Fc region comprising a substitution at one or more positions selected from the group consisting of 268, 309, 330 and 331. In another example, the Fc region is an IgG1 Fc region comprising one or more of the following changes E233P, L234V, L235A and deletion of G236 and/or one or more of the following changes A327G, A330S and P331S (Armour et al., Eur J Immunol. 29:2613-2624, 1999; Shields et al., J Biol Chem. 276(9):6591-604, 2001). Additional examples of non-immunostimulatory Fc regions are described, for example, in Dall'Acqua et al., J Immunol. 177: 1129-1138 2006; and/or Hezareh J Virol; 75: 12161-12168, 2001).
(116) In another example, the Fc region is a chimeric Fc region, e.g., comprising at least one C.sub.H2 domain from an IgG4 antibody and at least one C.sub.H3 domain from an IgG1 antibody, wherein the Fc region comprises a substitution at one or more amino acid positions selected from the group consisting of 240, 262, 264, 266, 297, 299, 307, 309, 323, 399, 409 and 427 (EU numbering) (e.g., as described in WO2010/085682). Exemplary substitutions include 240F, 262L, 264T, 266F, 297Q, 299A, 299K, 307P, 309K, 309M, 309P, 323F, 399S, and 427F.
(117) Additional Modifications
(118) The present invention also contemplates additional modifications to an antibody or antigen binding site comprising an Fc region or constant region.
(119) For example, the antibody comprises one or more amino acid substitutions that increase the half-life of the protein. For example, the antibody comprises a Fc region comprising one or more amino acid substitutions that increase the affinity of the Fc region for the neonatal Fc region (FcRn). For example, the Fc region has increased affinity for FcRn at lower pH, e.g., about pH 6.0, to facilitate Fc/FcRn binding in an endosome. In one example, the Fc region has increased affinity for FcRn at about pH 6 compared to its affinity at about pH 7.4, which facilitates the re-release of Fc into blood following cellular recycling. These amino acid substitutions are useful for extending the half-life of a protein, by reducing clearance from the blood.
(120) Exemplary amino acid substitutions include T250Q and/or M428L or T252A, T254S and T266F or M252Y, S254T and T256E or H433K and N434F according to the EU numbering system. Additional or alternative amino acid substitutions are described, for example, in US20070135620 or U.S. Pat. No. 7,083,784.
(121) Protein Production
(122) In one example, an antigen binding site described herein according to any example is produced by culturing a hybridoma under conditions sufficient to produce the protein, e.g., as described herein and/or as is known in the art.
(123) Recombinant Expression
(124) In another example, an antigen binding site described herein according to any example is recombinant.
(125) In the case of a recombinant protein, nucleic acid encoding same can be cloned into expression constructs or vectors, which are then transfected into host cells, such as E. coli cells, yeast cells, insect cells, or mammalian cells, such as simian COS cells, Chinese Hamster Ovary (CHO) cells, human embryonic kidney (HEK) cells, or myeloma cells that do not otherwise produce the protein. Exemplary cells used for expressing a protein are CHO cells, myeloma cells or HEK cells. Molecular cloning techniques to achieve these ends are known in the art and described, for example in Ausubel et al., (editors), Current Protocols in Molecular Biology, Greene Pub. Associates and Wiley-Interscience (1988, including all updates until present) or Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press (1989). A wide variety of cloning and in vitro amplification methods are suitable for the construction of recombinant nucleic acids. Methods of producing recombinant antibodies are also known in the art, see, e.g., U.S. Pat. No. 4,816,567 or 5,530,101.
(126) Following isolation, the nucleic acid is inserted operably linked to a promoter in an expression construct or expression vector for further cloning (amplification of the DNA) or for expression in a cell-free system or in cells.
(127) As used herein, the term promoter is to be taken in its broadest context and includes the transcriptional regulatory sequences of a genomic gene, including the TATA box or initiator element, which is required for accurate transcription initiation, with or without additional regulatory elements (e.g., upstream activating sequences, transcription factor binding sites, enhancers and silencers) that alter expression of a nucleic acid, e.g., in response to a developmental and/or external stimulus, or in a tissue specific manner. In the present context, the term promoter is also used to describe a recombinant, synthetic or fusion nucleic acid, or derivative which confers, activates or enhances the expression of a nucleic acid to which it is operably linked. Exemplary promoters can contain additional copies of one or more specific regulatory elements to further enhance expression and/or alter the spatial expression and/or temporal expression of said nucleic acid.
(128) As used herein, the term operably linked to means positioning a promoter relative to a nucleic acid such that expression of the nucleic acid is controlled by the promoter.
(129) Many vectors for expression in cells are available. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, a sequence encoding a protein (e.g., derived from the information provided herein), an enhancer element, a promoter, and a transcription termination sequence. The skilled artisan will be aware of suitable sequences for expression of a protein. Exemplary signal sequences include prokaryotic secretion signals (e.g., pelB, alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II), yeast secretion signals (e.g., invertase leader, factor leader, or acid phosphatase leader) or mammalian secretion signals (e.g., herpes simplex gD signal).
(130) Exemplary promoters active in mammalian cells include cytomegalovirus immediate early promoter (CMV-IE), human elongation factor 1- promoter (EF1), small nuclear RNA promoters (U1a and U1b), -myosin heavy chain promoter, Simian virus 40 promoter (SV40), Rous sarcoma virus promoter (RSV), Adenovirus major late promoter, -actin promoter; hybrid regulatory element comprising a CMV enhancer/-actin promoter or an immunoglobulin promoter or active fragment thereof. Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture; baby hamster kidney cells (BHK, ATCC CCL 10); or Chinese hamster ovary cells (CHO).
(131) Typical promoters suitable for expression in yeast cells such as for example a yeast cell selected from the group comprising Pichia pastoris, Saccharomyces cerevisiae and S. pombe, include, but are not limited to, the ADH1 promoter, the GAL1 promoter, the GAL4 promoter, the CUP1 promoter, the PHO5 promoter, the nmt promoter, the RPR1 promoter, or the TEF1 promoter.
(132) Means for introducing the isolated nucleic acid or expression construct comprising same into a cell for expression are known to those skilled in the art. The technique used for a given cell depends on the known successful techniques. Means for introducing recombinant DNA into cells include microinjection, transfection mediated by DEAE-dextran, transfection mediated by liposomes such as by using lipofectamine (Gibco, MD, USA) and/or cellfectin (Gibco, MD, USA), PEG-mediated DNA uptake, electroporation and microparticle bombardment such as by using DNA-coated tungsten or gold particles (Agracetus Inc., WI, USA) amongst others.
(133) The host cells used to produce the protein may be cultured in a variety of media, depending on the cell type used. Commercially available media such as Ham's FI0 (Sigma), Minimal Essential Medium ((MEM), (Sigma), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing mammalian cells. Media for culturing other cell types discussed herein are known in the art.
(134) Isolation of Proteins
(135) Methods for isolating a protein are known in the art and/or described herein.
(136) Where an antigen binding site is secreted into culture medium, supernatants from such expression systems can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants. Alternatively, or additionally, supernatants can be filtered and/or separated from cells expressing the protein, e.g., using continuous centrifugation.
(137) The antigen binding site prepared from the cells can be purified using, for example, ion exchange, hydroxyapatite chromatography, hydrophobic interaction chromatography, gel electrophoresis, dialysis, affinity chromatography (e.g., protein A affinity chromatography or protein G chromatography), or any combination of the foregoing. These methods are known in the art and described, for example in WO99/57134 or Ed Harlow and David Lane (editors) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, (1988).
(138) The skilled artisan will also be aware that a protein can be modified to include a tag to facilitate purification or detection, e.g., a poly-histidine tag, e.g., a hexa-histidine tag, or a influenza virus hemagglutinin (HA) tag, or a Simian Virus 5 (V5) tag, or a FLAG tag, or a glutathione S-transferase (GST) tag. The resulting protein is then purified using methods known in the art, such as, affinity purification. For example, a protein comprising a hexa-his tag is purified by contacting a sample comprising the protein with nickel-nitrilotriacetic acid (Ni-NTA) that specifically binds a hexa-his tag immobilized on a solid or semi-solid support, washing the sample to remove unbound protein, and subsequently eluting the bound protein. Alternatively, or in addition a ligand or antibody that binds to a tag is used in an affinity purification method.
(139) Assaying Activity of an Antigen Binding Site
(140) Binding to HIV-1 Env and Mutants Thereof
(141) It will be apparent to the skilled artisan from the disclosure herein that antigen binding sites of the present invention bind to a HIV-1 Env antigen. Methods for assessing binding to a protein are known in the art, e.g., as described in Scopes (In: Protein purification: principles and practice, Third Edition, Springer Verlag, 1994). Such a method generally involves immobilizing the antigen, binding site and contacting it with labelled antigen (HIV-1 Env). Following washing to remove non-specific bound protein, the amount of label and, as a consequence, bound antigen is detected. Of course, the antigen binding site can be labelled and the antigen immobilized. Panning-type assays can also be used. Alternatively, or additionally, surface plasmon resonance assays can be used.
(142) Optionally, the dissociation constant (Kd), association constant (Ka) and/or affinity constant (K.sub.D) of an immobilized antigen binding site for HIV-1 Env or an epitope thereof is determined. The Kd or Ka or K.sub.D for HIV-1 Env is in one example measured by a radiolabelled or fluorescently-labelled HIV-1 Env ligand binding assay. In the case of a Kd, this assay equilibrates the antigen binding site with a minimal concentration of labelled HIV-1 Env or epitope thereof in the presence of a titration series of unlabelled HIV-1 Env. Following washing to remove unbound HIV-1 Env or epitope thereof, the amount of label is determined, which is indicative of the Kd of the protein.
(143) According to another example the Kd, Ka or K.sub.D is measured by using surface plasmon resonance assays, e.g., using BIAcore surface plasmon resonance (BIAcore, Inc., Piscataway, NJ) with immobilized HIV-1 Env or an antigen thereof or immobilized antigen binding site.
(144) Human Immunodeficiency Virus Type 1 (HIV-1)
(145) The antigen binding sites or antibodies described herein are useful for treating, attenuating or preventing HIV-1 in a subject in need thereof. In particular, the antigen binding sites or antibodies described herein are particularly useful for targeting the HIV-1 Env protein. The HIV-1 Env protein, which forms the viral envelope, is one of the only proteins that is accessible to antibody-directed immunity. The env gene encodes the glycosylated Env polypeptide of about 160 kDa (gp160) that is subsequently cleaved by a host cell protease to generate the viral envelope proteins gp120 and gp41. These two chains associate non-covalently in trimers to form the viral envelope spikes extending from the virion envelope.
(146) There are many different types of strains or species of HIV-1 that belong to particular clades including A, B, C, AC, G, CRF07_BC or CFR01_AE. HIV-1 species belonging to clade B include MN, 6535, HXB-2, QH0692, pREJO4541, pRHPA4259, AD8, JRCSF, YU-2, ZM53M.PB12, X2278 and TRO11. HIV-1 species belonging to clade A include BG505 and 398F1. HIV-1 species belonging to clade C include Du156, ZM135M.PL10a, CAP210.200.E8, CAP45.2.00.G3, 25710, CE1176 and CEO217, preferably 25710, CE1176 and CEO217. HIV-1 species belonging to clade G include X1632. HIV-1 species belonging to clade CRF01_AE include CNE8 and CNE55, preferably CNE55.
(147) The extensive variation among different strains of HIV-1, especially in gp120, and the ability of the virus to evolve during the course of a single infection and to adapt to drugs and immunologic attack rapidly present problems in therapy and vaccine development. Most of the variability among strains of HIV occurs in the envelope sequence in five variable domains of gp120, designated V1 through V5 (comprising amino acids 128 to 152, 182 to 195, 300 to 330, 395 to 415, and 460 to 467, respectively). The third variable region, called the V3 loop (formed by joining two cysteine residues), is a dominant antibody-neutralizing domain of gp120 and plays an important role in determining viral tropism. Four regions that are relatively invariant have been designated C1 through C4 (amino acids 33 to 60, 87 to 126, 231 to 276, and 460 to 467). These regions presumably maintain essential viral structures. The viral envelope ultimately must be understood as a fusion machine that allows viral entry into target cells. Fusion depends on sequential binding of gp120 to CD4 and the chemokine receptors, but the fusogenic domain is located in gp41. The fusion peptide that is inserted into the target cell membrane is formed at the new amino terminus created by proteolytic cleavage of the gp160 precursor protein.
(148) The antigen binding sites or antibodies described herein are capable of targeting multiple forms of the HIV-1 Env protein including gp120, uncleaved gp140 and SOSIP gp140. As used herein, unless the context specifies or requires otherwise, reference to an antigen binding site of the invention binding to or specifically binding to HIV-1 also is a reference to that antigen binding site of the invention binding to or specifically binding to gp120 or any variant thereof including those described herein, gp140 or any variant thereof including those described herein, gp160 or any variant thereof including those described herein, or any other env gene product or variant thereof.
(149) A subject that has been infected with HIV-1 may be asymptomatic or symptomatic. In the first few months of infection, a subject may demonstrate flu like symptoms including headache, fever, tiredness, swollen lymph nodes, sore throat, thrush, rash, muscle and joint pain, ulcers in mouth or on genitals, night sweats and/or diarrhoea. Clinically, this will typically correlate with detectable HIV-1 viral load in blood, sputum and/or urine as well as detectable antibodies produced by the subject in response to HIV-1 infection. Symptoms in the later phases of HIV-1 infection include high fevers, chills and night sweats, rashes, breathing difficulty and persistent coughing, severe weight loss, nausea, white spots in the mouth, genital sores, fatigue, pneumonia and cognitive decline.
(150) Thus, it is envisaged that the antigen binding sites and antibodies described herein are capable of treating one or more of the above-described symptoms associated with HIV-1 infection.
(151) The existence of, improvement in, or treatment of HIV-1 infection may be determined by any clinically or biochemically relevant method as described herein or known in the art, including assessment of blood, sputum and/or urine for HIV-1 viral load and HIV-1 antibodies. A positive response to treatment with any antigen binding site or antibody may be determined by any method known in the art and may include a: reduced viral load; reduced HIV-1 antibody titre; reduced headache, fever, tiredness; reduced swollen lymph nodes; reduced sore throat; reduced thrush, rash, muscle and/or joint pain; reduced ulcers in mouth or on genitals; reduced night sweats, chills and/or diarrhoea; reduced high fevers; reduced breathing difficulty and/or persistent coughing; reduced severe weight loss, nausea and/or white spots in the mouth; reduced genital sores; reduced fatigue; recovery from pneumonia; and/or improved cognitive capacity.
(152) The determination of any of the above may be considered to be a positive response (i.e. treatment) to the antigen binding sites, antibodies and/or compositions described herein. Alternatively, a reduction in the requirement for standard HIV-1 medication that offers symptomatic relief may be considered to be a positive response to the compounds and/or compositions described herein.
(153) Similarly, it is envisaged that antigen binding sites and antibodies described herein are capable of preventing HIV-1 infection is a subject, including those at high risk, by preventing increases to one or more of the above described clinical correlates or symptoms.
(154) In an aspect of the invention, the subject, having received a treatment for a given HIV-1 infection, as described above, may have a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in the measurable parameters of any of those symptoms described above, as may be determined upon physical examination or by any of the clinical tests described above. Alternatively, where the infection is eradicated, there may be a complete, lasting disappearance of all detectable manifestations of the HIV-1 infection, such that the subject does not have any detectable signs of infection according to those parameters described above or others known in the art. The subject may have substantially undetectable signs of HIV-1 infection. A HIV-1 infection that is substantially undetectable generally refers to a circumstance where therapy has depleted the extent, severity or other physical measure of an HIV-1 infection so that through using relevant standard assessment techniques known in the art to determine the presence of one or more symptoms described above, as a consequence of the treatment, is not clearly detectable.
(155) In one embodiment, the method is particularly useful for extending survival of the subject, including overall survival as well as progression free survival. It will be understood that overall survival is the length of time from either the date of diagnosis or the start of treatment of a HIV-1 infection, that patients diagnosed with the HIV-1 are still alive. It will be understood that progression free survival is the length of time during and after the treatment of HIV-1 infection that a patient lives with the HIV-1 infection but it does not get worse.
(156) Survival analysis can be performed using well-known techniques in the art including the Kaplan-Meier method. The Kaplan-Meier method estimates the survival function from life-time data. In medical research, it can be used to measure the fraction of patients living for a certain amount of time after treatment. A plot of the Kaplan-Meier method of the survival function is a series of horizontal steps of declining magnitude which, when a large enough sample is taken, approaches the true survival function for that population. The value of the survival function between successive distinct sampled observations (clicks) is assumed to be constant.
(157) An important advantage of the Kaplan-Meier curve is that the method can take into account censored data-losses from the sample before the final outcome is observed (for instance, if a patient withdraws from a study). On the plot, small vertical tick-marks indicate losses, where patient data has been censored. When no truncation or censoring occurs, the Kaplan-Meier curve is equivalent to the empirical distribution.
(158) Diagnosis
(159) In an aspect of the invention, HIV-1 expressing cells or virus may be used to screen a biological sample obtained from a patient infected with HIV-1 for the presence of antibodies that preferentially bind to the cell expressing HIV-1 polypeptides using standard biological techniques. For example, in certain embodiments, the antibodies may be labelled, and the presence of label associated with the cell detected, e.g., using FMAT or FACs analysis. In particular embodiments, the biological sample is blood, serum, plasma, bronchial lavage, or saliva. Methods of the present invention may be practiced using high throughput techniques.
(160) Compositions
(161) In some examples, an antigen binding site or antibody described herein can be administered orally, parenterally, by inhalation spray, adsorption, absorption, topically, rectally, nasally, bucally, vaginally, intraventricularly, via an implanted reservoir in dosage formulations containing conventional non-toxic pharmaceutically-acceptable carriers, or by any other convenient dosage form. The term parenteral as used herein includes subcutaneous, intravenous, intramuscular, intraperitoneal, intrathecal, intraventricular, intrasternal, and intracranial injection or infusion techniques.
(162) Methods for preparing an antigen binding site into a suitable form for administration to a subject (e.g. a pharmaceutical composition) are known in the art and include, for example, methods as described in Remington's Pharmaceutical Sciences (18th ed., Mack Publishing Co., Easton, Pa., 1990) and U.S. Pharmacopeia: National Formulary (Mack Publishing Company, Easton, Pa., 1984).
(163) The pharmaceutical compositions of this invention are particularly useful for parenteral administration, such as intravenous administration or administration into a body cavity or lumen of an organ or joint. The compositions for administration will commonly comprise a solution of an antigen binding site dissolved in a pharmaceutically acceptable carrier, for example an aqueous carrier. A variety of aqueous carriers can be used, e.g., buffered saline and the like. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like. The concentration of an antigen binding site of the present invention in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the patient's needs. Exemplary carriers include water, saline, Ringer's solution, dextrose solution, and 5% human serum albumin. Nonaqueous vehicles such as mixed oils and ethyl oleate may also be used. Liposomes may also be used as carriers. The vehicles may contain minor amounts of additives that enhance isotonicity and chemical stability, e.g., buffers and preservatives.
(164) Upon formulation, an antigen binding site of the present invention will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically/prophylactically effective. Formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above, but other pharmaceutically acceptable forms are also contemplated, e.g., tablets, pills, capsules or other solids for oral administration, suppositories, pessaries, nasal solutions or sprays, aerosols, inhalants, liposomal forms and the like. Pharmaceutical slow release capsules or compositions may also be used. Slow release formulations are generally designed to give a constant drug level over an extended period and may be used to deliver an antigen binding site of the present invention.
(165) WO2002/080967 describes compositions and methods for administering aerosolized compositions comprising antibodies for the treatment of, e.g., asthma, which are also suitable for administration of an antigen binding site of the present invention.
(166) Dosages and Administration
(167) Suitable dosages of an antigen binding site of the present invention will vary depending on the specific an antigen binding site and/or the subject being treated. It is within the ability of a skilled physician to determine a suitable dosage, e.g., by commencing with a sub-optimal dosage and incrementally modifying the dosage to determine an optimal or useful dosage. Alternatively, to determine an appropriate dosage for treatment/prophylaxis, data from the cell culture assays or animal studies are used, wherein a suitable dose is within a range of circulating concentrations that include the ED.sub.50 of the active compound with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. A therapeutically/prophylactically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC.sub.50 (i.e., the concentration or amount of the compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma maybe measured, for example, by high performance liquid chromatography.
(168) In some examples, a method of the present invention comprises administering a prophylactically or therapeutically effective amount of a protein described herein.
(169) The term therapeutically effective amount is the quantity which, when administered to a subject in need of treatment, improves the prognosis and/or state of the subject and/or that reduces or inhibits one or more symptoms of a clinical condition described herein to a level that is below that observed and accepted as clinically diagnostic or clinically characteristic of that condition. The amount to be administered to a subject will depend on the particular characteristics of the condition to be treated, the type and stage of condition being treated, the mode of administration, and the characteristics of the subject, such as general health, other diseases, age, sex, genotype, and body weight. A person skilled in the art will be able to determine appropriate dosages depending on these and other factors. Accordingly, this term is not to be construed to limit the present invention to a specific quantity, e.g., weight or amount of protein(s), rather the present invention encompasses any amount of the antigen binding site(s) sufficient to achieve the stated result in a subject.
(170) As used herein, the term prophylactically effective amount shall be taken to mean a sufficient quantity of a protein to prevent or inhibit or delay the onset of one or more detectable symptoms of a clinical condition. The skilled artisan will be aware that such an amount will vary depending on, for example, the specific antigen binding site(s) administered and/or the particular subject and/or the type or severity or level of condition and/or predisposition (genetic or otherwise) to the condition. Accordingly, this term is not to be construed to limit the present invention to a specific quantity, e.g., weight or amount of antigen binding site(s), rather the present invention encompasses any amount of the antigen binding site(s) sufficient to achieve the stated result in a subject.
(171) Kits
(172) The present invention additionally comprises a kit comprising one or more of the following: (i) an antigen binding site of the invention or expression construct(s) encoding same; (ii) a cell of the invention; (iii) a complex of the invention; or (iii) a pharmaceutical composition of the invention.
(173) In the case of a kit for detecting HIV-1 Env, the kit can additionally comprise a detection means, e.g., linked to an antigen binding site of the invention.
(174) In the case of a kit for therapeutic/prophylactic use, the kit can additionally comprise a pharmaceutically acceptable carrier.
(175) Optionally a kit of the invention is packaged with instructions for use in a method described herein according to any example.
(176) TABLE-US-00001 TABLE1 Summaryofaminoacidandnucleotidesequences Antibodyor Region SEQ proteinID IDNO: Aminoacidornucleotidesequence H1842 CDRH1(protein) 1 DKAVG CDRH2(protein) 2 SIDTGGNADYNPGLKS CDRH3(protein) 3 VHQKTLRSCPSDYPYICDCEDTGSHCCRATNCP YYCNHGRDRMCTGRTYTYEWHVEA CDRH1(DNA) 4 GACAAGGCTGTAGGC CDRH2(DNA) 5 AGTATAGACACTGGCGGAAACGCAGATTATAA CCCAGGCCTGAAATCC CDRH3(DNA) 6 GTGCACCAGAAGACACTCCGTAGTTGTCCTTC TGATTATCCTTATATTTGTGATTGTGAAGATACT GGTAGTCATTGCTGTCGGGCTACTAATTGTCC TTATTACTGCAATCATGGCCGTGATCGTATGTG TACCGGTCGTACTTACACGTACGAGTGGCACG TCGAAGCC FRH1(protein) 7 KVQLQESGPSLVKPSQTLSLTCTASGFSLS FRH2(protein) 8 WVRQAPGQALEWLG FRH3(protein) 9 RLSITKDNAKSQVSLSVSSVTTEGSATYYCST FRH4(protein) 10 WGQGLLVTVSS FRH1(DNA) 11 AAGGTGCAGCTGCAGGAGTCGGGCCCCAGCC TGGTGAAGCCGTCACAGACCCTCTCGCTCACC TGCACGGCCTCTGGATTCTCATTGAGC FRH2(DNA) 12 TGGGTCCGCCAGGCTCCAGGGCAGGCGCTGG AGTGGCTCGGT FRH3(DNA) 13 CGGCTCAGCATCACCAAGGATAACGCCAAGAG CCAAGTCTCTCTGTCAGTAAGCAGCGTGACAA CTGAGGGCTCGGCCACGTATTACTGTTCTACT FRH4(DNA) 14 TGGGGCCAGGGACTCCTGGTCACCGTCTCCT CA VH(protein) 15 KVQLQESGPSLVKPSQTLSLTCTASGFSLSDKAV GWVRQAPGQALEWLGSIDTGGNADYNPGLKSR LSITKDNAKSQVSLSVSSVTTEGSATYYCSTVHQ KTLRSCPSDYPYICDCEDTGSHCCRATNCPYYC NHGRDRMCTGRTYTYEWHVEAWGQGLLVTVSS VH(DNA) 16 AAGGTGCAGCTGCAGGAGTCGGGCCCCAGCC TGGTGAAGCCGTCACAGACCCTCTCGCTCACC TGCACGGCCTCTGGATTCTCATTGAGCGACAA GGCTGTAGGCTGGGTCCGCCAGGCTCCAGGG CAGGCGCTGGAGTGGCTCGGTAGTATAGACA CTGGCGGAAACGCAGATTATAACCCAGGCCTG AAATCCCGGCTCAGCATCACCAAGGATAACGC CAAGAGCCAAGTCTCTCTGTCAGTAAGCAGCG TGACAACTGAGGGCTCGGCCACGTATTACTGT TCTACTGTGCACCAGAAGACACTCCGTAGTTG TCCTTCTGATTATCCTTATATTTGTGATTGTGAA GATACTGGTAGTCATTGCTGTCGGGCTACTAA TTGTCCTTATTACTGCAATCATGGCCGTGATCG TATGTGTACCGGTCGTACTTACACGTACGAGT GGCACGTCGAAGCCTGGGGCCAGGGACTCCT GGTCACCGTCTCCTCA H1872 CDRH1(protein) 17 DKAVG CDRH2(protein) 18 TIDTTGNAVYNPGLKS CDRH3(protein) 19 VHQKTRRSCPSDYSFICDCEGTGSHCCRASNCP YYCNYGRDRMCTGRSNIHEWHVDA CDRH1(DNA) 20 GACAAGGCTGTAGGC CDRH2(DNA) 21 ACTATAGACACTACTGGAAACGCAGTCTATAAC CCAGGCCTGAAATCC CDRH3(DNA) 22 GTGCACCAGAAGACACGTCGCAGTTGTCCTTC TGATTATAGTTTCATTTGTGATTGTGAAGGTAC TGGCAGTCATTGCTGTCGGGCTTCTAATTGTC CTTATTACTGCAATTACGGCCGTGATCGTATGT GTACGGGCAGGAGTAACATTCACGAATGGCAC GTCGATGCC FRH1(protein) 23 KVQLRESGPSLVKPSQTLSLTCTASGFSLS FRH2(protein) 24 WVRQAPGQPLEWLG FRH3(protein) 25 RLSITKDNSKSQVSLSLSSVTTEDSATYHCST FRH4(protein) 26 WGQGLLVTVSS FRH1(DNA) 27 AAGGTGCAGCTGCGGGAGTCGGGCCCCAGCC TGGTGAAGCCGTCACAGACCCTCTCGCTCACC TGCACAGCCTCTGGATTCTCATTGAGC FRH2(DNA) 28 TGGGTTCGCCAGGCTCCAGGGCAGCCGCTGG AGTGGCTCGGT FRH3(DNA) 29 CGGCTCAGCATCACCAAGGATAACTCCAAGAG CCAGGTCTCTCTGTCACTAAGCAGCGTGACAA CTGAGGACTCGGCCACATATCACTGTTCTACT FRH4(DNA) 30 TGGGGCCAAGGTCTCCTGGTCACCGTCTCCTCA VH(protein) 31 KVQLRESGPSLVKPSQTLSLTCTASGFSLSDKAV GWVRQAPGQPLEWLGTIDTTGNAVYNPGLKSRL SITKDNSKSQVSLSLSSVTTEDSATYHCSTVHQK TRRSCPSDYSFICDCEGTGSHCCRASNCPYYCN YGRDRMCTGRSNIHEWHVDAWGQGLLVTVSS VH(DNA) 32 AAGGTGCAGCTGCGGGAGTCGGGCCCCAGCC TGGTGAAGCCGTCACAGACCCTCTCGCTCACC TGCACAGCCTCTGGATTCTCATTGAGCGACAA GGCTGTAGGCTGGGTTCGCCAGGCTCCAGGG CAGCCGCTGGAGTGGCTCGGTACTATAGACAC TACTGGAAACGCAGTCTATAACCCAGGCCTGA AATCCCGGCTCAGCATCACCAAGGATAACTCC AAGAGCCAGGTCTCTCTGTCACTAAGCAGCGT GACAACTGAGGACTCGGCCACATATCACTGTT CTACTGTGCACCAGAAGACACGTCGCAGTTGT CCTTCTGATTATAGTTTCATTTGTGATTGTGAA GGTACTGGCAGTCATTGCTGTCGGGCTTCTAA TTGTCCTTATTACTGCAATTACGGCCGTGATCG TATGTGTACGGGCAGGAGTAACATTCACGAAT GGCACGTCGATGCCTGGGGCCAAGGTCTCCT GGTCACCGTCTCCTCA 2129 CDRH1(protein) 33 DKAVG CDRH2(protein) 34 SIDTGGNAGYNPGLKS CDRH3(protein) 35 VHQKTRRSCPVDYYYSCDCEGSGSHCCSASNC PYYCKYGRDRVCTDKHTYSYEWYVDA CDRH1(DNA) 36 GACAAGGCTGTAGGC CDRH2(DNA) 37 AGTATAGACACTGGTGGAAACGCAGGCTATAA CCCAGGCCTGAAATCC CDRH3(DNA) 38 GTGCACCAGAAGACACGACGTAGTTGTCCTGT TGATTATTATTATAGTTGCGACTGTGAAGGTAG TGGTAGTCATTGTTGCTCGGCTTCTAATTGTCC TTATTACTGCAAGTATGGCCGTGATAGAGTTTG TACTGACAAACATACTTACAGTTACGAATGGTA CGTCGATGCC CDRL1(protein) 39 SGSSSNVGNGYVS CDRL2(protein) 40 GDTSRAS CDRL3(protein) 41 ASAEDGSSNAV CDRL1(DNA) 42 TCTGGAAGCAGCAGCAATGTTGGAAATGGATA TGTGAGC CDRL2(DNA) 43 GGTGACACCAGTCGAGCCTCG CDRL3(DNA) 44 GCATCTGCTGAGGATGGTAGCAGTAATGCTGTT FRH1(protein) 45 KVQLRESGPSLVKPSQTLSLTCTASGFSLS FRH2(protein) 46 WVRQAPGKALEWLG FRH3(protein) 47 RLSITKGNSKSQVSLSVSSVTTEDSATYYCST FRH4(protein) 48 WGQGLLVTVSS FRH1(DNA) 49 AAGGTGCAGCTGCGGGAGTCGGGCCCCAGCC TGGTGAAGCCGTCACAGACCCTCTCGCTCACC TGCACGGCCTCTGGATTCTCATTAAGC FRH2(DNA) 50 TGGGTCCGCCAGGCTCCAGGGAAGGCGCTGG AGTGGCTCGGT FRH3(DNA) 51 CGGCTCAGCATCACCAAGGGTAACTCCAAGAG CCAAGTCTCTCTGTCAGTGAGTAGCGTGACGA CTGAGGACTCGGCCACATATTACTGTTCTACT FRH4(DNA) 52 TGGGGCCAGGGACTCCTGGTCACCGTCTCCTCA FRL1(protein) 53 QAVLTQPSSVSGSLGQRVSTTC FRL2(protein) 54 WYQLIPGSAPRTLIY FRL3(protein) 55 GVPDRFSGSRSGNTVTLTISSLQAEDEADYFC FRL4(protein) 56 FGRGTTLTVV FRL1(DNA) 57 CAGGCTGTGCTGACTCAGCCATCATCCGTGTC CGGGTCCCTGGGCCAGAGGGTCTCCACCACC TGC FRL2(DNA) 58 TGGTACCAACTGATTCCAGGATCGGCCCCCAG AACCCTCATCTAT FRL3(DNA) 59 GGGGTCCCCGACCGATTCTCCGGCTCCAGGT CTGGGAACACAGTCACCCTGACCATCAGCTCG CTCCAGGCTGAGGACGAGGCAGATTATTTCTGC FRL4(DNA) 60 TTCGGCAGAGGGACCACACTGACAGTCGTC VH(protein) 61 KVQLRESGPSLVKPSQTLSLTCTASGFSLSDKAV GWVRQAPGKALEWLGSIDTGGNAGYNPGLKSR LSITKGNSKSQVSLSVSSVTTEDSATYYCSTVHQ KTRRSCPVDYYYSCDCEGSGSHCCSASNCPYY CKYGRDRVCTDKHTYSYEWYVDAWGQGLLVTVSS VH(DNA) 62 AAGGTGCAGCTGCGGGAGTCGGGCCCCAGCC TGGTGAAGCCGTCACAGACCCTCTCGCTCACC TGCACGGCCTCTGGATTCTCATTAAGCGACAA GGCTGTAGGCTGGGTCCGCCAGGCTCCAGGG AAGGCGCTGGAGTGGCTCGGTAGTATAGACAC TGGTGGAAACGCAGGCTATAACCCAGGCCTGA AATCCCGGCTCAGCATCACCAAGGGTAACTCC AAGAGCCAAGTCTCTCTGTCAGTGAGTAGCGT GACGACTGAGGACTCGGCCACATATTACTGTT CTACTGTGCACCAGAAGACACGACGTAGTTGT CCTGTTGATTATTATTATAGTTGCGACTGTGAA GGTAGTGGTAGTCATTGTTGCTCGGCTTCTAAT TGTCCTTATTACTGCAAGTATGGCCGTGATAGA GTTTGTACTGACAAACATACTTACAGTTACGAA TGGTACGTCGATGCCTGGGGCCAGGGACTCC TGGTCACCGTCTCCTCA VL(protein) 63 QAVLTQPSSVSGSLGQRVSTTCSGSSSNVGNG YVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGS RSGNTVTLTISSLQAEDEADYFCASAEDGSSNAV FGRGTTLTV VL(DNA) 64 AATTCGCAGGCTGTGCTGACTCAGCCATCATC CGTGTCCGGGTCCCTGGGCCAGAGGGTCTCC ACCACCTGCTCTGGAAGCAGCAGCAATGTTGG AAATGGATATGTGAGCTGGTACCAACTGATTC CAGGATCGGCCCCCAGAACCCTCATCTATGGT GACACCAGTCGAGCCTCGGGGGTCCCCGACC GATTCTCCGGCTCCAGGTCTGGGAACACAGTC ACCCTGACCATCAGCTCGCTCCAGGCTGAGGA CGAGGCAGATTATTTCTGCGCATCTGCTGAGG ATGGTAGCAGTAATGCTGTTTTCGGCAGAGGG ACCACACTGACAGTC Gp120 65 MRVKEKYQHLWRWGWKWGTMLLGILMICSATE (protein) KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEV HNVWATHACVPTDPNPQEVVLENVTENFNMWK NNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNC TDLRNVTNINNSSEGMRGEIKNCSFNITTSIRDKV KKDYALFYRLDVVPIDNDNTSYRLINCNTSTITQA CPKVSFEPIPIHYCTPAGFAILKCKDKKFNGTGPC KNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIR SSNFTDNAKNIIVQLKESVEINCTRPNNNTRKSIHI GPGRAFYTTGDIIGDIRQAHCNISRTKWNNTLNQI ATKLKEQFGNNKTIVFNQSSGGDPEIVMHSFNC GGEFFYCNSTQLFNSTWNFNGTWNLTQSNGTE GNDTITLPCRIKQIINMWQEVGKAMYAPPIRGQIR CSSNITGLILTRDGGNNHNNDTETFRPGGGDMR DNWRSELYKYKVVKIEPLGVAPTKAKRRVVQRET Gp140 66 MRVKEKYQHLWRWGWKWGTMLLGILMICSATE (protein) KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEV HNVWATHACVPTDPNPQEVVLENVTENFNMWK NNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNC TDLRNVTNINNSSEGMRGEIKNCSFNITTSIRDKV KKDYALFYRLDVVPIDNDNTSYRLINCNTSTITQA CPKVSFEPIPIHYCTPAGFAILKCKDKKFNGTGPC KNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIR SSNFTDNAKNIIVQLKESVEINCTRPNNNTRKSIHI GPGRAFYTTGDIIGDIRQAHCNISRTKWNNTLNQI ATKLKEQFGNNKTIVFNQSSGGDPEIVMHSFNC GGEFFYCNSTQLFNSTWNFNGTWNLTQSNGTE GNDTITLPCRIKQIINMWQEVGKAMYAPPIRGQIR CSSNITGLILTRDGGNNHNNDTETFRPGGGDMR DNWRSELYKYKVVKIEPLGVAPTKAKRRVVQRE TGAVGTIGAMFLGFLGAAGSTMGAASITLTVQAR LLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQL QARVLAVERYLRDQQLLGIWGCSGKLICTTAVP WNASWSNKSLEQIWNNMTWMEWDREINNYTSL IHSLIEESQNQQEKNEQELLELDKWASLWNWFNI TNWLWYIK Gp160 67 MKVKGIRKNYQHLWKWGIMLLGMLMICSAVENL (protein) WVTVYYGVPVWKEATTTLFCASDAKAYDTEVHN VWATHACVPTDPNPQEVVLENVTENFNMWKNN MVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTD LRNVTNINNSSEGMRGEIKNCSFNITTSIRDKVKK DYALFYRLDVVPIDNDNTSYRLINCNTSTITQACP KVSFEPIPIHYCTPAGFAILKCKDKKFNGTGPCKN VSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSS NFTDNAKNIIVQLKESVEINCTRPNNNTRKSIHIGP GRAFYTTGDIIGDIRQAHCNISRTKWNNTLNQIAT KLKEQFGNNKTIVFNQSSGGDPEIVMHSFNCGG EFFYCNSTQLFNSTWNFNGTWNLTQSNGTEGN DTITLPCRIKQIINMWQEVGKAMYAPPIRGQIRCS SNITGLILTRDGGNNHNNDTETFRPGGGDMRDN WRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR AVGTIGAMFLGFLGAAGSTMGAASITLTVQARLL LSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQA RVLAVERYLRDQQLLGIWGCSGKLICTTAVPWN ASWSNKTLDMIWNNMTWMEWEREIDNYTGLIYT LIEESQNQQEKNEQELLELDKWASLWNWFDITN WLWYIKIFIMIVGGLIGLRIVFTVLSIVNRVRQGYS PSLFQTHLPAPRGPDRPEGIEEEGGDRDRDRSV RLVDGFLALFWDDLRSLCLFSYHRLRDLLLIVARI VELLGRRGWEALKYWWNLLQYWSQELRNSAVS LLNATAIAVAEGTDRVIEIVQRIYRAILHIPTRIRQG LERLLL SOSIP 68 MRVKEKYQHLWRWGWKWGTMLLGILMICSATE gp140 KLWVTVYYGVPVWKEATTTLFCASDAKAYDTKV (protein) HNVWATHACVPTDPNPQEVVLENVTENFNMWK NNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNC TDLRNVTNINNSSEGMRGEIKNCSFNITTSIRDKV KKDYALFYRLDVVPIDNDNTSYRLINCNTSTITQA CPKVSFEPIPIHYCTPAGFAILKCKDKKFNGTGPC KNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIR SSNFTDNAKNIIVQLKESVEINCTRPNNNTRKSIHI GPGRWFYTTGDIIGDIRQAHCNISRTKWNNTLNQ IATKLKEQFGNNKTIVFNQSSGGDPEIVMHSFNC GGEFFYCNSTQLFNSTWNFNGTWNLTQSNGTE GNDTITLPCRIKQIINMWQEVGKAMYAPPIRGQIR CSSNITGLILTRDGGNNHNNDTETFRPGGGDMR DNWRSELYKYKVVKIEPLGVAPTKCKRRVVQRE KRAVGTIGAMFLGFLGAAGSTMGAASMTLTVQA RNLLSGIVQQQNNLLRAPEAQQHLLQLTVWGIKQ LQARVLAVERYLRDQQLLGIWGCSGKLICCTAVP WNASWSNKSLEQIWNNMTWMEWDREINNYTSL IHSLIEESQNQQEKNEQELLELASGLNDIFEAQKI EWHE Trimer 69 MRVMGIQRNCQHLWRWGILIFGMLMICSAAENL gp140 WVTVYYGVPVWKEANTTLFCASDAKAYDTEVHN (ConMSOSIP) VWATHACVPTDPNPQEIVLENVTENFNMWKNN (protein) MVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTD VNATNNSTNMGEIKNCSFNITTEIRDKKQKVYALF YRLDVVPINDNSYRLINCNTSAITQACPKVSFEPI PIHYCAPAGFAILKCNDKKFNGTGPCKNVSTVQC THGIKPVVSTQLLLNGSLAEEEIIIRSENITDNAKTII VQLNESVEINCTRPNNNTRKSIRIGPGQAFYATG DIIGDIRQAHCNISGAEWNKTLQQVAAKLREHFN NKTIIFKPSSGGDLEITTHSFNCGGEFFYCNTSGL FNSTWNGTNETITLPCRIKQIVNMWQRVGQAMY APPIAGNITCKSNITGLLLTRDGGTNNTETFRPGG GDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRV VEREKRAVGIGAVFLGFLGAAGSTMGAASITLTV QARQLLSGIVQQQSNLLRAIEAQQHLLQLTVWGI KQLQARVLAVERYLKDQQLLGIWGCSGKLICTTN VPWNSSWSNKSQDEIWDNMTWMQWEREISNY TDIIYSLIEESQNQQEKNEQDLLALDKWASLWNW FDITNWLWYIKIFIMIVGGLIGLRIVFAVLSIVNRVR QGYSPLSFQTLIPNPRGPDRPGGIEEEGGEQDR DRSIRLVSGFLALAWDDLRSLCLFSYHRLRDFILI AARTVELLGRRGWEALKYLWNLLQYWGQELKN SAISLLDTTAIAVAEGTDRVIEVVQRACRAILHIPR RIRQGFERALL VRCO1VH 70 QVQLVQSGGQMKKPGESMRISCRASGYEFIDCT (protein) LNWIRLAPGKRPEWMGWLKPRGGAVNYARPLQ GRVTMTRDVYSDTAFLELRSLTVDDTAVYFCTR GKNCDYNWDFEHWGRGTPVIVSS VRCO1VL 71 EIVLTQSPGTLSLSPGETAIISCRTSQYGSLAWYQ (protein) QRPGQAPRLVIYSGSTRAAGIPDRFSGSRWGPD YNLTISNLESGDFGVYYCQQYEFFGQGTKVQVDIK NC-COW1 72 QVQLRESGPSLMKPSQTLSLTCTVSGSSLNDKS VH(protein) VGWVRQAPGKALQWLGSVDTSGNTDYNPGLKS RLSITKDNSKSRISLTVTGMTTEDSATYYCITAHQ KTNKKECPEDYTYNPRCPQQYGWSDCDCMGD RFGGYCRQDGCSNYIHRSTYEWYVSAWGQGLL VTVSS NC-COW1 73 HSYELTQPSSVSGSLGQRVSVTCSGSSSNVGN VL(protein) GYVSWYQLIPGSAPRTIIYGDTSRASGVPERFSG SRSGNTATLTISSLQAEDEADFFCASPDDSSSNA VFGSGTTLTVL NC-COW1 74 SGSSSNVGNGYVS CDRL1 (protein) NC-COW1 75 GDTSRAS CDRL2 (protein) NC-COW1 76 ASPDDSSSNAV CDRL3 (protein) NC-COW1 77 SYELTQPSSVSGSLGQRVSVTC FRL1 (protein) NC-COW1 78 WYQLIPGSAPRTIIY FRL2 (protein) NC-COW1 79 GVPERFSGSRSGNTATLTISSLQAEDEADFFC FRL3 (protein) NC-COW1 80 FGSGTTLTVL FRL4 (protein) CDRH2 81 X.sub.1IDTX.sub.2GNAX.sub.3YNPGLKS (protein) WhereinX1=SorT;X2=GorT;X3=G,DorV CDRH3 82 VHQKTX.sub.1RSCPX.sub.2DYX.sub.3X.sub.4X.sub.5CDCEX.sub.6X.sub.7GSHCCX.sub.8 (protein AX.sub.9NCPYYCX.sub.10X.sub.11GRDRX.sub.12CTX.sub.13X.sub.14XX.sub.15X.sub.16X.sub.17X.sub.18 X.sub.19EWX.sub.20VX.sub.21A whereinX1=RorL;X2=SorV;X3=P,SorY; X4=YorF;X5=IorS;X6=GorD;X7=TorS; X8=RorS;X9=SorT;X10=NorK; X11=YorH;X12=MorV;X13=GorD;X14=R orK;X15=Hornoaminoacidatthisposition; X16=TorS;X17=YorN;X18=T,IorS; X19=YorH;X20=HorY;X21=DorE. CDRL1 83 SGSSSNVGNGYVS (protein) CDRL2 84 GDTSRAS (protein) CDRL3 85 ASX.sub.1X.sub.2DX.sub.3SSNAV (protein) whereinX1=AorP;X2=EorD;X3=GorS. KNH664 86 TVYYGVPVWKDAETTLFCASDAKAYETEKHNVW (protein) ATHACVPTDPNPQEIPLENVTEEFNMWKNKMVE QMHTDIISLWDQSLQPCVKLTPLCVTLNCTDATN GTIGNITDEMKGEIKNCSFNITTEIRDKKQKVYSLF YRLDVVPIEPDSSNSSRNSSEYRLINCNTSAITQA CPKVSFEPIPIHYCAPAGFAILKCRDKEFNGTGKC KNVSTVQCTHGIKPVVSTQLLLNGSLAEGEVRIR SENITNNAKTIIVQLVEPVRINCTRPNNNTRESVRI GPGQAFFATGDIIGDIRQAHCNVSRSQWNKTLQ QVAAQLGEHFKNKAITFNSSSGGDLEITTHSFNC GGEFFYCNTSGLFNSTWKANNGTWKANISESNN TEITLQCRIKQIINMWQRTGQAIYAPPIQGVIRCES NITGLLLTRDGGEGNNESEIFRPGGGDMRDNWR SELYKYKVVKIEPLGVAPTRARRRVVGREKRAVG IGAVFLGFLGAAGSTMGAASITLTVQARQLLSGIV QQQSNLLRAIEAQQHMLKLTVWGIKQLQARVLA VERYLRDQQLLGIWGCSGKLICTTNVPWNSSWS NKSHDEIWNNMTWLQWDKEISNYTNLIYSLIEES QNQQEKNEQDLLALGSGSGSGSGHHHHHH 1842(IMGT) CDRH1(protein) 87 GFSLSDKA CDRH2(protein) 88 IDTGGNA CDRH3(protein) 89 STVHQKTLRSCPSDYPYICDCEDTGSHCCRATN CPYYCNHGRDRMCTGRTYTYEWHVEA CDRH1(DNA) 90 GGATTCTCATTGAGCGACAAGGCT CDRH2(DNA) 91 ATAGACACTGGCGGAAACGCA CDRH3(DNA) 92 TCTACTGTGCACCAGAAGACACTCCGTAGTTG TCCTTCTGATTATCCTTATATTTGTGATTGTGAA GATACTGGTAGTCATTGCTGTCGGGCTACTAA TTGTCCTTATTACTGCAATCATGGCCGTGATCG TATGTGTACCGGTCGTACTTACACGTACGAGT GGCACGTCGAAGCC FRH1(protein) 93 KVQLQESGPSLVKPSQTLSLTCTAS FRH2(protein) 94 VGWVRQAPGQALEWLGS FRH3(protein) 95 DYNPGLKSRLSITKDNAKSQVSLSVSSVTTEGSATYYC FRH4(protein) 96 WGQGLLVTVSS FRH1(DNA) 97 AAGGTGCAGCTGCAGGAGTCGGGCCCCAGCC TGGTGAAGCCGTCACAGACCCTCTCGCTCACC TGCACGGCCTCT FRH2(DNA) 98 GTAGGCTGGGTCCGCCAGGCTCCAGGGCAGG CGCTGGAGTGGCTCGGTAGT FRH3(DNA) 99 GATTATAACCCAGGCCTGAAATCCCGGCTCAG CATCACCAAGGATAACGCCAAGAGCCAAGTCT CTCTGTCAGTAAGCAGCGTGACAACTGAGGGC TCGGCCACGTATTACTGT FRH4(DNA) 100 TGGGGCCAGGGACTCCTGGTCACCGTCTCCTCA H1872(IMGT) CDRH1(protein) 101 GFSLSDKA CDRH2(protein) 102 IDTTGNA CDRH3(protein) 103 STVHQKTRRSCPSDYSFICDCEGTGSHCCRASN CPYYCNYGRDRMCTGRSNIHEWHVDA CDRH1(DNA) 104 GGATTCTCATTGAGCGACAAGGCT CDRH2(DNA) 105 ATAGACACTACTGGAAACGCA CDRH3(DNA) 106 TCTACTGTGCACCAGAAGACACGTCGCAGTTG TCCTTCTGATTATAGTTTCATTTGTGATTGTGAA GGTACTGGCAGTCATTGCTGTCGGGCTTCTAA TTGTCCTTATTACTGCAATTACGGCCGTGATCG TATGTGTACGGGCAGGAGTAACATTCACGAAT GGCACGTCGATGCC FRH1(protein) 107 KVQLRESGPSLVKPSQTLSLTCTAS FRH2(protein) 108 VGWRQAPGQPLEWLGT FRH3(protein) 109 VYNPGLKSRLSITKDNSKSQVSLSLSSVTTEDSA TYHC FRH4(protein) 110 WGQGLLVTVSS FRH1(DNA) 111 AAGGTGCAGCTGCGGGAGTCGGGCCCCAGCC TGGTGAAGCCGTCACAGACCCTCTCGCTCACC TGCACAGCCTCT FRH2(DNA) 112 GTAGGCTGGGTTCGCCAGGCTCCAGGGCAGC CGCTGGAGTGGCTCGGTACT FRH3(DNA) 113 GTCTATAACCCAGGCCTGAAATCCCGGCTCAG CATCACCAAGGATAACTCCAAGAGCCAGGTCT CTCTGTCACTAAGCAGCGTGACAACTGAGGAC TCGGCCACATATCACTGT FRH4(DNA) 114 TGGGGCCAAGGTCTCCTGGTCACCGTCTCCTCA 2129(IMGT) CDRH1(protein) 115 GFSLSDKA CDRH2(protein) 116 IDTGGNA CDRH3(protein) 117 STVHQKTRRSCPVDYYYSCDCEGSGSHCCSAS NCPYYCKYGRDRVCTDKHTYSYEWYVDA CDRH1(DNA) 118 GGATTCTCATTAAGCGACAAGGCT CDRH2(DNA) 119 ATAGACACTGGTGGAAACGCA CDRH3(DNA) 120 TCTACTGTGCACCAGAAGACACGACGTAGTTG TCCTGTTGATTATTATTATAGTTGCGACTGTGA AGGTAGTGGTAGTCATTGTTGCTCGGCTTCTA ATTGTCCTTATTACTGCAAGTATGGCCGTGATA GAGTTTGTACTGACAAACATACTTACAGTTACG AATGGTACGTCGATGCC FRH1(protein) 121 KVQLRESGPSLVKPSQTLSLTCTAS FRH2(protein) 122 VGWVRQAPGKALEWLGS FRH3(protein) 123 GYNPGLKSRLSITKGNSKSQVSLSVSSVTTEDSA TYYC FRH4(protein) 124 WGQGLLVTVSS FRH1(DNA) 125 AAGGTGCAGCTGCGGGAGTCGGGCCCCAGCC TGGTGAAGCCGTCACAGACCCTCTCGCTCACC TGCACGGCCTCT FRH2(DNA) 126 GTAGGCTGGGTCCGCCAGGCTCCAGGGAAGG CGCTGGAGTGGCTCGGTAGT FRH3(DNA) 127 GGCTATAACCCAGGCCTGAAATCCCGGCTCAG CATCACCAAGGGTAACTCCAAGAGCCAAGTCT CTCTGTCAGTGAGTAGCGTGACGACTGAGGAC TCGGCCACATATTACTGT FRH4(DNA) 128 TGGGGCCAGGGACTCCTGGTCACCGTCTCCTCA CDRH2 129 IDTX.sub.1GNA (protein; WhereinX1=GorT IMGT) CDRH3 130 STVHQKTX.sub.1RSCPX.sub.2DYX.sub.3X.sub.4X.sub.5CDCEX.sub.6X.sub.7GSHCC (protein; X.sub.8AX.sub.9NCPYYCX.sub.10X.sub.11GRDRX.sub.12CTX.sub.13X.sub.14X.sub.15X.sub.16X.sub.17 IMGT) X.sub.18X.sub.19EWX.sub.20VX.sub.21A whereinX1=RorL;X2=SorV;X3=P, SorY;X4=YorF;X5=IorS;X6=Gor D;X7=TorS;X8=RorS;X9=SorT; X10=NorK;X11=YorH;X12=MorV; X13=GorD;X14=RorK;X15=Hor noaminoacidatthisposition;X16=Tor S;X17=YorN;X18=T,IorS;X19=Y orH;X20=HorY;X21=DorE. CDRL1(protein) 131 SSNVGNGY CDRL2(protein) 132 GDT CDRL3(protein) 133 ASAEDGSSNAV CDRL1(DNA) 134 AGCAGCAATGTTGGAAATGGATAT CDRL2(DNA) 135 GGTGACACC CDRL3(DNA) 136 GCATCTGCTGAGGATGGTAGCAGTAATGCTGTT FRL1(protein) 137 QAVLTQPSSVSGSLGQRVSTTCSGS FRL2(protein) 138 VSWYQLIPGSAPRTLIY FRL3(protein) 139 SRASGVPDRFSGSRSGNTVTLTISSLQAEDEADYFC FRL4(protein) 140 FGRGTTLTVV FRL1(DNA) 141 CAGGCTGTGCTGACTCAGCCATCATCCGTGTC CGGGTCCCTGGGCCAGAGGGTCTCCACCACC TGCTCTGGAAGC FRL2(DNA) 142 GTGAGCTGGTACCAACTGATTCCAGGATCGGC CCCCAGAACCCTCATCTAT FRL3(DNA) 143 AGTCGAGCCTCGGGGGTCCCCGACCGATTCT CCGGCTCCAGGTCTGGGAACACAGTCACCCT GACCATCAGCTCGCTCCAGGCTGAGGACGAG GCAGATTATTTCTGC FRL4(DNA) 144 TTCGGCAGAGGGACCACACTGACAGTCGTC
EXAMPLES
Example 1Generation and Validation of Bovine BrNAbs
(177) The inventors herein set out to generate and validate anti-HIV bovine BrNAbs as novel HIV therapeutic/prophylactic agents with utility as HIV vaccines.
Methods
(178) Cow immunisation: Holstein Friesian cattle (Bos taurus) were vaccinated subcutaneously into the flank, using Seppic Montanide (ISA206) adjuvant. Female cows were immunised prior to and during pregnancy period and revaccinated after calving (
(179) Serum ELISA and neutralization of sera samples: IgG titres in sera against autologous Env vaccine antigens were measured by direct ELISA, with incubations performed at room temperature (RT) except when stated. Casein buffer 1 (Sigma) was used as sample diluent for each step. Briefly, 96-well plates were coated with 1 g/ml recombinant Env gp140 proteins (BG505 SOSIP gp140, AD8 Unc gp140) in coating buffer (200 mM Tris-HCl, 100 mM NaCl, pH 8.8) overnight at 4 C. The plate was washed four times with PBS+ 0.1% Tween and four times with PBS then blocked with casein buffer 1 (Sigma). Sera samples were added in half-log.sub.10 dilutions and incubated for 3 hrs at RT. Afterward, 1/1000 dilution of HRP-conjugated sheep-anti-bovine IgG (BioRad, #AAI23P) was loaded and incubated for 1 hr at RT. Finally, color development was performed using TMB (Sigma, cat no: T5525) according to manufacturer instructions and the reaction was stopped using 1M H.sub.2SO.sub.4. Absorbance was measured at 450 nm against a reference of 690 nm.
(180) For neutralization assay of sera samples, HIV-1 pseudoviruses were produced as described previously (Kramski, M., et al. Antimicrob Agents Chemother, 2012. 56(8): p. 4310-9; Montefiori, D. C. Curr Protoc Immunol, 2005. Chapter 12: p. Unit 12 11). Pseudoviruses were produced in HEK 293T cells by co-transfecting a backbone plasmid with one of Env expressing plasmids. TZM-bl neutralization assay was performed for sera samples collected pre-immunisation, at phase 1 (week 54) and phase 2 (week 59). The assay was performed as described previously (Montefiori, D. C., Curr Protoc Immunol, 2005. Chapter 12: p. Unit 12 11). Briefly, 50 l of pseudovirus in complete DMEM (DMEM+10% FBS) (200 TCID50) was mixed with serial dilutions of serum samples in a final volume of 100 l in 96-well plates (Corning, flat bottom, non-pyrogenic), and incubated for 1 hr at 37 C. Thereafter, 10.sup.4 TZM-bl cells (containing 125 mM of DEAE-Dextran (Sigma) was added to each well and plates were incubated for 72 hours at 37 C. Inhibition of infection was calculated by measuring relative luminescence units (RLUs) using Britelite plus (PerkinElmer) in a FLUOstar Omega (BMG Labtech) plate reader. ID50 neutralizing antibody titers are expressed as the reciprocal of the sample dilution required to reduce RLU by 50%.
(181) HIV-1 Env Production, Expression and Purification:
(182) Vaccine proteins including HIV-1 NL AD8 (AD8) Unc gp140 Env (clade B) was expressed using stably-transfected Hela cells line and AD8 6R SOSIP.664 were produced by transient transfection of HeLa and HEK 293T cells Center, R. J., et al., Vaccine, 2009. 27(47): p. 6605-6612) or Expi293 cells. KNH1144 SOSIP gp140 (clade A) produced as in (Kang, Y., et al., Vaccine, 2009. 27(37): p. 5120-5132), and BG505 SOSIP gp140 (clade A). Proteins were purified with lentil-lectin column and size exclusion chromatography as previously described (Sanders, R. W., et al., PLoS Pathog, 2013. 9(9): p. e1003618; and Center, R. J., et al., Vaccine, 2009. 27(47): p. 6605-12).
(183) AD8 SOSIP gp140 v4.1 was produced using an Env-expression plasmid encoding the Env from NL(AD8) (Freed, E. O., G. Englund, and M. A. Martin, J Virol, 1995. 69(6): p. 3949-54) modified according to the v4.1 mutations described previously (de Taeye, S. W., et al., Cell, 2015. 163(7): p. 1702-15) with either a C-terminal D7324 epitope tag or AviTag. Proteins were expressed in Expi293F cells by co-transfecting the Env-expression plasmid with a human furin protease expression plasmid. Env was purified from culture supernatant using a 2G12-sepharose affinity resin (prepared by coupling anti-HIV-1 mAb 2G12 to CNBr-sepharose resin) and eluted using 3M MgCl.sub.2. The Env was immediately buffer exchanged into PBS and trimeric Env was further purified by size exclusion chromatography using a HiLoad 16/600 Superdex prep grade column (GE Healthcare Life Sciences). For biotinylation of AviTag trimers, BirA enzyme was used according to manufacturer's instructions (Avidity, LLC).
(184) Monomeric AD8 gp120 was also produced as described previously (Center, R. J., et al., Vaccine, 2009. 27(47): p. 6605-12; Center, R. J., et al. J Virol, 2000. 74(10): p. 4448-55; Gonelli, C. A., et al. Viruses, 2019. 11(6)). BG505 WT. SEKS (uncleaved gp140) was produced as described above for AD8 SOSIP gp140 protein, except that the Env expression plasmid (Ringe, R. P., et al. Proc Natl Acad Sci USA, 2013. 110(45): p. 18256-61) was not co-transfected with a furin expression plasmid.
(185) Small-angle X-ray scattering: Small-angle X-ray scattering (SAXS) measurements were conducted at the Australian Synchrotron SAXS/WAXS Beamline equipped with a co-flow system to avoid radiation damage and enable higher X-ray flux (11,500 eV) and with an in-line size exclusion chromatography (SEC) to limit protein sample dilution (Kirby, N., et al., Acta Crystallogr D Struct Biol, 2016. 72(Pt 12): p. 1254-1266; Kirby, N. M., et al., J. Appl. Crystallogr, 2013. 46: p. 1670-1680; Ryan, T. M., et al., J. Appl. Crystallogr, 2018. 51: p. 97-111). Fifty microliters of the purified AD8 SOSIP (2 mg/ml) was injected over a precision Superose 6 5/150 increase column (GE Healthcare) equilibrated and eluted with PBS (pH 7.4) with a solution containing 1 mM EDTA and 0.2% sodium azide. The sample to detector length used was 3256 mm, providing a q range of 0.007-0.515 .sup.1. Collected SAXS data was reduced using the Sactterbrain software, analysed by CHROMIXS (Panjkovich, A. and D. I. Svergun, Bioinformatics, 2018. 34(11): p. 1944-1946), and the ATSAS 3.0.2 software package (Franke, D., et al. J Appl Crystallogr, 2017. 50(Pt 4): p. 1212-1225). SAXS patterns, the radius of gyration (Rg), the maximal particle dimension (Dmax), and the pairwise distance distribution histogram [P(r) plot] were analyzed by using the ATSAS software suite (PV, K., et al. Journal of Applied Crystallography, 2003. 36: p. 1277-1282). Ab initio modelling was performed using DAMMIF (Franke, D. and D. I. Svergun, J Appl Crystallogr, 2009. 42(Pt 2): p. 342-346) and the models were averaged by DAMAVER. A summary of the SAXS data acquisition parameters is provided in Table 2. The first 100 data points (before the void volume) were averaged as buffer scattering data and subtracted from the corresponding protein scattering data.
(186) TABLE-US-00002 TABLE 2 SAXS data collection parameters Instrument/source Australian Synchrotron SAXS/WAXS beamline equipped with Pilatus 1M detector and sheath-flow cell for SEC-SAXS. Wavelength () 1.0332 Beam energy (kEv) 12 Beam size (m) 250 130 Sample-to-detector distance (mm) 1426 q measurement range (.sup.1) 0.005-0.300 Absolute scaling method Comparison with scattering from 1 mm pure water Normalization To transmitted intensity from beamstop counter Exposure time 1 s measurements from SEC-SAXS elution Sample temperature (K) 295 SEC-SAXS parameters Column Superdex 200 5 150 Flow rate (mL/min) 0.4 Loading concentration (mg/mL) 2 Injection volume (L) 50 Solvent 20 mM Phosphate buffer, pH 7.4, 150 mM NaCl, 0.5 mM TCEP, 0.1% sodium azide Software employed SAXS data reduction I(q) vs q using Scatterbrain 2.8.2, SEC-SAXS solvent subtraction using CHROMIXS from ATSAS 2.8.3 Basic analysis (Guinier, P(r), PRIMUSqt from ATSAS 2.8.3 molecular mass) Ab initio modelling GASBOR, fitting to reciprocal space, models aligned and compared using DAMAVER and DAMCLUST from ATSAS 2.8.3 Calculation of theoretical intensities CRYSOL from ATSAS 2.8.3 Atomic structure (hybrid) modelling CORAL from ATSAS 2.8.3 Structural parameters Mass from V.sub.c (kDa) (expected mass, 263.0 (232.2, 1.13) ratio to expected in brackets) Guinier analysis R.sub.g () 53.25 0.16 I(0) (cm.sup.1) 0.13 0.00025 qR.sub.g min, max 0.35, 1.29 P(r) analysis R.sub.g () 53.31 0.13 I(0) (cm.sup.1) 0.12 0.00021 D.sub.max () 174.59 Porod volume (.sup.3) 905887.00 Ab initio modelling DAMMIF (10 calculations, default parameters q range for fitting () 0.00955-0.1507 Constant subtracted 5.643 10.sup.5 Symmetry, anisotropy assumptions P3, none Number of Shannon channels 7.050 .sup.2 range 0.77-1.05 NSD (standard deviations) 0.797 DAMMIN (default parameters) q range for fitting () 0.00955-0.1507 Symmetry, anisotropy assumptions P3, none .sup.2 0.77 Constant adjustment 5.643 10.sup.5
(187) Single Particle Negative Stain Electron Microscopy: Purified AD8 SOSIP v4.1 (100 ng/l) was placed on glow-discharged carbon coated copper mesh grids and stained with 1% uranyl formate. Grids were screened for appropriate stain thickness and particle distribution and images were collected using an FEI Talos L120C electron microscope. Images were collected at 73,000 magnification with a 1.8 m defocus for a final magnified pixel size of 1.9 /pix. Negatively stained AD8 particles were then automatically picked based on an empirical evaluation of maximum particle radius of 110 , characteristic particle radius of 80 , and with threshold peak high of 5 standard deviation above the noise using cisTEM software version 1.0.0-beta (Grant, T., A. Rohou, and N. Grigorieff, Elife, 2018. 7). Further, a 2D classification was performed on 38,000 particles in cisTEM that resulted in 50 classes. The initial model was generated ab initio using the data set and processed under the filter for particles from 20 to 8 in the first step of classification within cisTEM. Best 18 classes representing different orientations of AD8 were selected for further iterative 3D classification under C3 symmetry. This was followed by a local refinement and a final 3D refinement in cisTEM. UCSF Chimera was used to generate figures (Pettersen, E. F., et al. J Comput Chem, 2004. 25(13): p. 1605-12).
(188) Single cell sorting by Fluorescence-Activated Cell Sorting (FACS): Sorting of bovine PBMC was performed as described previously (Heydarchi, B., et al., MAbs, 2017. 9(3): p. 550-566) with minor modifications (
(189) Single cell cDNA synthesis, RT-PCR and cloning: cDNA was synthesized from mRNA of each single cell (Tiller, T., et al., Journal of Immunological Methods, 2008. 329(1-2): p. 112-124) and antibody variable genes were amplified as described previously (Heydarchi, B., et al., MAbs, 2017. 9(3): p. 550-566) with minor modifications. Briefly, antibody heavy gamma () and light lambda () variable genes were amplified independently in nested PCR using MyTaq HS Red Mix (Bioline) according to the manufacturer's instruction. The PCR reaction primers and conditions are listed in Table 3. PCR1 reactions were set up in 25 l with 2.5 l cDNA while volume of PCR2 reactions were 50 l using 5 l PCR1 product. The PCR reaction was performed as 94 C. 5 minutes, 50 cycles of 94 C. for 45 seconds, 60 C. for 45 seconds and 72 C. for 45 seconds and final extension at 72 C. for 10 minutes. The annealing temperature of PCR1 for lambda gene was 58 C. The amplified bovine VH/VL genes were cloned into the human constant heavy (CH) and constant light (CL) region expression vectors in pFUSEssCHIg-hG1 and pFUSE2ss-CLIg-hL2 (Invivogen), using EcoRI/NheI and EcoRI/AvrII restriction enzymes, respectively.
(190) TABLE-US-00003 TABLE3 Primersusedforproducingchimericbovine-humanfullantibodies PCR Primercode SEQIDNO: Sequence5-3 Reaction odp 145 ATGAACCCACTGTGGACCCTC Forward H1 2569 odp 146 AGAACTCAGAGGGTAGACTTTCGG Reverse H1 2570 odp 147 CTTTCGGGGCTGTGGTGGAGGC Reverse H1 3667 odp 148 GAATTCGMAGGTGCAGCTGCRGGAGTC Forward H2 3668 (EcoRI) odp 149 GCTAGCTGAGGAGACGGTGACCAGGAG Reverse H2 2568 (Nhel) odp 150 CACCATGGCCTGGTCCCCTCTG Forward L1 3670 odp 151 GACCCCAGACTCACCATCTC Forward L1 3671 odp 152 AGGGCTGCGGGCTCAGAAGGCAGC Forward L1 3672 odp 153 CTGCCCCTCCTCACTCTCTGC Forward L1 3673 odp 154 GGAACCTTTCCTGCAGCTC Forward L1 3674 odp 155 GCTTGCTTATGGCTCAGGTC Forward L1 3675 odp 156 ATGTCCACCATGGCCTGGTCC Forward L1 2573 odp 157 CTTGTTGCCGTTGAGCTCCTC Reverse L1 2574 odp 158 GAATTCGCAGGCTGTGCTGACTCAG Forward L2 2571 (EcoRI) odp 159 CCTAGGACGACKGTCAGTGTGGTSCC Reverse L2 3677 (AvrII) odp 160 CTCAACTCTACGTCTTTGTTTC Forward Sequencing 2781
Restriction enzyme sites are in bold and the nucleotides inserted to keep the frame reading in the expression vector are in Italic and underlined. H: heavy chain, L: light chain. Reaction number shows whether the primer was used in nester RT-PCR reaction 1 or reaction 2.
(191) Antibody production and purification: Antibody plasmids containing heavy chain and light chain genes were co-transfected (2:3 ratio) in Expi293F cells using Expifectamine (Thermo Fisher Scientific) according to manufacturer instructions. Supernatants containing antibodies were harvested 4 days after transfection and sterilised using 0.22 m filters. Antibody supernatants were purified over Protein G Agarose Fast Flow (Merck Millipore). NC-Cow1 antibody was produced as an anti-HIV-1 bovine antibody control by codon optimisation of genes available from the GenBank (MF167446.1 and MF167436.1). Antibody supernatants were purified using Protein G Agarose Fast Flow (Merck Millipore). Antibodies were eluted from chromatography columns using 50 mM glycine (pH=2.7) and immediately neutralised by addition of 1/10 volume of 1 M Tris (pH=8.0) before being buffer exchanged into PBS, concentration using Amicon 50 kDa spin membranes (Millipore) and sterilization using 0.22 m filters.
(192) Generation of HIV-1 AD8 pseudovirus mutant: Specific amino acid changes to HIV-1 AD8 gp160 Env were introduced using the following PCR reaction set up: 100 ng Full-length AD8 gp160 Env plasmid, 5% Dimethyl sulfoxide (DMSO), 10 l 5 Phusion Reaction buffer (New England BioLabs), 1 l dNTP mix (10 mM, Promega), 3 U Phusion HF DNA Polymerase (New England BioLabs, (MEL-2000 units/ml)), 0.5 l from each forward and Reverse primer (20 M) (Table 4) and nuclease-free H2O up to the total volume of 50 l. The PCR reaction was performed as following: 95 C. 5 min, 30 cycles of 95 C. 30 sec, 48 C. 30 sec, 72 C. 8 min and final extension of 72 C. 15 min. Mutations were confirmed by sequence analysis.
(193) TABLE-US-00004 TABLE4 PrimersusedforsitedirectedmutagenesisoffulllengthAD8gp160Env Primer SEQ code IDNO: Sequence5-3 Mutation odp 161 cacaagaagtagtattggCaaatgtgacaga Forward E87A 3770 odp 162 attttctgtcacatttGccaatactacttc Reverse E87A 3771 odp 163 taaagccatgtgtaGCattaaccccactctgtg Forward K121A 3772 odp 164 acacagagtggggttaaTGCtacacatggc Reverse K121A 3773 odp 165 aagactatgcacttttttatagaGCtgatgtagtaccaatag Forward L179A 3774 odp 166 tcattatctattggtactacatctGCtctataaaaaagtgcatag Reverse L179A 3775 odp 167 ttgatgtagtaccaatagCtaatgataatactagctatagg Forward D185A 3776 odp 168 acctatagctagtattatcattaGctattggtactaca Reverse D185A 3777 odp 169 tataggttgataaattgtGCtacctcaaccattacacagg Forward N197A 3778 odp 170 tgtgtaatggttgaggtaGCacaatttatcaacctatagc Reverse N197A 3779 odp 171 tcaactcaactgctgttaGCtggcagtctagc Forward N262A 3782 odp 172 ttcttctgctagactgccaGCtaacagcagttgag Reverse N262A 3783 odp 173 agaggtagtaattagatctagtGCtttcacagacaatgc Forward N276A 3784 odp 174 ttgcattgtctgtgaaaGCactagatctaattactacctc Reverse N276A 3785 odp 175 tctagtaatttcacagCcaatgcaaaaaacataatagtac Forward D279A 3786 odp 176 atgttttttgcattgGctgtgaaattactagatctaattactac Reverse D279A 3787 odp 177 atttcacagacaatgcaGCaaacataatagtacagttg Forward K282A 3788 odp 178 aactgtactattatgttTGCtgcattgtctgtgaaattac Reverse K282A 3789 odp 179 ttcacagacaatgcaaaaGCcataatagtacagttg Forward N283A 3790 odp 180 ttcaactgtactattatGGCttttgcattgtctgtg Reverse N283A 3791 odp 181 agtatacatataggaGcaggaagagcattttatac Forward P313A 3792 odp 182 tgttgtataaaatgctcttcctgCtcctatatgtatac Reverse P313A 3793 odp 183 aggagatataagacaaAAacattgcaacattagtagaac Forward A329K 3794 odp 184 ttgttctactaatgttTTaatgtgcttgtcttatatctcc Reverse A329K 3795 odp 185 aagacaagcacattgcaCcattagtagaacaaaatgg Forward N332? 3796 odp 186 tgttattccattttgttctactaatgGtgcaatgtgcttgtcttatatc Reverse N332T 3797 odp 187 aataaaacaatagtctttaatGCatcctcaggaggggaccc Forward Q363A 3800 odp 188 acaatttctgggtcccctcctgaggatGCattaaagactattgttttatt Reverse Q363A 3801 attccc odp 189 aacaatagtctttaatcaaGcctcaggaggggacccagaaattg Forward S364A 3802 odp 190 ttctgggtcccctcctgaggCttgattaaagactattgttttattattcc Reverse S364A 3803 odp 191 aatagtctttaatcaatccGcaggaggggacccagaaattgtaatgc Forward S365A 3804 odp 192 aatttctgggtcccctcctgCggattgattaaagactattgttttattatt Reverse S365A 3805 cc odp 193 tagtctttaatcaatcctcagCaggggacccagaaattgtaatgc Forward G366A 3806 odp 194 attacaatttctgggtcccctGctgaggattgattaaagac Reverse G366A 3807 odp 195 tagtctttaatcaatcctcaggagCggacccagaaattgtaatgc Forward G367A 3808 odp 196 tgcattacaatttctgggtccGctcctgaggattgattaaagac Reverse G367A 3809 odp 197 ttaatcaatcctcaggaggggCcccagaaattgtaatgcac Forward D368A 3810 odp 198 aactgtgcattacaatttctgggGcccctcctgaggattg Reverse D368A 3811 odp 199 aatcaatcctcaggaggggacGcagaaattgtaatgcacag Forward P369A 3812 odp 200 aactgtgcattacaatttctgCgtcccctcctgagg Reverse P369A 3813 odp 201 aatcaatcctcaggaggggacccagCaattgtaatgcacag Forward E370A 3814 odp 202 taaaactgtgcattacaattGctgggtcccctcctgagg Reverse E370A 3815 odp 203 aatcctcaggaggggacccagaaGCtgtaatgcacagttttaattgtgg Forward 1371A 3816 odp 204 aattaaaactgtgcattacaGCttctgggtcccctcc Reverse 1371A 3817 odp 205 atcaatcctcaggaggggacccagaaattgCaatgcacagttttaattgt Forward V372A 3818 gg odp 206 ttcccctccacaattaaaactgtgcattGcaatttctgggtcccctcc Reverse V372A 3819 odp 207 acccagaaattgtaGCgcacagttttaattgtggaggg Forward M373A 3820 odp 208 ttcccctccacaattaaaactgtgcGCtacaatttctggg Reverse M373A 3821 odp 209 atgacactatcacactcccatgtGCaataaaacaaattataaacatgtg Forward R419A 3822 odp 210 atgtttataatttgttttattGCacatgggagtgtgatagtgtc Reverse R419A 3823 odp 211 atattacagggctgatattaGcaagagatggtggaaataacc Forward T455A 3824 odp 212 ttgtggttatttccaccatctcttgCtaatatcagccctg Reverse T455A 3825 odp 213 tacagggctgatattaacaagagCtggtggaaataaccacaataatgat Forward D457A 3826 ac odp 214 ttgtggttatttccaccaGctcttgttaatatcagccctg Reverse D457A 3827 odp 215 taccgagacctttagacctgCaggaggagatatgagggac Forward G471A 3828 odp 216 ttgtccctcatatctcctcctGcaggtctaaaggtctcgg Reverse G471A 3829 odp 217 agacctttagacctggagCaggagatatgagggacaattgg Forward G472A 3830 odp 218 attgtccctcatatctcctGctccaggtctaaaggtctcgg Reverse G472A 3831 odp 219 acctttagacctggaggagCagatatgagggacaattggag Forward G473A 3832 odp 220 ttctccaattgtccctcatatctGctcctccaggtctaaaggtctcgg Reverse G473A 3833 odp 221 tagacctggaggaggagCtatgagggacaattggagaagtg Forward D474A 3834 odp 222 ttctccaattgtccctcataGctcctcctccaggtctaaagg Reverse D474A 3835 odp 223 ttagacctggaggaggagatGCgagggacaattggagaagtg Forward M475A 3836 odp 224 ttctccaattgtccctcGCatctcctcctccaggtctaaagg Reverse M475A 3837 odp 225 tggaggaggagatatgGCggacaattggagaagtg Forward R476A 3838 odp 226 acttctccaattgtccGCcatatctcctcctccaggtctaaagg Reverse R476A 3839 odp 227 ggtacataatgtttgggccac Forward Sequencing 1377 odp 228 gctgttaaatggcagtctagc Forward Sequencing 1379 odp 229 ctactgtaattcaacacaactg Forward Sequencing 1441 Nucleotides to be mutated are shown in capital letters and bold font.
(194) ELISA assays of HIV-1 monoclonal antibodies: To screen HIV Env binding mAbs, ELISA plates were coated with 2 g/ml D7324 Sheep Anti-gp120 (Aalto Bio Reagents) at 4 C. in 1PBS overnight. Plates were washed 4 with PBS+0.1% tween and 2 with PBS, then blocked with 5% Skim milk in 1PBS at room temperature for 1 hr. The plates were washed and 600 ng/ml D7324 tagged AD8 SOSIP gp140 v4.1 trimer was added and incubated for 1 hour at room temperature. Plates were washed and 1/1000 dilutions of goat anti-human IgG gamma HRP (KPL Cat No. 474-1002) (pre-incubated with 2% normal sheep serum) was added to the wells. The plate was incubated at room temperature for 1 h, washed then developed by adding SureBlue TMB (Australian Biosearch) according to the manufacturer's instructions. The absorbance was measured at 450 nm against a reference of 690 nm.
(195) To assess the binding of mAbs to mutated HIV Env gp160, harvested pseudoviruses were lysed with 1 Triton X-100 detergent (Astral Scientific). The plates were coated with D7324 Sheep Anti-gp120, blocked with skim milk and lysed pseudoviruses were captured on ELISA for 2 hours at 37 C. Then serial dilutions of mAbs were added before addition of goat anti-human gamma HRP.
(196) For experiments involving antibody binding to untagged HIV Env (monomeric AD8 gp120, AD8 uncleaved gp140, AD8 SOSIP gp140 v4.1 and ConM SOSIP gp140), plates were coated directly with 1 g/ml Env proteins at 4 C. in 1PBS overnight then washed and blocked before addition of mAbs and goat anti-human gamma HRP.
(197) Competition ELISA: To investigate the epitopes of AD8 Env-binding mAbs, a competition ELISA was performed using competing antibodies that were biotinylated with EZ-Link Sulfo-NHS-LC-Biotin kit (Thermo Fisher Scientific). The plates were coated with 1/1000 dilution of anti-6His antibody (Abcam #9108) and incubated overnight at 4 C. Then, the plates were washed and blocked with 5% skim milk in PBS+0.1% tween T (0.1%) for 1 hour at room temperature. Following washing, 500 ng/ml His-tagged AD8 SOSIP gp140 v4.1 trimer was added and the plates were incubated for 2 hours at room temperature. Then, bovine mAbs in the following amounts were added: 1 g/ml (MEL-1842, MEL-1872, MEL-2129, MEL-2000, MEL-2028 and MEL-782), 2 g/ml (MEL-2010, MEL-33, MEL-130, MEL-563 and MEL-663), and 5 g/ml (MEL-1905, MEL-1967, MEL-2114, MEL-F2, MEL-198 and MEL-D1). After washing, the biotinylated human mAbs were added in the following amounts to give sufficient signal: 1 g/ml (PGT121, PGT145, 10-1074, PGT151), 2 g/ml (VRC01 and 3BNC117), 5 g/ml (b12, HJ16). Then, 1/1000 dilutions of Streptavidin horse-radish peroxidase was added and incubated for 1 hour at room temperature followed by addition of SureBlue according to the manufacturer's instructions.
(198) For self-competition of bovine BrNAbs, the assay was performed as above except using biotinylated bovine mAbs as the following amounts: 1 g/ml for MEL-2028, MEL-2000, MEL-782, MEL-2129, MEL-1842, MEL-1872, 2 g/ml for MEL-2010, MEL-33, MEL-130, MEL-563, 5 g/ml for MEL-1905, MEL-1967, MEL-2114, MEL-F2, MEL-198 and MEL-D1.
(199) Neutralization assays of anti-HIV-1 monoclonal antibodies: The neutralization assay of TZM-bl was performed as described previously (Heydarchi, B., et al., MAbs, 2017. 9(3): p. 550-566). Wild-type and single mutated HIV pseudoviruses were produced by co-transfection of full length Env expression plasmids and a proviral reporter plasmid (pNL-4.3DenvNefEGFP). Supernatant was harvested after 72 hours and sterile filtered through a 0.22 m filter. Neutralization activity was measured by incubation of mAbs with pseudovirus for 1 hour at 37 C. before transferring onto TZM-bl cells.
(200) Polyreactivity assays: HEp-2 cell staining assay. The HEp-2 cell-staining kit (Aesku Diagnostics) was used according to manufacturer's instructions. In brief, 2.5 g of mAbs and controls were added to HEp-2 cell containing wells and incubated in a moist chamber at room temperature for 30 min. Slides were washed with PBS then 25 l FITC-conjugated goat anti-human IgG was applied with incubation of 30 minutes at room temperature. The slide was washed and mounted on coverslips using the provided mounting medium. Slides were viewed at 20 magnification and imaged on the Zeiss LSM780 confocal microscope. All images were captured with the following conditions: digital gain 800, laser power 2.0%. Samples showing fluorescence greater than the negative control (provided by the vendor) were considered positive for HEp-2 staining.
(201) Polyreactivity assay: Single autoantigen reactivity. Single antigen ELISA assays was performed using AESKULISA ANA-8Pro (Aesku) for U1-ribonucleoprotein (RNP), SnRNP/Sm, Sm, SS-A, SS-B, Jo-1, Scl-70, and CenpB. The 96 wells were coated with these cellular and nuclear antigens for the qualitative detection of mAbs reactivity. The cut-off calibrator, negative control and positive control were provided by the manufacturer.
Results
(202) Serum binding and neutralization. Holstein Friesian cattle were vaccinated prior to, during and after pregnancy with different HIV Env proteins. In order to evaluate the antibody responses against HIV-1 vaccines, sera from different timepoints were collected and binding of bovine IgGs to autologous Env immunogen was measured by direct ELISA (
(203) Although both cows vaccinated with AD8 Unc gp140 were unable to induce autologous neutralization, both cows #2 and #3 induced neutralizing antibodies against multiple pseudoviruses. On phase 1, cow #2 induced neutralization against MN (ID50 of 25.9), and this increased in phase 2 for MN (ID50 of 127.4). Cow #3 showed neutralization against MN, SF162, BG505 and JR-CSF at phase 1 (ID50s of 56.9, 27.6, 31.6 and 88, respectively), and the neutralizing activity enhanced against all mentioned viruses at phase #2 (ID50 values of 1000, 55.9, 47.3 and 108.9, respectively).
(204) HIV-1-specific bovine monoclonal antibodies. The secreted AD8 SOSIP gp140 v4.1 Env proteins were affinity-purified using the 2G12 antibody followed by SEC on a Superdex S200 16/600 column and characterised in reducing/non reducing SDS gel, BN-PAGE analysis and capture ELISA (
(205) HIV-1 Env-specific single B cells were sorted by FACS from PBMCs of animals #35, #8434 and #617 using AD8 SOSIP gp140 v4.1. AD8 strain (clade B) which is among difficult to neutralize HIV-1 viruses and we used this Env bait to isolate B cells from AD8 vaccinated animals (cow #2 and #3) and isolate B cells producing cross-clade anti-HIV-1 antibodies from the animal vaccinated with clade A Env (cow #1) (
(206) However, none of these mAbs could neutralize autologous HIV AD8 pseudovirus. From cow #8434, sixty chimeric mAbs were produced and although only nineteen mAb showed binding to SOSIP AD8 gp140, two of these antibodies showed autologous neutralization against AD8 pseudovirus in TZM-bl neutralization assay. MEL-1842 and MEL-1872 mAbs shower higher Env binding against AD8 SOSIP gp140 than VRC01 antibody (
(207) Bovine anti-HIV BrNAbs with ultra-long CDRH3: To understand the neutralisation properties of AD8 SOSIP gp140 v4.1 binding antibodies, TZM-bl neutralization was performed using a virus panel including HIV 12-virus global panel as well as several clade A, B and C viruses. Anti-HIV mAbs isolated from cow #35 showed a narrow breadth while mAbs of cow #8434 showed a moderate breadth against clade B viruses (
(208) Antibodies MEL-1842 and MEL-1872 demonstrated broader and more potent HIV-1 neutralizing activity compared with NC-Cow1 (60% breadth with IC.sub.50 of 0.09 g/ml) against tested viruses (
(209) Sequences of the isolated antibody variable genes are listed in
(210) TABLE-US-00005 TABLE 5 IMGT V-quest analysis of heavy chain for anti-HIV-1 bovine mAbs CDR1- CDR2- CDR3- V-gene J-gene IMGT IMGT IMGT Cow ID V-gene allele ID (%) J-gene allele ID (%) D-gene allele (aa) (aa) (aa) 1 MEL-1842 Bostau IGHV1-7*02 94.39 Bostau IGHJ2-4*01 89.58 Bostau IGHD8-2*01 8 7 59 MEL-1872 Bostau IGHV1-7*02 93.33 Bostau IGHJ2-4*01 91.67 Bostau IGHD8-2*01 8 7 59 MEL-1905 Bostau IGHV1-7*02 95.14 Bostau IGHJ2-4*01 91.67 Bostau IGHD6-2*01 8 7 45 MEL-1967 Bostau IGHV1-7*02 96.14 Bostau IGHJ2-4*01 93.75 Bostau IGHD8-2*01 8 7 55 MEL-2000 Bostau IGHV1-7*02 92.63 Bostau IGHJ2-4*01 93.75 Bostau IGHD8-2*01 8 7 55 MEL-2010 Bostau IGHV1-7*02 95.79 Bostau IGHJ2-4*01 95.83 Bostau IGHD8-2*01 8 7 58 MEL-2028 Bostau IGHV1-7*02 93.68 Bostau IGHJ2-4*01 93.75 Bostau IGHD8-2*01 8 7 63 MEL-2114 Bostau IGHV1-10*02 89.47 Bostau IGHJ2-4*01 89.58 Bostau IGHD3-1*01 8 7 14 MEL-2129 Bostau IGHV1-7*02 96.14 Bostau IGHJ2-4*01 93.75 Bostau IGHD8-2*01 8 7 60 2 Mel-563 Bostau IGHV1-7*02 97.54 Bostau IGHJ2-4*01 93.75 Bostau IGHD8-2*01 8 7 63 Mel-663 Bostau IGHV1-7*02 92.98 Bostau IGHJ2-4*01 97.92 Bostau IGHD8-2*01 8 7 60 MEL-782 Bostau IGHV1-10*01 93.68 Bostau IGHJ2-4*01 91.67 Bostau IGHD6-2*01 8 7 29 3 MEL-33 Bostau IGHV1-21*03 61.05 Bostau IGHJ2-4*01 89.58 Bostau IGHD6-2*01 8 7 19 MEL-130 Bostau IGHV1-21*03 99.65 Bostau IGHJ2-4*01 85.42 Bostau IGHD7-3*01 8 7 24 Bostau IGHV1-33*01 MEL-101 Bostau IGHV1-27*03 91.58 Bostau IGHJ2-4*01 95.83 Bostau IGHD7-3*01 8 7 24 MEL-F2 Bostau IGHV1-27*03 91.58 Bostau IGHJ2-4*01 95.83 Bostau IGHD7-3*01 8 7 24 MEL-D1 Bostau IGHV1-7*02 98.60 Bostau IGHJ2-4*01 91.67 Bostau IGHD8-2*01 8 7 61 MEL-198 Bostau IGHV1-7*02 96.14 Bostau IGHJ2-4*01 87.50 Bostau IGHD8-2*01 8 7 61 NA: The germline sequence could not be assigned with IMGT.
(211) Bovine BrNAbs bind to CD4 binding site (CD4bs) on HIV Env: Competition ELISA with reference human BrNAbs targeting four known epitopes was performed to evaluate interference with bovine mAbs binding to the AD8 SOSIP gp140 v4.1. As shown in
(212) Bovine BrNAbs bind to different form of HIV Env. As shown in
(213) Epitope mapping of bovine BrNAbs with HIV Env mutants: Affinity binding of bovine BrNAbs to a panel of thirty-three AD8 Env mutants (HIV AD8 lysed virions) showed that mutations located primarily in the CD4 binding site (CD4bs), C4 and C5 regions of Env impeded the binding of these mAbs (
(214) Neutralization activity of bovine BrNAbs was also assessed in TZM-bl neutralization assay using a panel of twenty-seven mutated AD8 pseudoviruses. As shown in
(215) A neutralization assay with multi-clade panel of viruses and their corresponding CD4bs mapping mutations (N279A, N280D, G458Y) showed evidence of CD4bs specificity for MEL-1842, MEL-1872 and MEL-2129 with at least three of the viruses (
(216) Bovine BrNAbs are not polyreactive: Autoreactivity and polyreactivity of 2129, 1842 and 1879 mAbs were evaluated in HEp-2 staining and ELISA assay against some human autoantigens. These bovine BrNAbs showed no autoreactivity or polyreactivity against tested antigens (
(217) Bovine BrNAbs retain their function when utilising different light chains. As shown in
(218) Among reported anti-HIV-1 neutralizing antibodies, CAP256-VRC26.25 (targeting V1V2 apex) has been the most potent antibody with geometric mean IC.sub.50 of 0.012 g/mL (median IC.sub.50=0.006 g/ml, breadth 59%) thus far. The CDRH3 of CAP256-VRC26.25 comprises 36 amino acids and is one of the longest human CDRH3s identified. There is a correlation between neutralization potency and CDRH3 length. CAP256-VRC26.25 has a protruding CDRH3 comprising a two-stranded antiparallel sheet that is stabilized with a disulfide bond. Although CAP256-VRC26.25 has approximately 70% breadth on clade C viruses, it shows limited breadth (<30%) on clade B viruses due to the relative rarity of acidic and basic residues recognized by the antibody at positions 164 and 169, respectively. NC-Cow1 is also the only potent anti-HIV-1 bovine CD4bs BrNAb with a protruding CDRH3 of 60 amino acids and broad neutralization against clade A viruses but moderate neutralization against clade B and C viruses. A bovine antibody isolated in this study (MEL-1872) showed higher potency with geometric mean IC.sub.50 of 0.009 g/ml (median IC.sub.50=0.006 g/ml) and breadth (66%) than CAP256-VRC26.25. Additionally, it showed more breadth and potency compared with NC-Cow1 against tested viruses (66% versus 60% breadth; Geometric mean IC.sub.50 of 0.009 g/ml versus 0.090 g/0 ml). Although MEL-1872 and NC-Cow1 mAbs showed similar breadth against clade A and C viruses, the former antibody showed more potency (8-fold and 4-fold, respectively). MEL-1872 mAb also neutralized clade B viruses with more potency (above 23-fold) and breadth (100% versus 50%) than NC-Cow1. Although like NC-Cow1, MEL-1872 mAb was isolated from a BG505 SOSIP (clade A) vaccinated cow, the usage of a tier-2 HIV-1 Env with different clade (AD8 SOSIP; clade B) for HIV-1-specific B cell sorting is likely the explanation of why MEL-1872 neutralization was broader and more potent than NC-Cow1 and other CD4bs antibodies that were isolated using Env binding-based HIV-1-specific B cell selection.
(219) Although there are numerous approved drugs against HIV-1 infection, they are limited to wealthy nations and lifelong treatment can be associated with significant toxicity and economic cost. Passive antibody prophylaxis and immunotherapy could hold a valuable place in both the prevention and treatment of HIV-1 infection. Disulphide bonds in bovine CDRH3 results in a rigid structure that might survive the acidic environment of mucosal environment better than human BrNAbs [9]. This rigid structure in bovine CDRH3 provides an excellent opportunity to design novel small molecule drug inhibitors accessing deep recessed epitopes on HIV-1 Env more efficiently than human BrNAbs.
(220) In conclusion, these data highlight those technical advantages identified by the inventors including that the defined broadly neutralising HIV-1 antibodies are capable of neutralizing multiple HIV-1 viral strains by targeting conserved epitopes of the HIV-1 Env protein, that they have higher potency than commercially available therapeutic antibodies, that they are capable of binding to multiple forms of HIV-1 Env and that they are not polyreactive or autoreactive, unlike antibody VRC01, highlighting their safety as anti-HIV therapeutics. These findings are significant in so far as they demonstrate that the antigen binding sites and antibodies described herein hold utility in the prevention, attenuation, treatment and neutralisation of HIV-1 infection.