FIBROBLAST ACTIVATION PROTEIN LIGANDS FOR TARGETED DELIVERY APPLICATIONS
20230147962 · 2023-05-11
Inventors
- Ilaria Biancofiore (Otelfingen, CH)
- Samuele Cazzamalli (Otelfingen, CH)
- Sheila Plaza Dakhel (Otelfingen, CH)
- Etienne J. Donckele (Otelfingen, CH)
- Jacopo Millul (Otelfingen, CH)
- Florent Samain (Otelfingen, CH)
- Eleonore Schmidt (Otelfingen, CH)
Cpc classification
A61K47/55
HUMAN NECESSITIES
A61K51/0455
HUMAN NECESSITIES
C07F7/00
CHEMISTRY; METALLURGY
A61K51/0497
HUMAN NECESSITIES
C07D519/00
CHEMISTRY; METALLURGY
C07F15/00
CHEMISTRY; METALLURGY
International classification
A61P35/00
HUMAN NECESSITIES
C07D519/00
CHEMISTRY; METALLURGY
C07F1/00
CHEMISTRY; METALLURGY
C07F7/00
CHEMISTRY; METALLURGY
C07F15/00
CHEMISTRY; METALLURGY
C07F5/00
CHEMISTRY; METALLURGY
Abstract
The present invention relates to ligands of Fibroblast Activation Protein (FAP) for the active delivery of various payloads (e.g. cytotoxic drugs, radionuclides, fluorophores, proteins and immunomodulators) at the site of disease. In particular, the present invention relates to the development of FAP ligands for targeting applications, in particular diagnostic methods and/or methods for therapy or surgery in relation to a disease or disorder, such as cancer, inflammation or another disease characterized by overexpression of FAP.
Claims
1-32. (canceled)
33. A compound, its individual diastereoisomers, its hydrates, its solvates, its crystal forms, its individual tautomers or a pharmaceutically acceptable salt thereof, wherein the compound comprises a moiety having the following structure A.sup.1 or A.sup.2, wherein m is 0, 1, 2, 3, 4 or 5: ##STR00231##
34. The compound according to claim 33, wherein the compound structure further comprises a diagnostic agent.
35. A therapeutic compound, its individual diastereoisomers, its hydrates, its solvates, its crystal forms, its individual tautomers or a pharmaceutically acceptable salt thereof, wherein the compound structure comprises a moiety having the following structure A: ##STR00232## and further comprises a therapeutic agent.
36. The compound according to claim 33, wherein the compound is represented by the following Formula I: ##STR00233## wherein A has the structure A.sup.1 or A.sup.2; B is a covalent bond or a moiety comprising a chain of atoms covalently attaching A to C; and C is an atom, a molecule or a particle, and/or is a therapeutic or diagnostic agent.
37. The compound according to claim 35, wherein the compound is represented by the following Formula I: ##STR00234## wherein B is a covalent bond or a moiety comprising a chain of atoms covalently attaching A to C; and C is a therapeutic agent.
38. The compound according to claim 37, wherein B is represented by any of the following general Formulae II-V, wherein: ##STR00235## each x is an integer independently selected from the range of 0 to 100, preferably 0 to 50, more preferably 0 to 30, yet more preferably selected from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20; each y is an integer independently selected from the range of 0 to 30, preferably selected from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20; each z is an integer independently selected from the range of 0 to 5, preferably selected from selected from 0, 1, 2, 3 and 4; and * represents a point of attachment to moiety A; and • represents a point of attachment to moiety C, wherein: B.sub.S and/or B.sub.L is a group comprising or consisting of a structural unit independently selected from the group consisting of alkylene, cycloalkylene, arylalkylene, heteroarylalkylene, heteroalkylene, heterocycloalkylene, alkenylene, cycloalkenylene, arylalkenylene, heteroarylalkenylene, heteroalkenylene, heterocycloalenkylene, alkynylene, heteroalkynylene, arylene, heteroarylene, aminoacyl, oxyalkylene, aminoalkylene, diacid ester, dialkylsiloxane, amide, thioamide, thioether, thioester, ester, carbamate, hydrazone, thiazolidine, methylene alkoxy carbamate, disulfide, vinylene, imine, imidamide, phosphoramide, saccharide, phosphate ester, phosphoramide, carbamate, dipeptide, tripeptide, tetrapeptide, each of which is substituted or unsubstituted.
39. The compound according to claim 38, wherein: (a) B.sub.S and/or B.sub.L is a group comprising or consisting of a structural unit independently selected from the group consisting of: ##STR00236## ##STR00237## ##STR00238## ##STR00239## ##STR00240## ##STR00241## ##STR00242## ##STR00243## ##STR00244## wherein each of R, R.sup.1, R.sup.2 and R.sup.3 is independently selected from H, OH, SH, NH.sub.2, halogen, cyano, carboxy, alkyl, cycloalkyl, aryl and heteroaryl, each of which is substituted or unsubstituted; each of R.sup.4 and R.sup.5 is independently selected from alkyl, cycloalkyl, aryl and heteroaryl, each of which is substituted or unsubstituted; each of R.sup.a, R.sup.b and R.sup.c is independently selected from side-chain residues of a proteinogenic or a non-proteinogenic amino acid, each of which can be further substituted; each X is independently selected from NH, NR, S, O and CH.sub.2, preferably NH; each of n and m is independently an integer from 0 to 100, preferably 0 to 50, more preferably 0 to 30, yet more preferably selected from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20; and wherein each * represents a point of attachment for which the shortest path to moiety A comprises less atoms than that for •; and each • represents a point of attachment for which the shortest path to moiety C comprises less atoms than that for *; (b) one or more B.sub.L independently comprises or consists of one or more of the following structural units: ##STR00245## ##STR00246## wherein in each of the above structures, n is 1, 2, 3 or 4; and each * represents a point of attachment for which the shortest path to moiety A comprises less atoms than that for •; and each • represents a point of attachment for which the shortest path to moiety C comprises less atoms than that for *, with the proviso that when n is >1 and a respective point of attachment is indicated on any one of R.sup.a, R.sup.b and R.sup.c, then it can be independently present in one or more of the peptide monomeric units, preferably in one peptide monomeric unit most distant from the other point of attachment indicated in the respective structure; (c) one or more of B.sub.L and B.sub.S is independently selected from the following structures: ##STR00247## wherein each * represents a point of attachment for which the shortest path to moiety A comprises less atoms than that for •; and each • represents a point of attachment for which the shortest path to moiety C comprises less atoms than that for *; and/or (d) y is 1, 2 or 3; and/or at least one B.sub.L further comprises a cleavable linker group independently selected from the following structures: ##STR00248## each * represents a point of attachment for which the shortest path to moiety A comprises less atoms than that for •; and each • represents a point of attachment for which the shortest path to moiety C comprises less atoms than that for *.
40. The compound according to claim 37, wherein B has the following structure: ##STR00249## wherein B′.sub.S and B″.sub.S are each independently selected from the group consisting of: ##STR00250## each B.sub.L is independently selected from the group consisting of: ##STR00251## ##STR00252## ##STR00253## each n is 0, 1, 2, 3, 4 or 5; each m is 0, 1, 2, 3, 4 or 5; each x′ is 0, 1 or 2; each x″ is 0, 1 or 2; each y is 0, 1 or 2; and z is 1 or 2, wherein R, R.sup.1, R.sup.2, R.sup.3, R.sup.a, R.sup.b, R.sup.c, X, * and • are defined as in claim 7.
41. The compound according to claim 33 having a structure represented by one of the following formulae: ##STR00254## ##STR00255## ##STR00256## ##STR00257## ##STR00258## ##STR00259##
42. The compound according to claim 37, wherein B is represented by the Formula IV or V, ##STR00260## wherein each B.sub.S and B.sub.L is independently selected from: ##STR00261## and wherein optionally at least one B.sub.L further comprises a cleavable linker group independently selected from the following structures: ##STR00262## wherein each of R is independently selected from H, OH, SH, NH.sub.2, halogen, cyano, carboxy, alkyl, cycloalkyl, aryl and heteroaryl, each of which is substituted or unsubstituted; each R.sup.a is independently selected from side-chain residues of a proteinogenic or a non-proteinogenic amino acid, each of which can be further substituted, wherein side-chain residues of a proteinogenic or a non-proteinogenic amino acid represented by any of R.sup.a can be part of a 3-, 4-, 5-, 6- or 7-membered ring, optionally wherein the side chain of said proteinogenic or non-proteinogenic amino acid can be part of a cyclic structure selected from an azetidine ring, pyrrolidine ring and a piperidine ring, such as in proline or hydroxyproline; and wherein each R.sup.a may independently be part of an unsaturated structure; and wherein each * represents a point of attachment for which the shortest path to moiety A comprises less atoms than that for •; and each • represents a point of attachment for which the shortest path to moiety C comprises less atoms than that for *.
43. The compound according to claim 37, wherein the moiety C is selected from: (a) a chelating agent group suitable for radiolabelling; (b) a radioactive group comprising a radioisotope; (c) a chelate of a radioactive isotope with a chelating agent; (d) a fluorophore group; (e) a cytotoxic and/or cytostatic agent; (f) immunomodulator agent; or (g) a protein.
44. The compound according to claim 43, wherein: (a) the chelating agent group suitable for radiolabelling: (i) has a structure according one of the following formulae: ##STR00263## wherein: n is 0, 1, 2, 3, 4 or 5; preferably 1; R.sup.1e is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH; R.sup.2e is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH; each R.sup.3e is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH; R.sup.4e is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH; R.sup.1f is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH; R.sup.2f is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH; R.sup.3f is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH; and X is O, NH or S; preferably O; or (ii) is selected from sulfur colloid, diethylenetriaminepentaacetic acid (DTPA), ethylenediaminetetraacetic acid (EDTA), 1,4,7,10-tetraazacyclododecane-N,N′,N″,N′″-tetraacetic acid (DOTA), 1,4,7-triazacyclononane-N,N′,N″-triacetic acid (NOTA), 1,4,8,11-tetraazacyclotetradecane-N,N′,N″,N′″-tetraacetic acid (TETA), iminodiacetic acid, bis(carboxymethylimidazole)glycine, 6-Hydrazinopyridine-3-carboxylic acid (HYNIC), ##STR00264## ##STR00265## ##STR00266## (b) the radioactive group comprising a radioisotope is selected from .sup.223Ra, .sup.89Sr, .sup.94mTc, .sup.99mTc, .sup.186Re, .sup.188Re, .sup.203Pb, .sup.67Ga, .sup.68Ga, .sup.47Sc, .sup.111In, .sup.97Ru, .sup.62Cu, .sup.64Cu, .sup.86Y, .sup.88Y, .sup.90Y, .sup.121Sn, .sup.161Tb, .sup.153Sm, .sup.166Ho, .sup.105Rh, .sup.177Lu, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.18F, .sup.211At, .sup.225Ac, .sup.89Sr, .sup.225Ac, .sup.117mSn and .sup.169Er; (c) the chelate of a radioactive isotope is a chelate of an isotope listed under (b) above and/or with a chelating agent listed under (a) above; or moiety C is a group selected from any of the following structures: ##STR00267## (d) the fluorophore group is selected from a xanthene dye, acridine dye, oxazine dye, cyanine dye, styryl dye, coumarine dye, porphine dye, fluorescent metal-ligand-complex, fluorescent protein, nanocrystals, perylene dye, boron-dipyrromethene dye and phtalocyanine dye, preferably selected from the following structures: ##STR00268## ##STR00269## (e) the cytotoxic and/or cytostatic agent: (i) has a structure according to the following formula: ##STR00270## wherein: R.sup.1d is independently H or C.sub.1-C.sub.6 alkyl; preferably H or CH.sub.3; R.sup.2d is independently C.sub.1-C.sub.6 alkyl; preferably CH.sub.3 or iPr; R.sup.3d is independently H or C.sub.1-C.sub.6 alkyl; preferably H or CH.sub.3; R.sup.4d is independently H, C.sub.1-C.sub.6 alkyl, COO(C.sub.1-C.sub.6 alkyl), CON(H or C.sub.1-C.sub.6 alkyl), C.sub.3-C.sub.10 aryl or C.sub.3-C.sub.10 heteroaryl; preferably H, CH.sub.3, COOH, COOCH.sub.3 or thiazolyl; R.sup.5d is independently H, OH, C1-C.sub.6 alkyl; preferably H or OH; and R.sup.6d is independently C.sub.3-C.sub.10 aryl or C.sub.3-C.sub.10 heteroaryl; preferably optionally substituted phenyl or pyridyl; or (ii) is selected from chemotherapeutic agent selected from the group consisting of topoisomerase inhibitors, alkylating agents, antimetabolites, antibiotics, mitotic disrupters, DNA intercalating agents, DNA synthesis inhibitors, DNA-RNA transcription regulator, enzyme inhibitors, gene regulators, hormone response modifiers, hypoxia-selective cytotoxins, epidermal growth factor inhibitors, anti-vascular agents and a combination of two or more thereof; or (iii) is selected from the following structures: ##STR00271## ##STR00272## ##STR00273## ##STR00274## ##STR00275## ##STR00276## ##STR00277## (f) the immunomodulator agent is selected from molecules known to be able to modulate the immune system, such as ligands of CD3, CD25, TLRs, STING, 4-1BBL, 4-1BB, PD-1, mTor, PDL-1, NKG-2D) IMiDs, wherein ligands can be agonists and/or antagonist; or (g) the protein is selected from cytokines, such as IL2, IL10, IL12, IL15, TNF, Interferon Gamma, or is an antibody.
45. The compound according to claim 33 having one the following structures, its individual diastereoisomers, its hydrates, its solvates, its crystal forms, its individual tautomers or a pharmaceutically acceptable salt thereof: TABLE-US-00009 # Structure 1
46. The compound according to claim 45, wherein the structure is selected from those with numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 18, 21, 26, 27, 30, 31, 34a, 35, 36, 37a, 38, 39, 40, 41, 42, 43, 43a, 44, 45, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58a, 58b, 58c, 58d, 58e, 58f, 59a, 60a, 64, 65, 66, 67, and 68.
47. The compound according to claim 45, wherein the structure is selected from those with numbers 2, 7, 8, 9, 10, 11, 12, 13, 14, 15, 18, 21, 26, 27, 30, 31, 34a, 35, 36, 37a, 38, 39, 40, 41, 42, 43, 43a, 44, 45, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58a, 58b, 58c, 58d, 58e, 58f, 59a, 60a, 64, 65, 66, 67, and 68.
48. The compound according to claim 45, wherein the structure is selected from those with numbers 8, 9, 10, 11, 12, 13, 14, 15, 18, 21, 26, 27, 30, 35, 38, 39, 40, 41, 42, 43a, 58a, 58b, 59a, 60a, 64, 65, 66, 67, and 68.
49. The compound according to claim 45, wherein the structure is selected from those with numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, and 26.
50. The compound according to claim 45 having the structure 8.
51. A diagnostic composition comprising the compound according to claim 34.
52. A method for the diagnosis of cancer comprising administering the compound according to claim 34 or a composition comprising the compound according to claim 34 to a subject in need thereof.
53. A method for the diagnosis of a disease or disorder in a human or animal subject, the method comprising administering the compound according to claim 34 or a diagnostic composition comprising the compound according to claim 34 to the subject.
54. A method for guided surgery practised on a subject suffering from or having risk for a disease or disorder, the method comprising administering the compound according to claim 34 or a composition comprising the compound according to claim 34 to the subject.
55. The method according to claim 53, the method being practised on the human or animal body and involving a nuclear medicine imaging technique, such as Positron Emission Tomography (PET) or Single Photon Emission Computed Tomography (SPECT).
56. The method according to claim 53, wherein said disease or disorder is independently selected from cancer, inflammation, atherosclerosis, fibrosis, tissue remodelling and keloid disorder, preferably wherein the cancer is selected from the group consisting of breast cancer, pancreatic cancer, small intestine cancer, colon cancer, multi-drug resistant colon cancer, rectal cancer, colorectal cancer, metastatic colorectal cancer, lung cancer, non-small cell lung cancer, head and neck cancer, ovarian cancer, hepatocellular cancer, oesophageal cancer, hypopharynx cancer, nasopharynx cancer, larynx cancer, myeloma cells, bladder cancer, cholangiocarcinoma, clear cell renal carcinoma, neuroendocrine tumour, oncogenic osteomalacia, sarcoma, CUP (carcinoma of unknown primary), thymus cancer, desmoid tumours, glioma, astrocytoma, cervix cancer, skin cancer, kidney cancer and prostate cancer; preferably wherein the compound has a prolonged residence at the disease site at a diagnostically relevant level, preferably beyond 1 h, more preferably beyond 6 h post injection.
57. A compound, its individual diastereoisomers, its hydrates, its solvates, its crystal forms, its individual tautomers or a salt thereof, wherein the compound comprises: a moiety having the following structure A.sup.1 or A.sup.2, wherein m is 0, 1, 2, 3, 4 or 5: ##STR00334##
58. The compound according to claim 57, wherein the compound is represented by the following Formula VI: ##STR00335## wherein B is a covalent bond or a moiety comprising a chain of atoms covalently attaching A to L, preferably wherein moiety B is as a therapeutic compound, its individual diastereoisomers, its hydrates, its solvates, its crystal forms, its individual tautomers or a pharmaceutically acceptable salt thereof, wherein the compound structure comprises a moiety having the following structure A: ##STR00336## and further comprises a therapeutic agent, wherein the compound is represented by the following Formula I: ##STR00337## wherein B is a covalent bond or a moiety comprising a chain of atoms covalently attaching A to C; and C is a therapeutic agent.
59. The compound according to claim 57, wherein L is capable of forming, upon reacting, an amide, ester, carbamate, hydrazone, thiazolidine, methylene alkoxy carbamate, disulphide, alkylene, cycloalkylene, arylalkylene, heteroarylalkylene, heteroalkylene, heterocycloalkylene, alkenylene, cycloalkenylene, arylalkenylene, heteroarylalkenylene, heteroalkenylene, heterocycloalenkylene, alkynylene, heteroalkynylene, arylene, heteroarylene, aminoacyl, oxyalkylene, aminoalkylene, diacid ester, dialkylsiloxane, amide, thioamide, thioether, thioester, ester, carbamate, hydrazone, thiazolidine, methylene alkoxy carbamate, disulfide, vinylene, imine, imidamide, phosphoramide, saccharide, phosphate ester, phosphoramide, carbamate, dipeptide, tripeptide or tetrapeptide linking group, preferably wherein moiety L is selected from: H, NH.sub.2, N.sub.3, COOH, SH, Hal, ##STR00338## ##STR00339## wherein each n is, independently, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10; each m is, independently, 0, 1, 2, 3, 4 or 5; each Hal is F, Cl, Br or I; and each R.sup.4 is, independently selected from carboxy, alkyl, cycloalkyl, aryl and heteroaryl, wherein each of the foregoing is substituted or unsubstituted, halogen, and cyano.
60. A method for preparing a conjugate comprising the step of conjugating with a compound according to claim 57 with a conjugation partner, wherein: the compound is conjugated by reacting with the conjugation partner to form a covalent bond; (a) the conjugate is a compound, its individual diastereoisomers, its hydrates, its solvates, its crystal forms, its individual tautomers or a pharmaceutically acceptable salt thereof, wherein the compound comprises a moiety having the following structure A.sup.1 or A.sup.2, wherein m is 0, 1, 2, 3, 4 or 5: ##STR00340## wherein the compound is represented by the following Formula I: ##STR00341## wherein A has the structure A.sup.1 or A.sup.2; B is a covalent bond or a moiety comprising a chain of atoms covalently attaching A to C; and C is an atom, a molecule or a particle, and/or is a therapeutic or diagnostic agent; and/or (b) the method further comprises formulating the conjugate as a diagnostic composition.
61. A method for preparing a conjugate comprising the step of conjugating with a compound according to claim 56 with a conjugation partner, wherein the compound is conjugated by reacting with the conjugation partner to form a covalent bond; and (a) the conjugate is a compound, its individual diastereoisomers, its hydrates, its solvates, its crystal forms, its individual tautomers or a pharmaceutically acceptable salt thereof, wherein the compound structure comprises a moiety having the following structure A: ##STR00342## and further comprises a therapeutic agent; wherein the compound is represented by the following Formula I: ##STR00343## wherein B is a covalent bond or a moiety comprising a chain of atoms covalently attaching A to C; and C is a therapeutic agent; and/or (b) the method further comprises formulating the conjugate as a pharmaceutical composition.
62. The compound according to claim 37, wherein the moiety C is a therapeutic agent selected from a: (a) cytotoxic and/or cytostatic agent which: (i) has a structure according to the following formula: ##STR00344## wherein: R.sup.1d is independently H or C.sub.1-C.sub.6 alkyl; preferably H or CH.sub.3; R.sup.2d is independently C.sub.1-C.sub.6 alkyl; preferably CH.sub.3 or iPr; R.sup.3d is independently H or C.sub.1-C.sub.6 alkyl; preferably H or CH.sub.3; R.sup.4d is independently H, C.sub.1-C.sub.6 alkyl, COO(C.sub.1-C.sub.6 alkyl), CON(H or C.sub.1-C.sub.6 alkyl), C.sub.3-C.sub.10 aryl or C.sub.3-C.sub.10 heteroaryl; preferably H, CH.sub.3, COOH, COOCH.sub.3 or thiazolyl; R.sup.5d is independently H, OH, C.sub.1-C.sub.6 alkyl; preferably H or OH; and R.sup.6d is independently C.sub.3-C.sub.10 aryl or C.sub.3-C.sub.10 heteroaryl; preferably optionally substituted phenyl or pyridyl; or (ii) is selected from chemotherapeutic agent selected from the group consisting of topoisomerase inhibitors, alkylating agents, antimetabolites, antibiotics, mitotic disrupters, DNA intercalating agents, DNA synthesis inhibitors, DNA-RNA transcription regulator, enzyme inhibitors, gene regulators, hormone response modifiers, hypoxia-selective cytotoxins, epidermal growth factor inhibitors, anti-vascular agents and a combination of two or more thereof; or (iii) is selected from the following structures: ##STR00345## ##STR00346## ##STR00347## ##STR00348## ##STR00349## (b) immunomodulator agent selected from molecules known to be able to modulate the immune system, and/or ligands of CD3, CD25, TLRs, STING, 4-1BBL, 4-1BB, PD-1, mTor, PDL-1, NKG-2D IMiDs, wherein ligands can be agonists and/or antagonist; or (c) protein preferably selected from cytokines, IL2, IL10, IL12, IL15, TNF, Interferon Gamma, and an antibody.
63. The compound according to claim 37 having one the following structures, its individual diastereoisomers, its hydrates, its solvates, its crystal forms, its individual tautomers or a pharmaceutically acceptable salt thereof: TABLE-US-00010 # Structure 1
64. A pharmaceutical composition comprising the compound according to claim 35 and a pharmaceutically acceptable excipient.
65. A method for the treatment of the human or animal body by surgery or therapy, the method comprising administering the compound according to claim 35 or a composition comprising the compound according to claim 35 to a subject in need thereof.
66. A method for the targeted delivery of a therapeutic agent to a subject suffering from or having risk for a disease or disorder, the method comprising administering the compound according to claim 35 or a composition comprising the compound according to claim 35 to the subject.
67. A method of treating a disease or disorder independently selected from cancer, inflammation, atherosclerosis, fibrosis, tissue remodelling and keloid disorder, the method comprising administering the compound according to claim 35 or a composition comprising the compound according to claim 35 to a subject in need thereof; preferably wherein the cancer is selected from the group consisting of breast cancer, pancreatic cancer, small intestine cancer, colon cancer, multi-drug resistant colon cancer, rectal cancer, colorectal cancer, metastatic colorectal cancer, lung cancer, non-small cell lung cancer, head and neck cancer, ovarian cancer, hepatocellular cancer, oesophageal cancer, hypopharynx cancer, nasopharynx cancer, larynx cancer, myeloma cells, bladder cancer, cholangiocarcinoma, clear cell renal carcinoma, neuroendocrine tumour, oncogenic osteomalacia, sarcoma, CUP (carcinoma of unknown primary), thymus cancer, desmoid tumours, glioma, astrocytoma, cervix cancer, skin cancer, kidney cancer and prostate cancer; and/or preferably wherein the compound has a prolonged residence at the disease site at a therapeutically relevant level, preferably beyond 1 h, more preferably beyond 6 h post injection.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
DETAILED DESCRIPTION OF THE INVENTION
[0045] The present inventors have identified small molecule binders of fibroblast activation protein (FAP) which are suitable for targeting applications. The binders according to the invention provide high inhibition of FAP, high affinity for FAP and/or are suitable for targeted delivery of a payload, such as a therapeutic or diagnostic agent, to a site afflicted by or at risk of disease or disorder characterized by overexpression of FAP. The binders according to the present invention form a stable complex with FAP, display an increased affinity, increased inhibitory activity, a slower rate of dissociation from the complex, and/or prolonged residence at a disease site. The binders according to the invention further can have an increased tumour-to-liver, tumour-to-kidney and/or tumour-to-intestine uptake ratio; a more potent anti-tumour effect (e.g., measured by mean tumour volume increase), and/or lower toxicity (e.g., as assessed by the evaluation of changes (%) in body weight). The binders according to the invention further can have a high or improved affinity for human and murine fibroblast activation protein and/or cross-reactivity to the murine antigen. The binders according to the invention preferably attain FAP-specific cellular binding; FAP-selective accumulation on the cell membrane; FAP-selective accumulation inside the cytosol. The binders according to the invention can further preferably, rapidly and homogeneously localize at the tumour site in vivo with a high tumour-to-organs selectivity, in particular for melanoma and/or renal cell carcinoma. Binders according to the invention comprising a radioactive payload (e.g., .sup.177Lu) preferably attain dose-dependent response, with target saturation reached between 250 nmol/Kg and 500 nmol/Kg reached and/or maintained at up to 12 h, more preferably 1 to 9 h, further more preferably 3 to 6 h after intravenous administration.
[0046] As explained above, the present invention provides a compound, its individual diastereoisomers, its hydrates, its solvates, its crystal forms, its individual tautomers or a pharmaceutically acceptable salt thereof, wherein the compound comprises a moiety A having the following structure:
##STR00003##
[0047] As explained above, a compound according to the present invention may be represented by Formula I:
##STR00004##
[0048] Therein, B is a covalent bond or a moiety comprising a chain of atoms covalently attaching A to C; and C may be an atom, a molecule or a particle, and/or is a therapeutic or diagnostic agent.
[0049] Accordingly, a compound according to the present invention may comprise a moiety having the following structure:
##STR00005##
wherein B is a covalent bond or a moiety comprising a chain of atoms covalently bound atoms.
Moiety A
[0050] Without wishing to be bound by any theory, it is contemplated that these surprising technical effects are associated with the particular structure of the small binding moiety A wherein the quinoline ring is substituted at the 8-position by a nitrogen-containing group, such as an amino or amido group:
##STR00006##
[0051] It has been previously shown that the higher target protein affinity of a compound results in longer tumour residence in vivo (Wichert et al., Nature Chemistry 7, 241-249 (2015)). The compounds of the present invention have an increased affinity, slower dissociation rate with respect to FAP as compared to prior art compounds, and therefore are also considered to as having a prolonged residence at the disease site at a therapeutically or diagnostically relevant level, preferably beyond 1 h, more preferably beyond 6 h post injection. Preferably, the highest enrichment is achieved after 5 min, 10 min, 20 min, 30 min, 45 min, 1 h, 2 h, 3 h, 4 h, 5 h or 6 h; and/or enrichment in the disease site is maintained at a therapeutically or diagnostically relevant level, over a period of or at least for 5 min, 10 min, 20 min, 30 min, 45 min, 1 h, 2 h, 3 h, 4 h, 5 h or 6 h, more preferably beyond 6 h post injection.
[0052] Preferably, the binding moiety A has the following structure A.sup.1; more preferably the following structure A.sup.2, wherein m is 0, 1, 2, 3, 4 or 5, preferably 1:
##STR00007##
Moiety B
[0053] Moiety B is a covalent bond or a moiety comprising a chain of atoms that covalently attaches A to the payload C, e.g., through one or more covalent bond(s). The moiety B may be cleavable or non-cleavable, bifunctional or multifunctional moiety which can be used to link one or more payload and/or binder moieties to form the targeted conjugate of the invention. In some embodiments, the structure of the compound comprises, independently, more than one moieties A, preferably 2, 3, 4, 5, 6, 7, 8, 9 or 10 moieties A; and/or more than one moieties C, preferably 2, 3, 4, 5, 6, 7, 8, 9 or 10 moieties C per molecule. Preferably, the structure of the compound comprises 2 moieties A and 1 moiety C; or 1 moiety A and 2 moieties C per molecule.
[0054] When cleavable linker units are present within moiety B, release mechanisms can be identical to those specific to antibodies linked to cytotoxic payloads. Indeed, the nature of the binding moieties is independent in that respect. Therefore, there is envisaged pH-dependent [Leamon, C. P. et al (2006) Bioconjugate Chem., 17, 1226; Casi, G. et al (2012) J. Am. Chem. Soc., 134, 5887], reductive [Bernardes, G. J. et al (2012) Angew. Chem. Int. Ed Engl., 51. 941; Yang, J. et al (2006) Proc. Natl. Acad Sci. USA, 103, 13872] and enzymatic release [Doronina S. O. et al (2008) Bioconjugate Chem, 19 1960; Sutherland, M. S. K. (2006) J. Biol. Chem, 281, 10540]. In a specific setting, when functional groups are present on either the binding moiety or payloads (e.g. thiols, alcohols) a linkerless connection can be established thus releasing intact payloads, which simplifies substantially pharmacokinetic analysis.
[0055] Moiety B can comprise or consist of a unit shown in Table 1 below wherein the substituents R and R.sup.n shown in the formulae may suitably be independently selected from H, halogen, substituted or unsubstituted (hetero)alkyl, (hetero)alkenyl, (hetero)alkynyl, (hetero)aryl, (hetero)arylalkyl, (hetero)cycloalkyl, (hetero)cycloalkylaryl, heterocyclylalkyl, a peptide, an oligosaccharide or a steroid group. Preferably, each of R, R.sub.1, R.sub.2 and R.sub.3 is independently selected from H, OH, SH, NH.sub.2, halogen, cyano, carboxy, alkyl, cycloalkyl, aryl and heteroaryl, each of which is substituted or unsubstituted. Suitably R and R.sup.n are independently selected from H, or C1-C7 alkyl or heteroalkyl. More suitably, R and R.sup.n are independently selected from H, methyl or ethyl.
TABLE-US-00001 TABLE 1 Linker Structure Release mechanism Amide
[0056] Moiety B, unit(s) B.sub.L and/or unit(s) B.sub.S may suitably comprise as a cleavable bond a disulfide linkage since these linkages are stable to hydrolysis, while giving suitable drug release kinetics at the target in vivo, and can provide traceless cleavage of drug moieties including a thiol group.
[0057] Moiety B, unit(s) B.sub.L and/or unit(s) B.sub.S may be polar or charged in order to improve water solubility of the conjugate. For example, the linker may comprise from about 1 to about 20, suitably from about 2 to about 10, residues of one or more known water-soluble oligomers such as peptides, oligosaccharides, glycosaminoglycans, polyacrylic acid or salts thereof, polyethylene glycol, polyhydroxyethyl (meth) acrylates, polysulfonates, etc. Suitably, the linker may comprise a polar or charged peptide moiety comprising e.g. from 2 to 10 amino acid residues. Amino acids may refer to any natural or non-natural amino acid. The peptide linker suitably includes a free thiol group, preferably a N-terminal cysteine, for forming the said cleavable disulfide linkage with a thiol group on the drug moiety. Any peptide containing L- or D-aminoacids can be suitable; particularly suitable peptide linkers of this type are Asp-Arg-Asp-Cys and/or Asp-Lys-Asp-Cys.
[0058] In these and other embodiments, moiety B, unit(s) B.sub.L and/or unit(s) B.sub.S may comprise a cleavable or non-cleavable peptide unit that is specifically tailored so that it will be selectively enzymatically cleaved from the drug moiety by one or more proteases on the cell surface or the extracellular regions of the target tissue. The amino acid residue chain length of the peptide unit suitably ranges from that of a single amino acid to about eight amino acid residues. Numerous specific cleavable peptide sequences suitable for use in the present invention can be designed and optimized in their selectivity for enzymatic cleavage by a particular tumour-associated enzyme e.g. a protease. Cleavable peptides for use in the present invention include those which are optimized toward the proteases MMP-1, 2 or 3, or cathepsin B, C or D. Especially suitable are peptides cleavable by Cathepsin B. Cathepsin B is a ubiquitous cysteine protease.
[0059] It is an intracellular enzyme, except in pathological conditions, such as metastatic tumours or rheumatoid arthritis. An example for a peptide cleavable by Cathepsin B is containing the sequence Val-Cit.
[0060] In any of the above embodiments, the moiety B and in particular, unit(s) B.sub.L suitably further comprise(s) self-immolative moiety can or cannot be present after the linker. The self-immolative linkers are also known as electronic cascade linkers. These linkers undergo elimination and fragmentation upon enzymatic cleavage of the peptide to release the drug in active, preferably free form. The conjugate is stable extracellularly in the absence of an enzyme capable of cleaving the linker. However, upon exposure to a suitable enzyme, the linker is cleaved initiating a spontaneous self-immolative reaction resulting in the cleavage of the bond covalently linking the self-immolative moiety to the drug, to thereby effect release of the drug in its underivatized or pharmacologically active form. In these embodiments, the self-immolative linker is coupled to the binding moiety through an enzymatically cleavable peptide sequence that provides a substrate for an enzyme to cleave the amide bond to initiate the self-immolative reaction. Suitably, the drug moiety is connected to the self-immolative moiety of the linker via a chemically reactive functional group pending from the drug such as a primary or secondary amine, hydroxyl, sulfhydryl or carboxyl group.
[0061] Examples of self-immolative linkers are PABC or PAB (para-aminobenzyloxycarbonyl), attaching the drug moiety to the binding moiety in the conjugate (Carl et al (1981) J. Med. Chem. 24: 479-480; Chakravarty et al (1983) J. Med. Chem. 26: 638-644). The amide bond linking the carboxy terminus of a peptide unit and the para-aminobenzyl of PAB may be a substrate and cleavable by certain proteases. The aromatic amine becomes electron-donating and initiates an electronic cascade that leads to the expulsion of the leaving group, which releases the free drug after elimination of carbon dioxide (de Groot, et al (2001) Journal of Organic Chemistry 66 (26): 8815-8830). Further self-immolating linkers are described in WO2005/082023.
[0062] In yet other embodiments, the linker comprises a glucuronyl group that is cleavable by glucoronidase present on the cell surface or the extracellular region of the target tissue. It has been shown that lysosomal beta-glucuronidase is liberated extracellularly in high local concentrations in necrotic areas in human cancers, and that this provides a route to targeted chemotherapy (Bosslet, K. et al. Cancer Res. 58, 1195-1201 (1998)).
[0063] In any of the above embodiments, the moiety B suitably further comprises a spacer unit. A spacer unit can be the unit B.sub.S, which may be linked to the binding moiety A, for example via an amide, amine or thioether bond. The spacer unit is of a length that enables e.g. the cleavable peptide sequence to be contacted by the cleaving enzyme (e.g. cathepsin B) and suitably also the hydrolysis of the amide bond coupling the cleavable peptide to the self-immolative moiety X. Spacer units may for example comprise a divalent radical such as alkylene, arylene, a heteroarylene, repeating units of alkyloxy (e.g. polyethylenoxy, PEG, polymethyleneoxy) and alkylamino (e.g. polyethyleneamino), or diacid ester and amides including succinate, succinamide, diglycolate, malonate, and caproamide.
[0064] In any of the embodiments described therein, * represents a point of attachment to moiety A or a point of attachment for which the shortest path to moiety A comprises less atoms than that for •, as the case may be; and • represents a point of attachment a point of attachment to moiety C or a point of attachment to moiety C for which the shortest path to moiety C comprises less atoms than that for *, as the case may be. The same applies also for cases where a reactive moiety L is present rather than payload moiety C. The following notations and all have the meaning of a point of attachment of a certain group or atom (e.g., R) to a further moiety:
##STR00016##
[0065] If the structure of relevance is a peptide mono- or oligomer, each * represents a point of attachment for which the shortest path to moiety A comprises less atoms than that for •; and each • represents a point of attachment for which the shortest path to moiety C comprises less atoms than that for *, with the proviso that when n is >1 and a respective point of attachment is indicated on any one of R.sup.a, R.sup.b and R.sup.c, then it can be independently present in one or more of the peptide monomeric units, preferably in one peptide monomeric unit most distant from the other point of attachment indicated in the respective structure.
[0066] In any of the embodiments described herein, the terms “peptide”, “dipeptide”, “tripeptide”, “tetrapeptide” etc. refer to peptide mono- or oligomers having a backbone formed by proteinogenic and/or a non-proteinogenic amino acids. As used herein, the terms “aminoacyl” or “aminoacid” generally refer to any proteinogenic or a non-proteinogenic amino acid. Preferably, in any of the embodiments disclosed therein, the side-chain residues of a proteinogenic or a non-proteinogenic amino acid are represented by any of R.sup.a, R.sup.b and R.sup.c, each of which is selected from the following list:
##STR00017## ##STR00018##
wherein each of R, R.sup.1, R.sup.2 and R.sup.3 is independently selected from H, OH, SH, NH.sub.2, halogen, cyano, carboxy, alkyl, cycloalkyl, aryl and heteroaryl, each of which is substituted or unsubstituted;
each X is independently selected from NH, NR, S, O and CH.sub.2, preferably NH; and
each n and m is independently an integer preferably selected from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20.
[0067] Preferably, in any of the embodiments disclosed therein, side-chain residues of a proteinogenic or a non-proteinogenic amino acid are represented by any of R.sup.a, R.sup.b and R.sup.c,
each of which may be part of a 3-, 4-, 5-, 6- or 7-membered ring. For instance, the side chain alpha, beta and/or gamma position of said proteinogenic or non-proteinogenic amino acid can be part of a cyclic structure selected from an azetidine ring, pyrrolidine ring and a piperidine ring, such as in the following aminoacids (proline and hydroxyproline):
##STR00019##
or
each of which may independently be part of an unsaturated structure (i.e. wherein the H atom geminal to the respective group R.sup.a, R.sup.b and R.sup.c is absent), e.g.:
##STR00020##
[0068] Further preferable non-proteinogenic amino acids can be selected from the following list:
##STR00021##
[0069] Particularly preferred embodiments for the moiety B as well as the compound according to the present invention are shown in the appended claims.
[0070] Preferably, B is represented by any of the following general Formulae II-V, wherein:
##STR00022## [0071] each x is an integer independently selected from the range of 0 to 100, preferably 0 to 50, more preferably 0 to 30, yet more preferably selected from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20; [0072] each y is an integer independently selected from the range of 0 to 30, preferably selected from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20; [0073] each z is an integer independently selected from the range of 0 to 5, preferably selected from selected from 0, 1, 2, 3 and 4; and [0074] * represents a point of attachment to moiety A; and [0075] • represents a point of attachment to moiety C, wherein: [0076] (a) B.sub.S and/or B.sub.L is a group comprising or consisting of a structural unit independently selected from the group consisting of alkylene, cycloalkylene, arylalkylene, heteroarylalkylene, heteroalkylene, heterocycloalkylene, alkenylene, cycloalkenylene, arylalkenylene, heteroarylalkenylene, heteroalkenylene, heterocycloalenkylene, alkynylene, heteroalkynylene, arylene, heteroarylene, aminoacyl, oxyalkylene, aminoalkylene, diacid ester, dialkylsiloxane, amide, thioamide, thioether, thioester, ester, carbamate, hydrazone, thiazolidine, methylene alkoxy carbamate, disulfide, vinylene, imine, imidamide, phosphoramide, saccharide, phosphate ester, phosphoramide, carbamate, dipeptide, tripeptide, tetrapeptide, each of which is substituted or unsubstituted; and/or [0077] (b) B.sub.S and/or B.sub.L is a group comprising or consisting of a structural unit independently selected from the group consisting of:
##STR00023## ##STR00024## ##STR00025## ##STR00026## ##STR00027## ##STR00028## ##STR00029## ##STR00030## ##STR00031## [0078] wherein each of R, R.sup.1, R.sup.2 and R.sup.3 is independently selected from H, OH, SH, NH.sub.2, halogen, cyano, carboxy, alkyl, cycloalkyl, aryl and heteroaryl, each of which is substituted or unsubstituted; [0079] each of R.sup.4 and R.sup.5 is independently selected from alkyl, cycloalkyl, aryl and heteroaryl, each of which is substituted or unsubstituted; [0080] each of R.sup.a, R.sup.b and R.sup.c is independently selected from side-chain residues of a proteinogenic or a non-proteinogenic amino acid, each of which can be further substituted; [0081] each X is independently selected from NH, NR, S, O and CH.sub.2, preferably NH; [0082] each of n and m is independently an integer from 0 to 100, preferably 0 to 50, more preferably 0 to 30, yet more preferably selected from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20; and [0083] wherein each * represents a point of attachment for which the shortest path to moiety A comprises less atoms than that for •; and each • represents a point of attachment for which the shortest path to moiety C comprises less atoms than that for *; and/or [0084] (c) one or more B.sub.L independently comprises or consists of one or more of the following structural units:
##STR00032## ##STR00033## [0085] wherein in each of the above structures, n is 1, 2, 3 or 4; and [0086] each * represents a point of attachment for which the shortest path to moiety A comprises less atoms than that for •; and each • represents a point of attachment for which the shortest path to moiety C comprises less atoms than that for *, with the proviso that when n is >1 and a respective point of attachment is indicated on any one of R.sup.a, R.sup.b and R.sup.c, then it can be independently present in one or more of the peptide monomeric units, preferably in one peptide monomeric unit most distant from the other point of attachment indicated in the respective structure; and/or [0087] (d) one or more of B.sub.L and B.sub.S is independently selected from the following structures:
##STR00034## [0088] wherein each * represents a point of attachment for which the shortest path to moiety A comprises less atoms than that for •; and each • represents a point of attachment for which the shortest path to moiety C comprises less atoms than that for *; and/or [0089] (e) y is 1, 2 or 3; and/or at least one B.sub.L further comprises a cleavable linker group independently selected from the following structures:
##STR00035## [0090] each * represents a point of attachment for which the shortest path to moiety A comprises less atoms than that for •; and each • represents a point of attachment for which the shortest path to moiety C comprises less atoms than that for *
[0091] Preferably, B may be defined as above and/or have the following structure:
##STR00036## [0092] wherein B′.sub.S and B″.sub.S are each independently selected from the group consisting of:
##STR00037## [0093] each B.sub.L is independently selected from the group consisting of:
##STR00038## ##STR00039## ##STR00040## [0094] each n is 0, 1, 2, 3, 4 or 5; [0095] each m is 0, 1, 2, 3, 4 or 5; [0096] each x′ is 0, 1 or 2; [0097] each x″ is 0, 1 or 2; [0098] each y is 0, 1 or 2; and [0099] z is 1 or 2, [0100] wherein R, R.sup.1, R.sup.2, R.sup.3, R.sup.a, R.sup.b, R, X, * and • are as defined above.
[0101] More preferably, the compound according the invention has a structure represented by one of the following formulae:
##STR00041## ##STR00042## ##STR00043## ##STR00044## ##STR00045## ##STR00046##
Moiety C
[0102] Moiety C in the present invention represents a payload, which can be generally any atom (including H), molecule or particle. Preferably, moiety C is not a hydrogen atom.
[0103] The payload may be a chelator for radiolabelling. Suitably the radionuclide is not released. Chelators are well known to those skilled in the art, and for example, include chelators such as sulfur colloid, diethylenetriaminepentaacetic acid (DTPA), ethylenediaminetetraacetic acid (EDTA), 1,4,7,10-tetraazacyclododecane-N,N′,N″,N′″-tetraacetic acid (DOTA), 1,4,7,10-tetraazacyclododececane,N-(glutaric acid)-N′,N″,N′″-triacetic acid (DOTAGA), 1,4,7-triazacyclononane-N,N′,N″-triacetic acid (NOTA), 1,4,8,11-tetraazacyclotetradecane-N,N′,N″,N′″-tetraacetic acid (TETA), or any of the preferred chelator structures recited in the appended claims.
[0104] The payload may be a radioactive group comprising or consisting of radioisotope including isotopes such as .sup.223Ra, .sup.89Sr, .sup.94mTc, .sup.99mTc, .sup.186Re .sup.188Re, .sup.203Pb, .sup.67Ga, .sup.68Ga, .sup.47Sc, .sup.111In, .sup.97Ru, .sup.62Cu, .sup.64Cu, .sup.86Y, .sup.88Y, .sup.90Y, .sup.121Sn, .sup.161Tb, .sup.153Sm, .sup.166Ho, .sup.105Rh, .sup.177Lu, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.18F, .sup.211At, .sup.225Ac, .sup.89Sr, .sup.225Ac, .sup.117Sn and .sup.169E. Preferably, positron emitters, such as .sup.18F and .sup.124I, or gamma emitters, such as .sup.99mTc, .sup.111In and .sup.123I, are used for diagnostic applications (e.g. for PET), while beta-emitters, such as .sup.84Sr, .sup.131I, and .sup.177Lu, are preferably used for therapeutic applications. Alpha-emitters, such as .sup.211At, .sup.225Ac and .sup.223Ra may also be used for therapy. In one preferred embodiment the radioisotope is .sup.89Sr or .sup.223Ra. In a further preferred embodiment the radioisotope is .sup.68Ga.
[0105] The payload may be a chelate of a radioactive isotope, preferably of an isotope listed under above, with a chelating agent, preferably a chelating agent listed above or any of the preferred chelator structures recited in the appended claim 9 (a); or a group selected from the structures listed in claim 9 (c).
[0106] The payload may be a fluorophore group, preferably selected from a xanthene dye, acridine dye, oxazine dye, cyanine dye, styryl dye, coumarine dye, porphine dye, fluorescent metal-ligand-complex, fluorescent protein, nanocrystals, perylene dye, boron-dipyrromethene dye and phtalocyanine dye, more preferably selected from the structures listed in claim 9 (d).
[0107] The payload may be a cytotoxic and/or cytostatic agent. Such agents can inhibit or prevent the function of cells and/or cause destruction of cells. Examples of cytotoxic agents include radioactive isotopes, chemotherapeutic agents, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including synthetic analogues and derivatives thereof. The cytotoxic agent may be selected from the group consisting of an auristatin, a DNA minor groove binding agent, a DNA minor groove alkylating agent, an enediyne, a lexitropsin, a duocarmycin, a taxane, a puromycin, a dolastatin, a maytansinoid and a vinca alkaloid or a combination of two or more thereof. Preferred cytotoxic and/or cytostatic payload moieties are listed in claim 9 (e).
[0108] In one embodiment the payload is a chemotherapeutic agent selected from the group consisting of a topoisomerase inhibitor, an alkylating agent (e.g., nitrogen mustards; ethylenimes; alkylsulfonates; triazenes; piperazines; and nitrosureas), an antimetabolite (e.g., mercaptopurine, thioguanine, 5-fluorouracil), an antibiotics (e.g., anthracyclines, dactinomycin, bleomycin, adriamycin, mithramycin. dactinomycin) a mitotic disrupter (e.g., plant alkaloids—such as vincristine and/or microtubule antagonists—such as paclitaxel), a DNA methylating agent, a DNA intercalating agent (e.g., carboplatin and/or cisplatin, daunomycin and/or doxorubicin and/or bleomycin and/or thalidomide), a DNA synthesis inhibitor, a DNA-RNA transcription regulator, an enzyme inhibitor, a gene regulator, a hormone response modifier, a hypoxia-selective cytotoxin (e.g., tirapazamine), an epidermal growth factor inhibitor, an anti-vascular agent (e.g., xanthenone 5,6-dimethylxanthenone-4-acetic acid), a radiation-activated prodrug (e.g., nitroarylmethyl quaternary (NMQ) salts) or a bioreductive drug or a combination of two or more thereof. In some embodiments, the payload (i.e., moiety C) is not derived from an anthracycline, preferably not derived from PNU 159682.
[0109] The chemotherapeutic agent may selected from the group consisting of Erlotinib (TARCEVA®), Bortezomib (VELCADE®), Fulvestrant (FASLODEX®), Sutent (SU11248), Letrozole (FEMARA®), Imatinib mesylate (GLEEVEC®), PTK787/ZK 222584, Oxaliplatin (Eloxatin®.), 5-FU (5-fluorouracil), Leucovorin, Rapamycin (Sirolimus, RAPAMUNE®.), Lapatinib (GSK572016), Lonafarnib (SCH 66336), Sorafenib (BAY43-9006), and Gefitinib (IRESSA®.), AG1478, AG1571 (SU 5271; Sugen) or a combination of two or more thereof.
[0110] The chemotherapeutic agent may be an alkylating agent—such as thiotepa, CYTOXAN® and/or cyclosphosphamide; an alkyl sulfonate—such as busulfan, improsulfan and/or piposulfan; an aziridine—such as benzodopa, carboquone, meturedopa and/or uredopa; ethylenimines and/or methylamelamines—such as altretamine, triethylenemelamine, triethylenepbosphoramide, triethylenethiophosphoramide and/or trimethylomelamine; acetogenin—such as bullatacin and/or bullatacinone; camptothecin; bryostatin; callystatin; cryptophycins; dolastatin; duocarmycin; eleutherobin; pancratistatin; sarcodictyin; spongistatin; nitrogen mustards—such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide and/or uracil mustard; nitrosureas—such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and/or ranimnustine; dynemicin; bisphosphonates—such as clodronate; an esperamicin; a neocarzinostatin chromophore; aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN®. doxorubicin—such as morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and/or deoxydoxorubicin, epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins—such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites—such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues—such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogues—such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogues—such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens—such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals—such as aminoglutethimide, mitotane, trilostane; folic acid replenisher—such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; macrocyclic depsipeptides such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2′,2″-trichlorotriethylamine; trichothecenes—such as verracurin A, roridin A and/or anguidine; urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside; cyclophosphamide; thiotepa; taxoids—such as TAXOL®. paclitaxel, abraxane, and/or TAXOTERE®, doxetaxel; chloranbucil; GEMZAR®. gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogues—such as cisplatin and carboplatin; vinblastine; platinum; etoposide; ifosfamide; mitoxantrone; vincristine; NAVELBINE®, vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; topoisomerase inhibitor RFS 2000; difluoromethylomithine (DMFO); retinoids—such as retinoic acid; capecitabine; and pharmaceutically acceptable salts, acids, derivatives or combinations of two or more of any of the above.
[0111] The payload may be a tubulin disruptor including but are not limited to: taxanes—such as paclitaxel and docetaxel, vinca alkaloids, discodermolide, epothilones A and B, desoxyepothilone, cryptophycins, curacin A, combretastatin A-4-phosphate, BMS 247550, BMS 184476, BMS 188791; LEP, RPR 109881A, EPO 906, TXD 258, ZD 6126, vinflunine, LU 103793, dolastatin 10, E7010, T138067 and T900607, colchicine, phenstatin, chalcones, indanocine, T138067, oncocidin, vincristine, vinblastine, vinorelbine, vinflunine, halichondrin B, isohomohalichondrin B, ER-86526, pironetin, spongistatin 1, spiket P, cryptophycin 1, LU103793 (cematodin or cemadotin), rhizoxin, sarcodictyin, eleutherobin, laulilamide, VP-16 and D-24851 and pharmaceutically acceptable salts, acids, derivatives or combinations of two or more of any of the above.
[0112] The payload may be a DNA intercalator including but are not limited to: acridines, actinomycins, anthracyclines, benzothiopyranoindazoles, pixantrone, crisnatol, brostallicin, CI-958, doxorubicin (adriamycin), actinomycin D, daunorubicin (daunomycin), bleomycin, idarubicin, mitoxantrone, cyclophosphamide, melphalan, mitomycin C, bizelesin, etoposide, mitoxantrone, SN-38, carboplatin, cis-platin, actinomycin D, amsacrine, DACA, pyrazoloacridine, irinotecan and topotecan and pharmaceutically acceptable salts, acids, derivatives or combinations of two or more of any of the above.
[0113] The payload may be an anti-hormonal agent that acts to regulate or inhibit hormone action on tumours—such as anti-estrogens and selective estrogen receptor modulators, including, but not limited to, tamoxifen, raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and/or fareston toremifene and pharmaceutically acceptable salts, acids, derivatives or combinations of two or more of any of the above. The payload may be an aromatase inhibitor that inhibits the enzyme aromatase, which regulates estrogen production in the adrenal glands—such as, for example, 4(5)-imidazoles, aminoglutethimide, megestrol acetate, AROMASIN®. exemestane, formestanie, fadrozole, RIVISOR®. vorozole, FEMARA®. letrozole, and ARIMIDEX® and/or anastrozole and pharmaceutically acceptable salts, acids, derivatives or combinations of two or more of any of the above.
[0114] The payload may be an anti-androgen such as flutamide, nilutamide, bicalutamide, leuprolide, goserelin and/or troxacitabine and pharmaceutically acceptable salts, acids, derivatives or combinations of two or more of any of the above.
[0115] The payload may be a protein or an antibody. Preferably, the payload is a cytokine (e.g., an interleukin such as IL2, IL10, IL12, IL15; a member of the TNF superfamily; or an interferon such as interferon gamma.).
[0116] Any payload may be used in unmodified or modified form. Combinations of payloads in which some are unmodified and some are modified may be used. For example, the payload may be chemically modified. One form of chemical modification is the derivatisation of a carbonyl group—such as an aldehyde.
[0117] In a preferred embodiment, moiety C is an auristatin (i.e., having a structure derived from an auristatin compound family member) or an auristatin derivative. More preferably, moiety C has a structure according to the following formula:
##STR00047##
wherein:
R.sup.1d is independently H or C.sub.1-C.sub.6 alkyl; preferably H or CH.sub.3;
R.sup.2d is independently C.sub.1-C.sub.6 alkyl; preferably CH.sub.3 or iPr;
R.sup.3d is independently H or C.sub.1-C.sub.6 alkyl; preferably H or CH.sub.3;
R.sup.4d is independently H, C.sub.1-C.sub.6 alkyl, COO(C.sub.1-C.sub.6 alkyl), CON(H or C.sub.1-C.sub.6 alkyl), C.sub.3-C.sub.10 aryl or C.sub.3-C.sub.10 heteroaryl; preferably H, CH.sub.3, COOH, COOCH.sub.3 or thiazolyl;
R.sup.5d is independently H, OH, C.sub.1-C.sub.6 alkyl; preferably H or OH; and
R.sup.6d is independently C.sub.3-C.sub.10 aryl or C.sub.3-C.sub.10 heteroaryl; preferably optionally substituted phenyl or pyridyl.
[0118] More preferably, moiety C is derived from MMAE or MMAF.
[0119] In a preferred embodiment, moiety C has a structure according to the following formula:
##STR00048##
wherein:
n is 0, 1, 2, 3, 4 or 5; preferably 1;
R.sup.1e is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH;
R.sup.2e is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH;
each R.sup.3e is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH;
R.sup.4e is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH; and
X is O, NH or S; preferably O.
[0120] In a preferred embodiment, moiety C has a structure according to the following formula:
##STR00049##
wherein:
n is 0, 1, 2, 3, 4 or 5; preferably 1
R.sup.1f is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH;
R.sup.2f is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH;
R.sup.3f is independently H, COOH, aryl-COOH or heteroaryl-COOH; preferably COOH; and
X is O, NH or S; preferably O
[0121] Particularly preferred embodiments for the moiety C as well as the compound according to the present invention are shown in the appended claims.
[0122] Preferred compounds are those having a structure according to Table 2 or 3, their individual diastereoisomers, hydrates, solvates, crystal forms, individual tautomers or pharmaceutically acceptable salts thereof.
Further Aspects
[0123] In one aspect, herein disclosed a compound of the general Formula I as defined above, its individual diastereoisomers, its hydrates, its solvates, its crystal forms, its individual tautomers or a pharmaceutically acceptable salt thereof, wherein: A is a binding moiety having the structure as defined above; B is a covalent bond or a moiety comprising a chain of atoms that covalently attaches the moieties A und C; and C is a payload moiety.
[0124] In one further aspect, B is represented by any of the general Formulae II-V as defined above, wherein each B.sub.S independently represents a spacer group; each B.sub.L independently represents a cleavable or non-cleavable linker group; each x is an integer independently selected from the range of 0 to 100, preferably 0 to 50, more preferably 0 to 30, yet more preferably selected from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20; each y is an integer independently selected from the range of 0 to 30, preferably selected from 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and 20; each z is an integer independently selected from the range of 0 to 5, preferably selected from selected from 0, 1, 2, 3 and 4; and * represents a point of attachment to moiety A; and • represents a point of attachment to moiety C.
[0125] In one further aspect according to any of the preceding aspects, the binding moiety has the structure A.sup.1 as defined above.
[0126] In one further aspect according to any of the preceding aspects, B.sub.S and/or B.sub.L is a group comprising or consisting of a structural unit independently selected from the group consisting of alkylene, cycloalkylene, arylalkylene, heteroarylalkylene, heteroalkylene, heterocycloalkylene, alkenylene, cycloalkenylene, arylalkenylene, heteroarylalkenylene, heteroalkenylene, heterocycloalenkylene, alkynylene, heteroalkynylene, arylene, heteroarylene, aminoacyl, oxyalkylene, aminoalkylene, diacid ester, dialkylsiloxane, amide, thioamide, thioether, thioester, ester, carbamate, hydrazone, thiazolidine, methylene alkoxy carbamate, disulfide, vinylene, imine, imidamide, phosphoramide, saccharide, phosphate ester, phosphoramide, carbamate, dipeptide, tripeptide, tetrapeptide, each of which is substituted or unsubstituted.
[0127] In one further aspect according to any of the preceding aspects, B.sub.S and/or B.sub.L is a group defined as in appended claim 5 (b). In one preferred aspect according to any of the preceding aspects, one or more B.sub.L are defined as in appended claim 5 (c). In one preferred aspect according to any of the preceding aspects, one or more of B.sub.L and B.sub.S is defined as in appended claim 5 (d). In one preferred aspect according to any of the preceding aspects, y is 1, 2 or 3; and/or at least one B.sub.L defined as in appended claim 5 (e). In one preferred aspect according to any of the preceding aspects, B is defined as in appended claim 6.
[0128] In one further aspect according to any of the preceding aspects, compound is defined as in appended claim 7.
[0129] In one further aspect according to any of the preceding aspects, the moiety C is as defined in appended claim 8 and/or 9.
[0130] In one further aspect according to any of the preceding aspects, the compound having a structure selected from the following: Conjugate 1; Conjugate 2; Conjugate 3; Conjugate 4; Conjugate 5; Conjugate 6; Conjugate 7; Conjugate 8; Conjugate 9; Conjugate 10; Conjugate 11; Conjugate 12; Conjugate 13; Conjugate 14; Conjugate 15; and ESV6-fluo.
[0131] Also disclosed is a pharmaceutical composition comprising the compound according to any of the preceding aspects, and a pharmaceutically acceptable excipient. Such pharmaceutical composition is also disclosed for use in: (a) a method for treatment of the human or animal body by surgery or therapy or a diagnostic method practised on the human or animal body; or (b) a method for therapy or prophylaxis of a subject suffering from or having risk for a disease or disorder; or (c) a method for guided surgery practised on a subject suffering from or having risk for a disease or disorder; or (d) a method for diagnosis of a disease or disorder, the method being practised on the human or animal body and involving a nuclear medicine imaging technique, such as Positron Emission Tomography (PET) or Single Photon Emission Computed Tomography (SPECT); or (e) a method for targeted delivery of a therapeutic or diagnostic agent to a subject suffering from or having risk for a disease or disorder, wherein in each of the preceding (b)-(e), said disease or disorder is independently selected from cancer, inflammation, atherosclerosis, fibrosis, tissue remodelling and keloid disorder, preferably wherein the cancer is selected from the group consisting of breast cancer, pancreatic cancer, small intestine cancer, colon cancer, multi-drug resistant colon cancer, rectal cancer, colorectal cancer, metastatic colorectal cancer, lung cancer, non-small cell lung cancer, head and neck cancer, ovarian cancer, hepatocellular cancer, oesophageal cancer, hypopharynx cancer, nasopharynx cancer, larynx cancer, myeloma cells, bladder cancer, cholangiocarcinoma, clear cell renal carcinoma, neuroendocrine tumour, oncogenic osteomalacia, sarcoma, CUP (carcinoma of unknown primary), thymus cancer, desmoid tumours, glioma, astrocytoma, cervix cancer and prostate cancer; preferably wherein the compound has a prolonged residence at the disease site at a therapeutically or diagnostically relevant level, preferably beyond 1 h, more preferably beyond 6 h post injection.
Treatment
[0132] The compounds described herein may be used to treat disease. The treatment may be therapeutic and/or prophylactic treatment, with the aim being to prevent, reduce or stop an undesired physiological change or disorder. The treatment may prolong survival as compared to expected survival if not receiving treatment.
[0133] The disease that is treated by the compound may be any disease that might benefit from treatment. This includes chronic and acute disorders or diseases including those pathological conditions which predispose to the disorder.
[0134] The term “cancer” and “cancerous” is used in its broadest sense as meaning the physiological condition in mammals that is typically characterized by unregulated cell growth. A tumour comprises one or more cancerous cells.
[0135] When treating cancer, the therapeutically effect that is observed may be a reduction in the number of cancer cells; a reduction in tumour size; inhibition or retardation of cancer cell infiltration into peripheral organs; inhibition of tumour growth; and/or relief of one or more of the symptoms associated with the cancer.
[0136] In animal models, efficacy may be assessed by physical measurements of the tumour during the treatment, and/or by determining partial and complete remission of the cancer. For cancer therapy, efficacy can, for example, be measured by assessing the time to disease progression (TTP) and/or determining the response rate (RR).
[0137] Particularly preferred embodiments for the methods of treatment related to the present invention are shown in the appended claims.
[0138] Herein disclosed are also methods for treatment of the human or animal body, e.g., by surgery or therapy, or diagnostic method practised on the human or animal body, the methods involving a step of administering a therapeutically or diagnostically effective amount of a compound or a pharmaceutical composition as described herein to a subject in need thereof. More specifically, herein disclosed are methods for treatment, e.g., by therapy or prophylaxis, of a subject suffering from or having risk for a disease or disorder; or by guided surgery practised on a subject suffering from or having risk for a disease or disorder; method for diagnosis of a disease or disorder, e.g., diagnostic method practised on the human or animal body and/or involving a nuclear medicine imaging technique, such as Positron Emission Tomography (PET) or Single Photon Emission Computed Tomography (SPECT); method for targeted delivery of a therapeutic or diagnostic agent to a subject suffering from or having risk for a disease or disorder. In the aforementioned methods, said disease or disorder may be independently selected from cancer, inflammation, atherosclerosis, fibrosis, tissue remodelling and keloid disorder, preferably wherein the cancer is selected from the group consisting of breast cancer, pancreatic cancer, small intestine cancer, colon cancer, multi-drug resistant colon cancer, rectal cancer, colorectal cancer, metastatic colorectal cancer, lung cancer, non-small cell lung cancer, head and neck cancer, ovarian cancer, hepatocellular cancer, oesophageal cancer, hypopharynx cancer, nasopharynx cancer, larynx cancer, myeloma cells, bladder cancer, cholangiocarcinoma, clear cell renal carcinoma, neuroendocrine tumour, oncogenic osteomalacia, sarcoma, CUP (carcinoma of unknown primary), thymus cancer, desmoid tumours, glioma, astrocytoma, cervix cancer, skin cancer, kidney cancer and prostate cancer. When used in the methods disclosed herein, the compound has a prolonged residence at the disease site at a therapeutically or diagnostically relevant level, preferably beyond 1 h, more preferably beyond 6 h post injection.
Pharmaceutical Compositions
[0139] The compounds described herein may be in the form of pharmaceutical compositions which may be for human or animal usage in human and veterinary medicine and will typically comprise any one or more of a pharmaceutically acceptable diluent, carrier, or excipient. Acceptable carriers or diluents for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985). The choice of pharmaceutical carrier, excipient or diluent can be selected with regard to the intended route of administration and standard pharmaceutical practice. The pharmaceutical compositions may comprise as—or in addition to—the carrier, excipient or diluent any suitable binder(s), lubricant(s), suspending agent(s), coating agent(s), solubilising agent(s).
[0140] Preservatives, stabilisers, dyes and even flavouring agents may be provided in the pharmaceutical composition. Examples of preservatives include sodium benzoate, sorbic acid and esters of p-hydroxybenzoic acid. Antioxidants and suspending agents may be also used.
[0141] There may be different composition/formulation requirements dependent on the different delivery systems. By way of example, the pharmaceutical composition may be formulated to be administered using a mini-pump or by a mucosal route, for example, as a nasal spray or aerosol for inhalation or ingestable solution, or parenterally in which the composition is formulated by an injectable form, for delivery, by, for example, an intravenous, intramuscular or subcutaneous route. Alternatively, the formulation may be designed to be administered by a number of routes.
[0142] If the agent is to be administered mucosally through the gastrointestinal mucosa, it should be able to remain stable during transit though the gastrointestinal tract; for example, it should be resistant to proteolytic degradation, stable at acid pH and resistant to the detergent effects of bile.
[0143] Where appropriate, the pharmaceutical compositions may be administered by inhalation, in the form of a suppository or pessary, topically in the form of a lotion, solution, cream, ointment or dusting powder, by use of a skin patch, orally in the form of tablets containing excipients such as starch or lactose, or in capsules or ovules either alone or in admixture with excipients, or in the form of elixirs, solutions or suspensions containing flavouring or colouring agents, or the pharmaceutical compositions can be injected parenterally, for example, intravenously, intramuscularly or subcutaneously. For parenteral administration, the compositions may be best used in the form of a sterile aqueous solution which may contain other substances, for example, enough salts or monosaccharides to make the solution isotonic with blood. For buccal or sublingual administration, the compositions may be administered in the form of tablets or lozenges which can be formulated in a conventional manner.
[0144] The compound of the present invention may be administered in the form of a pharmaceutically acceptable or active salt. Pharmaceutically-acceptable salts are well known to those skilled in the art, and for example, include those mentioned by Berge et al, in J. Pharm. Sci., 66, 1-19 (1977). Salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucaronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate, and pamoate (i.e., 1,1′-methylene-bis-(2-hydroxy-3-naphthoate)) salts.
[0145] The routes for administration (delivery) may include, but are not limited to, one or more of oral (e.g. as a tablet, capsule, or as an ingestable solution), topical, mucosal (e.g. as a nasal spray or aerosol for inhalation), nasal, parenteral (e.g. by an injectable form), gastrointestinal, intraspinal, intraperitoneal, intramuscular, intravenous, intrauterine, intraocular, intradermal, intracranial, intratracheal, intravaginal, intracerebroventricular, intracerebral, subcutaneous, ophthalmic (including intravitreal or intracameral), transdermal, rectal, buccal, vaginal, epidural, sublingual.
[0146] Typically, a physician will determine the actual dosage which will be most suitable for an individual subject. The specific dose level and frequency of dosage for any particular patient may be varied and will depend upon a variety of factors including the activity of the specific compound employed, the metabolic stability and length of action of that compound, the age, body weight, general health, sex, diet, mode and time of administration, rate of excretion, drug combination, the severity of the particular condition, and the individual undergoing therapy.
[0147] The formulations may be packaged in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example water, for administration. Extemporaneous injection solutions and suspensions are prepared from sterile powders, granules and tablets of the kind previously described. Exemplary unit dosage formulations contain a daily dose or unit daily sub-dose, or an appropriate fraction thereof, of the active ingredient.
Precursor Compounds
[0148] In one aspect of the invention, herein disclosed is a compound, its individual diastereoisomers, its hydrates, its solvates, its crystal forms, its individual tautomers or a salt thereof, wherein the compound (precursor compound) comprises a moiety A and a reactive moiety L capable of reacting and forming a covalent bond with a conjugation partner. Upon conjugation (i.e., reacting and forming a covalent bond), the former precursor compound is bound to the former conjugation partner, which in turn to a payload moiety C. The conjugation partner can be an atom, a molecule, a particle, a therapeutic agent and/or diagnostic agent. Preferably, the conjugation is a therapeutic agent and/or diagnostic agent, and can correspond to the payload moieties already described in detail above with respect to the conjugates according to the invention.
[0149] Preferably, the precursor compound comprises a moiety having the structure:
##STR00050##
wherein B is a covalent bond or a moiety comprising a chain of atoms covalently bound atoms.
[0150] The precursor compound can be represented by the following Formula VI:
##STR00051##
wherein B is a covalent bond or a moiety comprising a chain of atoms covalently attaching A to L.
[0151] Moiety A preferably has the structure A.sup.1 or A.sup.2, wherein m is 0, 1, 2, 3, 4 or 5.
[0152] Moiety B preferably has the same structure as described in detail above with respect to the conjugates according to the invention.
[0153] Moiety L is preferably capable of forming, upon reacting, an amide, ester, carbamate, hydrazone, thiazolidine, methylene alkoxy carbamate, disulphide, alkylene, cycloalkylene, arylalkylene, heteroarylalkylene, heteroalkylene, heterocycloalkylene, alkenylene, cycloalkenylene, arylalkenylene, heteroarylalkenylene, heteroalkenylene, heterocycloalenkylene, alkynylene, heteroalkynylene, arylene, heteroarylene, aminoacyl, oxyalkylene, aminoalkylene, diacid ester, dialkylsiloxane, amide, thioamide, thioether, thioester, ester, carbamate, hydrazone, thiazolidine, methylene alkoxy carbamate, disulfide, vinylene, imine, imidamide, phosphoramide, saccharide, phosphate ester, phosphoramide, carbamate, dipeptide, tripeptide or tetrapeptide linking group. As will be appreciated by a person skilled in the art, multiple possibilities exist how to provide a reactive group capable of reacting with a conjugation partner to form a linking group according to the aforementioned list, and they are all encompassed by the present disclosure.
[0154] The moiety B may be cleavable or non-cleavable, bifunctional or multifunctional moiety which can be used to link one or more reactive and/or binder moieties to form the conjugate precursor of the invention. In some embodiments, the structure of the compound comprises, independently, more than one moieties A, preferably 2, 3, 4, 5, 6, 7, 8, 9 or 10 moieties A; and/or more than one moieties L, preferably 2, 3, 4, 5, 6, 7, 8, 9 or 10 moieties L per molecule. Preferably, the structure of the compound comprises 2 moieties A and 1 moiety L; or 1 moiety A and 2 moieties L per molecule.
[0155] Moiety L is preferably selected from: H, NH.sub.2, N.sub.3, COOH, SH, Hal,
##STR00052## ##STR00053##
wherein each n is, independently, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10; each m is, independently, 0, 1, 2, 3, 4 or 5; each Hal is F, Cl, Br or I; and each R.sup.4 is, independently selected from carboxy, alkyl, cycloalkyl, aryl and heteroaryl, wherein each of the foregoing is substituted or unsubstituted, halogen, and cyano.
[0156] Preferred compounds are those having a structure according to Table 3, their individual diastereoisomers, hydrates, solvates, crystal forms, individual tautomers or salts thereof.
Methods for Preparing a Conjugate
[0157] In one aspect of the invention, herein disclosed is a method for preparing a conjugate comprising the step of conjugating with a precursor compound as described above with a conjugation partner. Preferably, the precursor compound is conjugated to the conjugation partner by reacting therewith to form a covalent bond. Preferably, the thus obtained conjugate is a conjugate compound as described elsewhere in the present specification.
[0158] The conjugation partner can be an atom, a molecule, a particle, a therapeutic agent and/or diagnostic agent. Preferably, the conjugation is a therapeutic agent and/or diagnostic agent, and can correspond to the payload moieties already described in detail above with respect to the conjugates according to the invention.
[0159] Preferably, the method further comprises formulating the conjugate as a pharmaceutical composition or as a diagnostic composition. The pharmaceutical or diagnostic compositions may be for human or animal usage in human and veterinary medicine and will typically comprise any one or more of a pharmaceutically acceptable diluent, carrier, or excipient. Acceptable carriers or diluents for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985). The choice of carrier, excipient or diluent can be selected with regard to the intended route of administration and standard pharmaceutical practice. The pharmaceutical or diagnostic compositions may comprise as—or in addition to—the carrier, excipient or diluent any suitable binder(s), lubricant(s), suspending agent(s), coating agent(s), solubilising agent(s). All formulation details and aspects disclosed above in the section “Pharmaceutical compositions” fully apply here too.
General Techniques
[0160] The practice of the present invention employs, unless otherwise indicated, conventional methods of chemistry, biochemistry, molecular biology, cell biology, genetics, immunology and pharmacology, known to those of skill of the art. Such techniques are explained fully in the literature. See, e.g., Gennaro, A. R., ed. (1990) Remington's Pharmaceutical Sciences, 18th ed., Mack Publishing Co.; Hardman, J. G., Limbird, L. E., and Gilman, A. G., eds. (2001) The Pharmacological Basis of Therapeutics, 10th ed., McGraw-Hill Co.; Colowick, S. et al., eds., Methods In Enzymology, Academic Press, Inc.; Weir, D. M., and Blackwell, C. C., eds. (1986) Handbook of Experimental Immunology, Vols. I-IV, Blackwell Scientific Publications; Maniatis, T. et al., eds. (1989) Molecular Cloning: A Laboratory Manual, 2nd edition, Vols. I-III, Cold Spring Harbor Laboratory Press; Ausubel, F. M. et al., eds. (1999) Short Protocols in Molecular Biology, 4th edition, John Wiley & Sons; Ream et al., eds. (1998) Molecular Biology Techniques: An Intensive Laboratory Course, Academic Press; Newton, C. R., and Graham, A., eds. (1997) PCR (Introduction to Biotechniques Series), 2nd ed., Springer Verlag.
Chemical Synthesis
[0161] The compounds described herein may be prepared by chemical synthesis techniques.
[0162] It will be apparent to those skilled in the art that sensitive functional groups may need to be protected and deprotected during synthesis of a compound. This may be achieved by conventional techniques, for example as described in “Protective Groups in Organic Synthesis” by T W Greene and P G M Wuts, John Wiley and Sons Inc. (1991), and by P. J. Kocienski, in “Protecting Groups”, Georg Thieme Verlag (1994).
[0163] It is possible during some of the reactions that any stereocentres present could, under certain conditions, be epimerised, for example if a base is used in a reaction with a substrate having an optical centre comprising a base-sensitive group. It should be possible to circumvent potential problems such as this by choice of reaction sequence, conditions, reagents, protection/deprotection regimes, etc. as is well-known in the art.
Definitions
[0164] Antibody. The term “antibody” is used in its broadest sense and covers monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies (e.g., bispecific antibodies), veneered antibodies, antibody fragments and small immune proteins (SIPs) (see Int. J. Cancer (2002) 102, 75-85). An antibody is a protein generated by the immune system that is capable of recognizing and binding to a specific antigen. A target antigen generally has numerous binding sites, also called epitopes, recognized by CDRs on multiple antibodies. Each antibody that specifically binds to a different epitope has a different structure. Thus, one antigen may have more than one corresponding antibody. An antibody includes a full-length immunoglobulin molecule or an immunologically active portion of a full-length immunoglobulin molecule, i.e. a molecule that contains an antigen binding site that immunospecifically binds an antigen of a target of interest or part thereof. The antibodies may be of any type—such as IgG, IgE, IgM, IgD, and IgA)—any class—such as IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2—or subclass thereof. The antibody may be or may be derived from murine, human, rabbit or from other species.
[0165] Antibody fragments. The term “antibody fragment” refers to a portion of a full length antibody, generally the antigen binding or variable region thereof. Examples of antibody fragments include, but are not limited to, Fab, Fab′, F(ab′).sub.2, and Fv fragments; diabodies; linear antibodies; single domain antibodies, including dAbs, camelid V.sub.HH antibodies and the IgNAR antibodies of cartilaginous fish. Antibodies and their fragments may be replaced by binding molecules based on alternative non-immunoglobulin scaffolds, peptide aptamers, nucleic acid aptamers, structured polypeptides comprising polypeptide loops subtended on a non-peptide backbone, natural receptors or domains thereof.
[0166] Derivative. A derivative includes the chemical modification of a compound. Examples of such modifications include the replacement of a hydrogen by a halo group, an alkyl group, an acyl group or an amino group and the like. The modification may increase or decrease one or more hydrogen bonding interactions, charge interactions, hydrophobic interactions, van der Waals interactions and/or dipole interactions.
[0167] Analog. This term encompasses any enantiomers, racemates and stereoisomers, as well as all pharmaceutically acceptable salts and hydrates of such compounds.
[0168] Unless otherwise stated, the following definitions apply to chemical terms used in connection of compounds of the invention and compositions containing such compounds.
[0169] Alkyl refers to a branched or unbranched saturated hydrocarbyl radical. Suitably, the alkyl group comprises from 1 to 100, preferably 3 to 30, carbon atoms, more preferably from 5 to 25 carbon atoms. Preferably, alkyl refers to methyl, ethyl, propyl, butyl, pentyl, or hexyl.
[0170] Alkenyl refers to a branched or unbranched hydrocarbyl radical containing one or more carbon-carbon double bonds. Suitably, the alkenyl group comprises from 2 to 30 carbon atoms, preferably from 5 to about 25 carbon atoms.
[0171] Alkynyl refers to a branched or unbranched hydrocarbyl radical containing one or more carbon-carbon triple bonds. Suitably, the alkynyl group comprises from about 3 to about 30 carbon atoms, for example from about 5 to about 25 carbon atoms.
[0172] Halogen refers to fluorine, chlorine, bromine or iodine, preferably fluorine or chlorine. Cycloalkyl refers to an alicyclic moiety, suitably having 3, 4, 5, 6, 7 or 8 carbon atoms. The group may be a bridged or polycyclic ring system. More often cycloalkyl groups are monocyclic. This term includes reference to groups such as cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, norbornyl, bicyclo[2.2.2]octyl and the like.
[0173] Aryl refers to an aromatic carbocyclic ring system, suitably comprising 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 ring carbon atoms. Aryl may be a polycyclic ring system, having two or more rings, at least one of which is aromatic. This term includes reference to groups such as phenyl, naphthyl fluorenyl, azulenyl, indenyl, anthryl and the like.
[0174] The prefix (hetero) herein signifies that one or more of the carbon atoms of the group may be substituted by nitrogen, oxygen, phosphorus, silicon or sulfur. Heteroalkyl groups include for example, alkyloxy groups and alkythio groups. Heterocycloalkyl or heteroaryl groups herein may have from 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 16 ring atoms, at least one of which is selected from nitrogen, oxygen, phosphorus, silicon and sulfur. In particular, a 3- to 10-membered ring or ring system and more particularly a 5- or 6-membered ring, which may be saturated or unsaturated. For example, selected from oxiranyl, azirinyl, 1,2-oxathiolanyl, imidazolyl, thienyl, furyl, tetrahydrofuryl, pyranyl, thiopyranyl, thianthrenyl, isobenzofuranyl, benzofuranyl, chromenyl, 2H-pyrrolyl, pyrrolyl, pyrrolinyl, pyrrolidinyl, imidazolyl, imidazolidinyl, benzimidazolyl, pyrazolyl, pyrazinyl, pyrazolidinyl, thiazolyl, isothiazolyl, dithiazolyl, oxazolyl, isoxazolyl, pyridyl, pyrazinyl, pyrimidinyl, piperidyl, piperazinyl, pyridazinyl, morpholinyl, thiomorpholinyl, especially thiomorpholino, indolizinyl, 1,3-Dioxo-1,3-dihydro-isoindolyl, 3H-indolyl, indolyl, benzimidazolyl, cumaryl, indazolyl, triazolyl, tetrazolyl, purinyl, 4H-quinolizinyl, isoquinolyl, quinolyl, tetrahydroquinolyl, tetrahydroisoquinolyl, decahydroquinolyl, octahydroisoquinolyl, benzofuranyl, dibenzofuranyl, benzothiophenyl, dibenzothiophenyl, phthalazinyl, naphthyridinyl, quinoxalyl, quinazolinyl, quinazolinyl, cinnolinyl, pteridinyl, carbazolyl, [beta]-carbolinyl, phenanthridinyl, acridinyl, perimidinyl, phenanthrolinyl, furazanyl, phenazinyl, phenothiazinyl, phenoxazinyl, chromenyl, isochromanyl, chromanyl, 3,4-dihydro-2H-isoquinolin-1-one, 3,4-dihydro-2H-isoquinolinyl, and the like.
[0175] “Substituted” signifies that one or more, especially up to 5, more especially 1, 2 or 3, of the hydrogen atoms in said moiety are replaced independently of each other by the corresponding number of substituents. The term “optionally substituted” as used herein includes substituted or unsubstituted. It will, of course, be understood that substituents are only at positions where they are chemically possible, the person skilled in the art being able to decide (either experimentally or theoretically) without inappropriate effort whether a particular substitution is possible. For example, amino or hydroxy groups with free hydrogen may be unstable if bound to carbon atoms with unsaturated (e.g. olefinic) bonds. Preferably, the term “substituted” signifies one or more, especially up to 5, more especially 1, 2 or 3, of the hydrogen atoms in said moiety are replaced independently of each other by the corresponding number of substituents selected from OH, SH, NH.sub.2, halogen, cyano, carboxy, alkyl, cycloalkyl, aryl and heteroaryl. Additionally, the substituents described herein may themselves be substituted by any substituent, subject to the aforementioned restriction to appropriate substitutions as recognised by the skilled person. Preferably, any of the aforementioned substituents may be further substituted by any of the aforementioned substituents, each of which may be further substituted by any of the aforementioned substituents.
[0176] Substituents may suitably include halogen atoms and halomethyl groups such as CF.sub.3 and CCl.sub.3; oxygen containing groups such as oxo, hydroxy, carboxy, carboxyalkyl, alkoxy, alkoyl, alkoyloxy, aryloxy, aryloyl and aryloyloxy; nitrogen containing groups such as amino, alkylamino, dialkylamino, cyano, azide and nitro; sulfur containing groups such as thiol, alkylthiol, sulfonyl and sulfoxide; heterocyclic groups which may themselves be substituted; alkyl groups, which may themselves be substituted; and aryl groups, which may themselves be substituted, such as phenyl and substituted phenyl. Alkyl includes substituted and unsubstituted benzyl.
[0177] Where two or more moieties are described as being “each independently” selected from a list of atoms or groups, this means that the moieties may be the same or different. The identity of each moiety is therefore independent of the identities of the one or more other moieties.
[0178] For ease of reference, numbers and structures of some compounds disclosed herein are summarised in the following Tables 2, 3 and 4. In case of doubt, the numbers and structures below control.
TABLE-US-00002 TABLE 2 # Structure 1
TABLE-US-00003 TABLE 3 # Structure P3
TABLE-US-00004 TABLE 4 # Structure H6
MATERIAL & METHODS
General Remarks and Procedures
[0179] Yields refer to chromatographically purified compounds.
[0180] Proton (1H) nuclear magnetic resonance (NMR) spectra were recorded on a Bruker AV400 (400 MHz) spectrometer. Shifts are given in ppm using residual solvent as the internal standard. Coupling constants (J) are reported in Hz with the following abbreviations used to indicate splitting: s=singlet, d=doublet, t=triplet, q=quartet, m=multiplet.
[0181] Mass Spectrometry (LC-ESI-MS) spectra were recorded on an Agilent 6100 Series Single Quadrupole MS System combined with an Agilent 1200 Series LC System, using an InfinityLab Poroshell 120 EC-C18 column, 4.6 min×56 mm at a flow rate of 2 mL min.sup.−1 with linear gradients of solvents A and B (A=Millipore water with 0.1% formic acid [FA], B=MeCN with 0.1% formic acid [FA]).
[0182] High-Resolution Mass Spectrometry (HRMS) spectra and analytical Reversed-Phase Ultra Performance Liquid Chromatography (UPLC) were recorded on a Waters Xevo G2-XS QTOF coupled to a Waters Acquity UPLC H-Class System with PDA UV detector, using a ACQUITY UPLC BEH C18 Column, 130 Å, 1.7 pm, 2.1 min×50 mm at a flow rate of 0.6 mL min.sup.−1 with linear gradients of solvents A and B (A=Millipore water with 0.1% FA, B=MeCN with 0.1% FA).
[0183] Preparative reversed-phase high-pressure liquid chromatography (RP-HPLC) was performed on an Agilent 1200 Series System, using a Phenomenex Gemini® 5 μm NX-C18 semipreparative column, 110 Å, 150 min×10 mm at a flow rate of 5 mL min.sup.−1 with linear gradients of solvents A and B (A=Millipore water with 0.1% trifluoroacetic acid [TFA], B=MeCN with 0.1% trifluoroacetic acid [TFA]).
Comparative Example 1: Synthesis of (S)—N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)-6-(3-(4-(3,6′-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9′-xanthene]-5-carbonyl)piperazin-1-yl)propoxy) quinoline-4-carboxamide (“HABERKORN-FLUO”, 23)
Step 1: 6-hydroxy-4-quinolinecarboxylic acid (H1)
[0184] A solution of 6-methoxyquinoline-carboxylic acid (250 mg, 1.08 mmol, 1.0 eq) in HBr 48 wt. % in H.sub.2O (5 mL) was heated at 130° C. for 2 h then concentrated under vacuum to obtain product as an orange powder (292 mg, 1.08 mmol, Quant. Yield). MS (ES+) m/z 271 (M+H).sup.+.
Step 2: 1-Boc-4-(3-hydroxypropyl)piperazine (H2)
[0185] Anhydrous K.sub.2CO.sub.3 (815 mg, 5.91 mmol, 1.1 eq) was added to a solution of 1-Boc-piperazine (1.0 g, 5.37 mmol, 1.0 eq) in dry THF (15 mL) followed by 3-Bromo-1-propanol (530 μL, 5.91 mmol, 1.1 eq) and the reaction mixture was stirred at room temperature for 72 h. Volatiles were removed under reduced pressure, the residue was diluted with water, extracted with EtOAc (twice) and the combined organic layers were dried over Na.sub.2SO.sub.4, filtered and concentrated. Crude was purified by flash chromatography (DCM/MeOH from 98:2 to 90:10) to give the title compound as a colourless oil (1.2 g, 4.91 mmol, 91% yield). MS (ES+) m/z 245 (M+H).sup.+.
Step 3: 3-(4-(tert-butoxycarbonyl)piperazin-1-yl)propyl 6-(3-(4-(tert-butoxycarbonyl) piperazin-1-yl)propoxy)quinoline-4-carboxylate (H3)
[0186] A stirred solution of H1 (100 mg, 0.37 mmol, 1.0 eq), H2 (180 mg, 0.74 mmol, 2.0 eq) and Triphenylphosphine (193 mg, 0.74 mmol, 2.0 eq) in dry THE (25 mL) was treated with Diisopropyl azodicarboxylate (DIAD; 145 μL, 0.74 mmol, 2.0 eq). The reaction was stirred at room temperature for 1 h then concentrated under vacuum and directly purified by flash chromatography (DCM/MeOH from 95:5 to 90:10) to give the title compound as a white powder (100 mg, 0.156 mmol, 42% yield). MS (ES.sup.+) m/z 642 (M+H).sup.+.
##STR00141##
Step 4: 6-(3-(4-tert-butoxycarbonylpiperazin-1-yl)propoxy)quinoline-4-carboxylic acid (H4)
[0187] To a stirred solution of H3 (100 mg, 0.156 mmol, 1.0 eq) in THF (5 mL), a solution of LiOH (13 mg, 0.312 mmol, 2.0 eq) in H.sub.2O (2 mL) was added and reaction stirred at room temperature for 2 h. The mixture was diluted with water, extracted with EtOAc, washed with NH.sub.4Cl s.s., dried over Na.sub.2SO.sub.4 and filtered to obtain product as a white powder (60 mg, 0.144 mmol, 92% yield). MS (ES.sup.+) m/z 416 (M+H).sup.+.
Step 5: 1-Piperazinecarboxylic acid, 4-[3-[[4-[[[2-[(2S)-2-cyano-4,4-difluoro-1-pyrrolidinyl]-2-oxoethyl]amino]carbonyl]-6-quinolinyl]oxy]propyl]-, 1,1-dimethylethyl ester (H5)
[0188] To a stirred solution of H4 (15 mg, 0.036 mmol, 1.0 eq), HATU (20 mg, 0.054 mmol, 1.5 eq) and HOBt (7.3 mg, 0.054 mmol, 1.5 eq) in DCM (3 mL) a solution of (S)-1-(2-aminoacetyl)-4,4-difluoropyrrolidine-2-carbonitrile (10 mg, 0.054 mmol, 1.5 eq) in DMF (1.0 mL) and DIPEA (25 μL, 0.144 mmol, 4 eq) was added and reaction stirred at room temperature for 9 h. The mixture was evaporated under vacuum, dissolved in DMSO and purified by RP-HPLC to give product as a white solid (6.0 mg, 0.01 mmol, 28% yield). MS (ES.sup.+) m/z 587 (M+H).sup.+.
Step 6: (S)—N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)-6-(3-(piperazin-1-yl) propoxy)quinoline-4-carboxamide (H6)
[0189] A stirred solution of H5 (5.0 mg, 8.0 μmol, 1.0 eq) and 4-methylbenzenesulfonic acid monohydrate (6.8 mg, 40 μmol, 5.0 eq) in MeCN (3 mL) was heated at 55° C. for 2 h. The mixture was concentrated under vacuum and product used as such in the subsequent step. White powder (8.0 mg, 8.0 μmol, Quant. yield). MS (ES.sup.+) m/z 487 (M+H).sup.+.
Step 7: (S)—N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)-6-(3-(4-(3′,6′-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9′-xanthene]-5-carbonyl)piperazin-1-yl)propoxy)quinoline-4-carboxamide (“HABERKORN-FLUO”, 23)
[0190] To a stirred solution of H6 (4.5 mg, 4.0 μmol, 1.0 eq.) and TEA (1.1 μL, 8.0 μmol, 2.0 eq) in DMF (1 mL) NHS-Fluorescein (2.8 mg, 6.0 μmol, 1.5 eq) was added and reaction stirred at room temperature for 9 h. The mixture was directly purified by RP-HPLC to give product as an orange powder (0.9 mg, 1.0 mol, 26% yield). MS (ES.sup.+) m/z 845 (M+H).sup.+ (Comparative Example 1B; see
Example 2: Synthesis of (S)—N1-(4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl) quinolin-8-yl)-N4-(2-(2-(2-(3-(3′,6′-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9′-xanthen]-5-yl)thioureido)ethoxy)ethoxy)ethyl)succinimide (“ESV6-FLUO”, 26)
Step 1: 5,8-Dioxa-2,11-diazadodecanoic acid, 12-[(3′,6′-dihydroxy-3-oxospiro [isobenzofuran-1(3H),9′-[9H]xanthen]-6-yl)amino]-12-thioxo-, 1,1-dimethylethyl ester (P1)
[0191] To a stirred solution of tert-butyl N-{2-[2-(2-aminoethoxy)ethoxy]ethyl}carbamate (173 μL, 0.731 mmol, 1.5 eq) in THF (20 mL), Fluorescein-5-Isothiocyanate (190 mg, 0.487 mmol, 1.0 eq) was added and reaction stirred at room temperature for 12 h. The mixture was concentrated under vacuum and crude directly purified by flash chromatography (DCM/EtOAc from 9:1 to 8:2) to give compound as an orange powder (200 mg, 0.314 mmol, 64% yield). MS (ES.sup.+) m/z 638 (M+H).sup.+.
Step 2: Thiourea, N-[2-[2-(2-aminoethoxy)ethoxy]ethyl]-N-(3′,6′-dihydroxy-3-oxospiro [isobenzofuran-1(3H),9′-[9H]xanthen]-5-yl)-(P2)
[0192] To a stirred solution of P1 (150 mg, 0.235 mmol, 1.0 eq) in DCM (10 mL) cooled to 0° C., HCl 4M in Et.sub.2O (5 mL) was added. The reaction was stirred slowly warmed to room temperature for 2 h, then concentrated under vacuum and co-evaporated with Et.sub.2O several times until an orange powder was obtained (135 mg, 0.235 mmol, Quant. yield). MS (ES.sup.+) m/z 538 (M+H).sup.+.
##STR00142##
Step 3: (S)-8-amino-N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)quinoline-4-carboxamide (P3)
[0193] Commercially available 8-amino-quinoline-4-carboxylic acid (19.0 mg, 100 μmol, 1.0 eq), DIPEA (70.0 μL, 400 μmol, 4.0 eq) and HATU (38.0 mg, 100 μmol, 1.0 eq) were dissolved in a 1:1 DCM/DMF mixture (2 mL). After 15 min a solution of (S)-1-(2-aminoacetyl)-4,4-difluoropyrrolidine-2-carbonitrile trifluoroacetate (30.3 mg, 100 μmol, 1.0 eq) in DCM was added. The reaction mixture was stirred for 1 h at room temperature, washed with water, dried over Na.sub.2SO.sub.4, filtered and concentrated to obtain a brown crude as sticky oil. The residue was purified by flash chromatography (DCM/MeOH from 91:1 to 90:10) to yield the pure product as a brownish oil (24.8 mg, 68.9 μmol, 69% yield). MS (ES.sup.+) m/z 360 (M+H).sup.+.
Step 4: (S)-4-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid (P4)
[0194] Triethylamine (20.8 μL, 150 μmol, 2.0 eq) and 4-dimethylaminopyridine (0.91 mg, 10.0 μmol, 0.1 eq) were added to a cooled solution (0° C.) of P3 (26.8 mg, 70.0 μmol, 1.0 eq) in DCM, followed by a dropwise addition of succinic anhydride (15.0 mg, 150 μmol, 2.0 eq). The reaction mixture was allowed to warm to room temperature. The reaction mixture was placed in a preheated 40° C. oil bath until full conversion was observed. The solvent was evaporated and the residue was purified by RP-HPLC to yield the pure product as a white powder (9.42 mg, 20.0 μmol, 28% yield). MS (ES.sup.+) m/z 460 (M+H).sup.+.
Step 5: (S)—N1-(4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)-N4-(2-(2-(2-(3-(3′,6′-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9′-xanthen]-5-yl)thioureido)ethoxy)ethoxy)ethyl)succinamide (“ESV6-FLUO”, 26)
[0195] P2 (22.0 mg, 40.0 μmol, 2.0 eq) and HATU (15.6 mg, 40.0 μmol, 2.0 eq) were taken in a 1:1 DCM/DMF mixture (2 mL) and DIPEA (7.20 μl, 40.0 μmol, 2.0 eq). The resulting mixture was stirred for 15 min at room temperature. P4 (9.42 mg, 20.0 μmol, 1.0 eq) in DCM was added and the reaction mixture was stirred at room temperature overnight. The solvent was evaporated and the residue was purified by preparative RP-HPLC to get the pure product as a yellow solid (2.50 mg, 10.0 μmol, 25% yield). MS (ES.sup.+) m/z 979 (M+H).sup.+ (
[0196] Further conjugates according to the present invention are listed below.
Conjugate 1: (2S,5R,8R,11R)-2-(((1-(6-(((S)-1-(((R)-1-((4-((5R,8S,11R,12S)-11-((R)-sec-butyl)-12-(2-((R)-2-((1S,2S)-3-(((1S,2R)-1-hydroxy-1-phenylpropan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-2-oxoethyl)-5,8-diisopropyl-4,10-dimethyl-3,6,9-trioxo-2,13-dioxa-4,7,10-triazatetradecyl)phenyl)amino)-1-oxo-5-ureidopentan-2-yl)amino)-3-methyl-1-oxobutan-2-yl)amino)-6-oxohexyl)-2,5-dioxopyrrolidin-3-yl)thio)methyl)-5,11-bis(carboxymethyl)-16-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-8-(3-guanidinopropyl)-4,7,10,13,16-pentaoxo-3,6,9,12-tetraazahexadecanoic acid
[0197] ##STR00143##
Conjugate 2: (2S,5R,8R,11R)-8-(4-aminobutyl)-2-(((1-(6-(((S)-1-(((R)-1-((4-((5R,8S,11R,12S)-11-((R)-sec-butyl)-12-(2-((R)-2-((1S,2S)-3-(((1S,2R)-1-hydroxy-1-phenylpropan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-2-oxoethyl)-5,8-diisopropyl-4,10-dimethyl-3,6,9-trioxo-2,13-dioxa-4,7,10-triazatetradecyl)phenyl)amino)-1-oxo-5-ureidopentan-2-yl)amino)-3-methyl-1-oxobutan-2-yl)amino)-6-oxohexyl)-2,5-dioxopyrrolidin-3-yl)thio)methyl)-5,11-bis(carboxymethyl)-16-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4, 7,10,13,16-pentaoxo-3,6, 9,12-tetraazahexadecanoic acid
[0198] ##STR00144##
Conjugate 3: (2S,5R,8R,11R)-2-(((1-(6-(((S)-1-(((R)-1-((4-((5R,8S,11R,12S)-11-((R)-sec-butyl)-12-(2-((R)-2-((1S,2S)-3-(((1S,2R)-1-hydroxy-1-phenylpropan-2-yl)amino)-1-methoxy-2-methyl-3-oxopropyl)pyrrolidin-1-yl)-2-oxoethyl)-5,8-diisopropyl-4,10-dimethyl-3,6,9-trioxo-2,13-dioxa-4,7,10-triazatetradecyl)phenyl)amino)-1-oxopropan-2-yl)amino)-3-methyl-1-oxobutan-2-yl)amino)-6-oxohexyl)-2,5-dioxopyrrolidin-3-yl)thio)methyl)-5,11-bis(carboxymethyl)-16-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-8-(3-guanidinopropyl)-4,7,10,13,16-pentaoxo-3,6,9,12-tetraazahexadecanoic acid
[0199] ##STR00145##
Conjugate 4: N.SUP.6.-(4-((3-((3-(((2R)-1-(((1.SUP.4.R,1.SUP.6.R,3.SUP.3.R,2S,4S,10E,12Z,14S)-8.SUP.6.-chloro-1.SUP.4.-hydroxy-8.SUP.5.,14-dimethoxy-3.SUP.3.,2,7,10-tetramethyl-1.SUP.2.,6-dioxo-7-aza-1(6,4)-oxazinana-3(2,3)-oxirana-8(1,3)-benzenacyclotetradecaphane-10,12-dien-4-yl)oxy)-1-oxopropan-2-yl)(methyl)amino)-3-oxopropyl)thio)-2,5-dioxopyrrolidin-1-yl)methyl)cyclohexane-1-carbonyl)-N.SUP.2.-(4-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoyl)-D-aspartyl-D- arginyl-D-aspartyl-D-lysine
[0200] ##STR00146##
Conjugate 5: (2R,5R,8R,11R)-5,11-bis(carboxymethyl)-16-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8- yl)amino)-2-((1-(14-((4-(4,7-dimethyl-3,8,11-trioxo-11-((2S,4S)-2,5,12-trihydroxy-7-methoxy-4-(((1S,3R,4aS,9S,9aR,10aS)-9-methoxy-1- methyloctahydro-1H-pyrano[4′,3′:4,5]oxazolo[2,3-c][1,4]oxazin-3-yl)oxy)-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-2-yl)-2,9-dioxa-4,7-diazaundecyl)phenyl)carbamoyl)-15-methyl-3,12-dioxo-7,10-dioxa-4,13-diazahexadecyl)-2,5-dioxopyrrolidin-3-yl)thio)-8-(3-guanidinopropyl)-4,7,10,13,16-pentaoxo-3,6,9,12-tetraazahexadecanoic acid
[0201] ##STR00147##
Conjugate 6: (10R,13R,16R,19R)-1-((3aR,4R,5S,10bR)-4-acetoxy-3a-ethyl-9-((3S,5S,7S,9S)-5-ethyl-5-hydroxy-9-(methoxycarbonyl)-1,4,5,6,7,8,9,10-octahydro-2H-3,7-methano[1]azacycloundecino [5,4-b]indol-9-yl)-5-hydroxy-8-methoxy-6-methyl-3a,3a.SUP.1.,4,5,5a,6,11,12-octahydro-1H-indolizino[8,1-cd]carbazol-5-yl)-10-carboxy-13-(carboxymethyl)-19-(4-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanamido)-16-(3-guanidinopropyl)-1,4,12,15,18-pentaoxo-5-oxa-8,9-dithia-2,3,11,14,17-pentaazahenicosan-21-oic acid
[0202] ##STR00148##
Conjugate 7: 2,2′,2″-(10-(2-((2-(3-(((2S,5R,8R,11R)-8-(4-aminobutyl)-2-carboxy-5,11-bis(carboxymethyl)-16-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4,7,10,13,16-pentaoxo-3,6,9,12-tetraazahexadecyl)thio)-2,5-dioxopyrrolidin-1-yl)ethyl)amino)-2-oxoethyl)-1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetic acid
[0203] ##STR00149##
Conjugate 8: 2,2′,2″-(10-(1-carboxy-4-((2-(4-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanamido)ethyl)amino)-4-oxobutyl)-1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetic acid
[0204] ##STR00150##
Conjugate 9: 2,2′,2″-(10-(1-carboxy-4-((2-(4-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanamido)ethyl)amino)-4-oxobutyl)-1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetic acid labelled with 177-Lutetium
[0205] ##STR00151##
Conjugate 10: 2,2′,2″-(10-(1-carboxy-4-((2-(4-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanamido)ethyl)amino)-4-oxobutyl)-1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetic acid labelled with 225-Actinium
[0206] ##STR00152##
Conjugate 11: 2,2′,2″-(10-(1-carboxy-4-((2-(4-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanamido)ethyl)amino)-4-oxobutyl)-1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetic acid labelled with 64-Cupper
[0207] ##STR00153##
Conjugate 12: (S)-3-((S)-2-amino-6-(4-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanamido)hexanamido)-4-(((R)-1-carboxy-2-mercaptoethyl)amino)-4-oxobutanoic acid labelled with 68-Gallium
[0208] ##STR00154##
Conjugate 13: (S)-3-((S)-2-amino-6-(4-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanamido)hexanamido)-4-(((R)-1-carboxy-2-mercaptoethyl)amino)-4-oxobutanoic acid
[0209] ##STR00155##
Conjugate 14: (S)-3-((S)-2-amino-6-(4-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanamido)hexanamido)-4-(((R)-1-carboxy-2-mercaptoethyl)amino)-4-oxobutanoic acid labelled with 99m-Technetium
[0210] ##STR00156##
Conjugate 15: (2R,5S,8S,11S)-8-(4-aminobutyl)-5,11-bis(carboxymethyl)-16-((4-((2-((S)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-2-(((1-(3′,6′-dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9′-xanthen]-5-yl)-2,5-dioxopyrrolidin-3-yl)thio)methyl)-4,7,10,13,16-pentaoxo-3,6,9,12-tetraazahexadecanoic acid
[0211] ##STR00157##
Example 3: Characterization of the Fluorescein-Labelled Binder “ESV6-FLUO” (26)
Expression of Human FAP
[0212] Aminoacid sequence of polyhistidine-tagged human Fibroblast Activating Protein (hFAP):
TABLE-US-00005 LRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNN IVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYS YTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQR PGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAE FNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYV GPQEVPVPAMIASSDYYFSWLTWVTDERVCLQWLKRVQNVSVLSICDFRE DWQTWDCPKTQEHIEESRTGWAGGFFVSTPVFSYDAISYYKIFSDKDGYK HIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPGRRNIY RISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPIST LHDGRTDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKMILP PQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGR GTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSY GGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLE HYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQ AMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSDHHHHHH
[0213] Human Fibroblast Activating Protein (hFAP; UniProtKB-Q12884 (SEPR_HUMAN) Aminoacids 25-760) was cloned in pCDNA3.1(+) with a secretion sequence at its 5′-, and a 6x polyhistidine-tag at its 3′-end and expressed in CHO cells by transient gene expression. The transfection mix was assembled as follow: 0.625 μg of plasmid DNA, 2.5 μg polyethylenimine (PEI) for 10.sup.6 cells, with a cell density of 4×10.sup.6 cells/ml. Cells were incubated for 6 days at 37° C., 5% CO.sub.2, 120 rpm. Cells were harvested by centrifugation (4500 rpm 30 min, 4° C.), and 1 mL (dry volume) of complete His-tag purification Resin was added to the filtered supernatant and incubated for 2 hours, 120 rpm at room temperature. Resin was washed with 800 mL of wash-buffer (imidazole 10 mM, PBS/NaCl 250 mM) and hFAP was eluted with 250 mM imidazole PBS/NaCl 250 mM. Elution fractions (1.5 mL) were checked on a spectrophotometer for Absorbance at 280 nm. hFAP-enriched fractions were pooled and dialyzed against HEPES-buffer (50 mM HEPES, 100 mM NaCl, pH=7.4).
[0214] Samples of recombinant hFAP were analyzed by SDS-PAGE and size exclusion chromatography (see
Affinity Measurement to Human FAP by Fluorescence Polarization (FIG. 4)
[0215] Fluorescence polarization measurements were performed in 384-well plates (non-binding, ps, f-bottom, black, high volume, 30 μL final volume). A stock solution of human FAP (4 μM) was serially diluted with buffer (50 mM Tris, 100 mM NaCl, 1 mM EDTA, pH=7.4), while the final concentration of the binders was kept constant at 10 nM. The measurements were carried out after incubating for 30 min at 37° C. in the dark by fluorescent polarization (
In Vitro Human FAP Enzyme IC50 Assay (FIG. 5)
[0216] Enzymatic activity of human FAP on the Z-Gly-Pro-AMC substrate was measured at room temperature on a microtiter plate reader, monitoring the fluorescence at an excitation wavelength of 360 nm and an emission wavelength of 465 nm. The reaction mixture contained 20 μM substrate, 20 nM human FAP, assay buffer (50 mM Tris, 100 mM NaCl, 1 mM EDTA, pH=7.4) and inhibitor (ranging between 10.sup.−6 and 10.sup.−11 M) in a total volume of 30 μL. The IC.sub.50 value is defined as the concentration of inhibitor required to reduce the enzyme activity by 50% after a 30 min preincubation with the enzyme at 37° C. prior to addition of the substrate.
[0217] Inhibitor stock solutions (200 mM) were prepared in DMSO. Immediately prior to the commencement of the experiment, the stocks were further diluted to 10.sup.−6 M in the assay buffer, from which 1:2 serial dilutions were prepared. All measurements were done in triplicate.
[0218]
Chromatographic Co-Elution Experiments of Ligand-Protein Complexes (FIG. 3)
[0219] A PD-10 column was pre-equilibrated with assay buffer (50 mM Tris, 100 mM NaCl, 1 mM EDTA, pH=7.4) prior to the loading of the complex. Human FAP (2 μM) and fluorescein-labeled binders (6 μM) were incubated for 30 min at 37° C. in the dark. The mixture was loaded and the column was flushed using the assay buffer. The flow through was collected in 96-well plates and the fluorescence was measured immediately on a TECAN microtiter plate reader, monitoring the fluorescence at an excitation wavelength of 485 nm and an emission wavelength of 535 nm. The protein quantities were estimated by measuring the absorbance at 280 nM using a Nanodrop 2000/2000c spectrophotometer.
[0220]
Dissociation Rate Measurement (FIG. 6)
[0221] Fluorescence polarization measurements to determine the k.sub.off values were performed in 384-well plates (non-binding, ps, f-bottom, black, high volume, 30 μL final volume). The measurements were carried out after pre-incubation of 2.0 nM fluorescein-labelled binders with human FAP at a constant concentration of 1.0 μM at 37° C. in the dark. The dissociation of the fluorescein-labeled compound was induced by adding a large excess of the corresponding fluorescein-free binders (compound P3 obtained in Step 3 of Example 2 and compound H6 obtained in Step 6 of Comparative Example 1, respectively, each at 20 μM final concentration).
[0222]
[0223] The compound of Comparative Example 1 in the present application (“HABERKORN-FLUO”) can be considered representative for the disclosure of the prior art, and in particular for the structure of the ligand FAPI-04 described in the prior art (WO 2019/154886 and WO 2019/154859). The above results show that the compounds according to the present invention not only form a stable complex with hFAP, but also surprisingly show a significantly increased affinity (lower K.sub.D), increased inhibitory activity (lower IC.sub.50), and a slower rate of dissociation as compared to the prior art.
Example 4: Comparative experiments in tumour models
[0224] PART 1—Preparation of Conjugates
Synthesis of tert-butyl (8-aminoquinoline-4-carbonyl)glycinate
[0225] ##STR00158##
[0226] DIPEA (185 μL, 1.063 mmol, 4 eq) was added dropwise to a stirred solution of tert-butyl glycinate hydrochloride (89 mg, 0.532 mmol, 2.0 eq), 8-aminoquinoline-4-carboxylic acid (50 mg, 0.266 mmol, 0.1 eq) and HATU (111 mg, 0.292 mmol, 1.1 eq) in 300 μL of DMF and 3 mL of DCM. The reaction mixture was stirred at room temperature for 1 h. The mixture was concentrated under vacuum and the crude material was directly purified by flash chromatography (DMC/MeOH from 100% to 9.5:0.5) to yield tert-butyl (8-aminoquinoline-4-carbonyl)glycinate as brown oil (70 mg, 0.232 mmol, 87.5%). MS(ES.sup.+) m/z 302.14 (M+H).sup.+
Synthesis of 4-((4-((2-(tert-butoxy)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid
[0227] ##STR00159##
[0228] 4-dimethylaminopyridine (14 mg, 0.116 mmol, 0.5 eq) was added to a stirred solution of tert-butyl (8-aminoquinoline-4-carbonyl)glycinate (70 mg, 0.232 mmol, 1.0 eq) and dihydrofuran-2,5-dione (232 mg, 2.324 mmol, 10.0 eq) in THF (3 mL). The reaction was heated at 50° C. for 6 h. The mixture was concentrated under vacuum, diluted in DCM and washed with water. The organic phase was concentrated under vacuum and purified by flash chromatography (DMC/MeOH from 9:1 to 7:3) to give compound as brown oil (50 mg, 0.125 mmol, 83.3%). MS(ES.sup.+) m/z 402.16 (M+H).sup.+
Synthesis of on-resin Cys(STrt)-Asp(OtBu)-Lys(NHBoc)-Asp(OtBu)-NHFmoc
[0229] ##STR00160##
[0230] Commercially available pre-loaded Fmoc-Cys(Trt) on Tentagel resin (500 mg, 0.415 mmol, RAPP Polymere) was swollen in DMF (3×5 min×5 mL), the Fmoc group removed with 20% piperidine in DMF (1×1 min×5 mL and 2×10 min×5 mL) and the resin washed with DMF (6×1 min×5 mL). The peptide was extended with Fmoc-Asp(tBu)-OH, Fmoc-Lys(NHBoc)-OH and Fmoc-Asp(tBu)-OH in the indicated order. For this purpose, the Fmoc protected amino acid (2.0 eq), HBTU (2.0 eq), HOBt (2.0 eq) and DIPEA (4.0 eq) were dissolved in DMF (5 mL). The mixture was allowed to stand for 10 min at 0° C. and then reacted with the resin for 1 h under gentle agitation. After washing with DMF (6×1 min×5 mL) the Fmoc group was removed with 20% piperidine in DMF (1×1 min×5 min and 2×10 min×5 mL). Deprotection steps were followed by wash steps with DMF (6×1 min×5 mL) prior to coupling with the next aminoacid.
Synthesis of (2R,5S,8S,11R)-8-(4-aminobutyl)-5,11-bis(carboxymethyl)-16-((4-((carboxymethyl)carbamoyl)quinolin-8-yl)amino)-2-(mercaptomethyl)-4,7,10,13,16-pentaoxo-3,6,9,12-tetraazahexadecanoic acid
[0231] ##STR00161##
[0232] On-resin Cys(STrt)-Asp(OtBu)-Lys(NHTBoc)-Asp(OtBu)-NHFmoc (50 mg, 0.025 mmol) was swollen in DMF (3×5 min×5 mL). The peptide was extended with 4-((4-((2-(tert-butoxy)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid (20 mg, 0.05 mmol, 2.0 eq), HATU (19 mg, 0.05 mmol, 2.0 eq), and DIPEA (17 μL, 0.1 mmol, 4.0 eq) and let react for 1 h under gentle agitation. After washing with DMF (6×1 min×5 mL), the compound was cleaved by agitating the resin with a mixture of TFA (15%), TIS (2.5%) and H2O (2.5%) in DCM for 4 h at room temperature. The resin was washed with methanol (2×5 mL) and the combined cleavage and washing solutions concentrated under vacuum. The crude product was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid (2.4 mg, 0.003 mmol, 12%). MS(ES.sup.+) m/z 807.45 (M+H).sup.+
Synthesis of (2R,5S,8S,11S)-8-(4-aminobutyl)-5,11-bis(carboxymethyl)-16-(4-(3-((4-((2-((S)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-6-yl)oxy)propyl)piperazin-1-yl)-2-(mercaptomethyl)-4,7,10,13,16-pentaoxo-3,6,9,12-tetraazahexadecanoic acid
[0233] ##STR00162##
[0234] On-resin Cys(STrt)-Asp(OtBu)-Lys(NHBoc)-Asp(OtBu)-NHFmoc (60 mg, 0.03 mmol) was swollen in DMF (3×5 min×5 mL). The peptide was extended with (S)-4-(4-(3-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-6-yl)oxy)propyl)piperazin-1-yl)-4-oxobutanoic acid (17.5 mg, 0.03 mmol, 1.0 eq), HATU (22 mg, 0.06 mmol, 2.0 eq), and DIPEA (200 μL, 1.2 mmol, 40 eq) and let react for 1 h under gentle agitation. After washing with DMF (6×1 min×5 mL), the compound was cleaved by agitating the resin with a mixture of TFA (15%), TIS (2.5%) and H2O (2.5%) in DCM for 4 h at room temperature. The resin was washed with methanol (2×5 mL) and the combined cleavage and washing solutions concentrated under vacuum. The crude product was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid (1 mg, 0.95 μmol, 0.3%). MS(ES+) m/z 1048.39 (M+H).sup.+
Synthesis of (2R,5S,8S,11S)-8-(4-aminobutyl)-5,11-bis(carboxymethyl)-16-((4-((2-((S)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2- oxoethyl)carbamoyl)quinolin-8-yl)amino)-2-(mercaptomethyl)-4,7,10,13,16-pentaoxo-3,6,9,12-tetraazahexadecanoic acid
[0235] ##STR00163##
[0236] On-resin Cys(STrt)-Asp(OtBu)-Lys(NHBoc)-Asp(OtBu)-NHFmoc (80 mg, 0.04 mmol) was swollen in DMF (3×5 min×5 mL). The peptide was extended with (S)-4-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid (37 mg, 0.08 mmol, 2 eq), HATU (30 mg, 0.08 mmol, 2.0 eq), and DIPEA (28 μL, 0.16 mmol, 4.0 eq) and let react for 1 h under gentle agitation. After washing with DMF (6×1 min×5 mL), the compound was cleaved by agitating the resin with a mixture of TFA (15%), TIS (2.5%) and H2O (2.5%) in DCM for 4 h at room temperature. The resin was washed with methanol (2×5 mL) and the combined cleavage and washing solutions concentrated under vacuum. The crude product was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid (1 mg, 0.95 μmol, 0.3%). MS(ES.sup.+) m/z 921.29 (M+H).sup.+
Synthesis of “QCOOH-IRDye750”
[0237] SH-Cys-Asp-Lys-Asp-QCOOH (140 μg, 0.174 μmol, 1.0 eq) was dissolved in PBS pH 7.4 (800 μL). IRDye750 maleimide (200 μg, 0.174 μmol, 1.0 eq) was added o as dry DMF solution (200 μL). The reaction was stirred for 3 h. The crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a green solid (0.06 μmol, 40%). MS(ES+) m/z 978 (M+2H).sup.2+
##STR00164##
Conjugate 16: Structure of “QCOOH-IRDye750”
Synthesis of “HABERKORN-IRDye750”
[0238] SH-Cys-Asp-Lys-Asp-HK (181 μg, 0.174 μmol, 1.0 eq) was dissolved in PBS pH 7.4 (800 μL). IRDye750 maleimide (200 g, 0.174 μmol, 1.0 eq) was added as dry o DMF solution (200 μL). The reaction was stirred for 3 h. The crude material was purified by reversed-phase HPLC (Water 0.11% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a green solid (0.06 μmol, 40%). MS(ES+) m/z 1099.8 (M+2H).sup.2+
##STR00165##
Conjugate 17: Structure of “HABERKORN-IRDye750”
Synthesis of ESV6-IRDye750
[0239] SH-Cys-Asp-Lys-Asp-ESV6 (160 μg, 0.174 μmol, 1.0 eq) was dissolved in PBS pH 7.4 (800 μL). IRDye750 maleimide (200 μg, 0.174 μmol, 1.0 eq) was added as dry DMF solution (200 μL). The reaction was stirred for 3 h. The crude material was purified by reversed-phase HPLC (Water 0.10% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a green solid (0.08 μmol, 50%). MS(ES+) m/z 1036.3 (M+2H).sup.2+
##STR00166##
Conjugate 18: Structure of ESV6-IRDye750
Synthesis of “QCOOH-ValCit-MMAE”
[0240] SH-Cys-Asp-Lys-Asp-QCOOH (612 μg, 0.760 μmol, 1.0 eq) was dissolved in PBS pH 7.4 (840 μL). MC-ValCit-PAB-MMAE (1000 μg, 0.760 μmol, 1.0 eq) was added as dry DMF solution (160 μL). The reaction was stirred for 3 h. The crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid (322 μg, 20%). MS(ES+) m/z 2124.03 (M+H).sup.+
##STR00167##
Conjugate 19: Structure of “QCOOH-ValCit-MMAE”
Synthesis of “HABERKORN-ValCit-MMAE”
[0241] SH-Cys-Asp-Lys-Asp-HK (795 μg, 0.760 μmol, 1.0 eq) was dissolved in PBS pH 7.4 (840 μL). MC-ValCit-PAB-MMAE (1000 μg, 0.760 μmol, 1.0 eq) was added as dry DMF solution (160 μL). The reaction was stirred for 3 h. The crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid (322 μg, 20%). MS(ES.sup.+) m/z 2364.18 (M+H).sup.+
##STR00168##
Conjugate 20: Structure of “HABERKORN-ValCit-MMAE”
Synthesis of “ESV6-ValCit-MMAE”
[0242] SH-Cys-Asp-Lys-Asp-ESV6 (700 μg, 0.760 μmol, 1.0 eq) was dissolved in PBS pH 7.4 (840 μL). MC-ValCit-PAB-MMAE (1000 g, 0.760 μmol, 1.0 eq) was added as dry DMF solution (160 μL). The reaction was stirred for 3 h. The crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid (322 μg, 20%). MS(ES+) m/z 2236.07 (M+H).sup.+
##STR00169##
Conjugate 21: Structure of “ESV6-ValCit-MMAE”
[0243]
[0244] MS(ES+) m/z 1118.05 (M+2H).sup.2+.
[0245] PART 2—Animal Experiments
Tumour Cells Preparation
[0246] Upon thawing, SK-MEL-187 tumour cells were kept in culture in RPMI medium supplemented with fetal bovine serum (10%, FBS) and Antibiotic-Antimycotic (1%, AA) at 37° C. and 5% CO.sub.2. For passaging, cells were detached using Trypsin-EDTA 0.05% when reaching 90% confluence and re-seeded at a dilution of 1:4.
IVIS Experiments
[0247] SK-MEL-187 xenografted tumours were implanted into female athymic BALB/C nu/nu mice (6-8 weeks of age) as described above, and allowed to grow to an average volume of 0.1 mL. Mice bearing subcutaneous SK-MEL-187 tumours were injected intravenously with ESV6-IRDye750, HABERKORN-IRDye750 or QCOOH-IRDye750 (150 nmol/Kg, as 30 μM solutions prepared in sterile PBS, pH 7.4). Mice were anesthetized with isoflurane and fluorescence images acquired on an IVIS Spectrum imaging system (Xenogen, exposure Is, binning factor 8, excitation at 745 nm, emission filter at 800 nm, f number 2, field of view 13.1). Images were taken 5 min, 20 min and 1 h after the injection. Food and water were given ad libitum during that period. Mice were subsequently sacrificed by CO.sub.2 asphyxiation (2 h time point). Blood, heart, lung, kidneys, liver, spleen, stomach, a section of the intestine and the SK-MEL-187 tumour were collected and imaged individually using the abovementioned parameters (
[0248] Specifically,
Therapy Experiments
[0249] SK-MEL-187 xenografted tumours were implanted into female athymic BALB/C nu/nu mice (6-8 weeks of age) as described above, and allowed to grow to an average volume of 0.1 mL. Mice were randomly assigned into therapy groups of 3 animals. HABERKORN-ValCit-MMAE (250 nmol/kg) and ESV6-ValCit-MMAE (250 nmol/kg) were injected daily as sterile PBS solution with 1% of DMSO for 7 consecutive days. Tumours were measured with an electronic caliper and animals were weighted daily. Tumour volume (mm.sup.3) was calculated with the formula (long side, mm)×(short side, mm)×(short side, mm)×0.5 (
[0250] Specifically,
Example 5: Preparation of Conjugates for Radio-Labeling
Synthesis of “HABERKORN-DOTA”
[0251] (S)-N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)-6-(3-(piperazin-1-yl) propoxy)quinoline-4-carboxamide (15 mg, 0.030 mol, 1.0 eq), HATU (13 mg, 0.039 mmol, 1.1 eq) and Tri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetate (19 mg, 0.039 mmol, 1.1 eq) were dissolved in DCM/MDF (800 μL/50 μL). DIPEA (18 μL, 0.101 mmol, 3 eq) was added dropwise and the reaction was stirred at room temperature for 1 h. The crude product was treated with TFA (40%) overnight and purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid (4 mg, 15%). MS(ES+) m/z 873.4 (M+H).sup.+
##STR00170##
Conjugate 22: Structure of “HABERKORN-DOTA”
Synthesis of “ESV6-DOTA” (8)
[0252] (S)-4-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid (15 mg, 0.032 mmol, 1.0 eq) was dissolved in dry DMSO (400 μL). Dicyclohexylcarbodiimide (9 mg, 0.042 mmol, 1.3 eq) and N-hydroxysuccinimide (4.5 mg, 0.039 mmol, 1.3 eq) were added and the reaction was stirred overnight at room temperature, protected from light. 100 μL of PBS solution containing 2,2′,2″-(10-(4-((2-aminoethyl)amino)-1-carboxy-4-oxobutyl)-1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetic acid (20 mg, 0.039 mmol, 1.2 eq) were added and the reaction was stirred for 2h. The crude product was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid (2.4 mg, 8%). MS(ES+) m/z 960.39 (M+H).sup.+
##STR00171##
Conjugate 8: Structure of “ESV6-DOTA”
[0253]
Example 6: Comparative Experiment Between Compound P4 and Compound 24
[0254] PART 1—Preparation of Compound 24
Synthesis of 7-(phenylamino)quinoline-4-carboxylic acid
[0255] ##STR00172##
[0256] 7-Bromoquinoline-4-carboxylic acid (30 mg, 0.119 mmol, 1.0 eq) was added to a stirred solution of aniline (111 mg, 1.19 mmol, 198 μL, 10.0 eq) in toluene (1 mL) and dioxane (500 μL) in a pressure-vial. The solution was degassed for 5 minutes (Argon-vacuum cycles) and then BrettPhos Palladacycle (10 mg, 0.0119 mmol, 0.1 eq) and potassium tert-butoxide (53 mg, 0.476 mmol, 4.0 eq) were added and the reaction was warmed up at 110° C. for 4h and checked via LC/MS. The crude was absorbed on silica and purified by flash chromatography (DMC/MeOH from 9:1 to 2:8) to give compound as orange oil (31 mg, 0.119 mmol, 100%). MS(ES+) m/z 265.09 (M+H).sup.+
Synthesis of (S)-N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)-7-(phenylamino)quinoline-4-carboxamide (compound 24)
[0257] ##STR00173##
[0258] 7-(phenylamino)quinoline-4-carboxylic acid (31 mg, 0.119 mmol, 1.0 eq), (S)-4,4-difluoro-1-glycylpyrrolidine-2-carbonitrile (24 mg, 0.129 mmol, 1.1 eq) and HATU (89 mg, 0.234 mmol, 2 eq) were added in a solution DMF (200 μL) and dichloromethane (1 mL). DIPEA (45 mg, 0.352 mmol, 61 μL, 3 eq) was added dropwise and the reaction was stirred for 15 minutes at room temperature. The DCM was evaporated and the crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a yellow solid (3.5 mg, 0.008 mmol, 6.9%). MS(ES+) m/z 436.15 (M+1H).sup.1+
[0259] PART 2—In Vitro Experiments
In Vitro inhibition assay on hFAP
[0260] Enzymatic activity of human FAP on the Z-Gly-Pro-AMC substrate in the presence of different small organic ligands (compound P4 from Example 2; compound 24) was measured at room temperature on a microtiter plate reader, monitoring the fluorescence at an excitation wavelength of 360 nm and an emission wavelength of 465 nm. The reaction mixture contained 20 μM substrate, 20 nM human FAP (constant), assay buffer (50 mM Tris, 100 mM NaCl, 1 mM EDTA, pH=7.4) and inhibitor (serial dilution from 10.sup.−6 to 10.sup.−11 M, 1:2) in a total volume of 20 μL. The IC.sub.50 value is defined as the concentration of inhibitor required to reduce the enzyme activity by 50% after addition of the substrate).
[0261]
Example 7: Synthesis of conjugates 15 and 25 and their characterization
[0262] PART 1—Preparation of Conjugates
Synthesis of Conjugate 15
[0263] ##STR00174##
[0264] SH-Cys-Asp-Lys-Asp-ESV6 (2 mg, 2.171 μmol, 1.0 eq) was dissolved in PBS pH 7.4 (800 μL). Fluorescein-5-maleimide (1.8 mg, 4.343 μmol, 2.0 eq) was added as dry DMSO solution (200 μL). The reaction was stirred for 3 h. The crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a yellow solid (420 nmol, 19.3%). MS(ES.sup.+) m/z 1348.36 (M+1H).sup.1+
[0265]
Synthesis of Conjugate 25
[0266] ##STR00175##
[0267] SH-Cys-Asp-Lys-Asp-HK (1 mg, 0.954 μmol, 1.0 eq) was dissolved in PBS pH 7.4 (800 μL). Fluorescein-5-maleimide (817 μg, 1.909 μmol, 2.0 eq) was added as dry DMSO solution (200 μL). The reaction was stirred for 3 h. The crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a yellow solid (373 nmol, 39.1%). MS(ES.sup.+) m/z 1476.47 (M+1H).sup.+
[0268] PART 2—In Vitro Experiments
Affinity Measurement to Human and Murine FAP by Fluorescence Polarization (FP)
[0269] Fluorescence polarization experiments were performed in 384-well plates (non-binding, ps, f-bottom, black, high volume, 30 μL final volume). Stock solutions of human FAP (4 μM) and murine FAP (5 μM) were serially diluted with buffer (50 mM Tris, 100 mM NaCl, 1 mM EDTA, pH=7.4), while the final concentration of the binders was kept constant at 10 nM. The fluorescence anisotropy was measured on a TECAN microtiter plate reader. Experiments were performed in triplicate and the mean anisotropy values fitted using Prism 7.
[0270]
Chromatographic Co-Elution Experiments of Ligand-Protein Complexes
[0271] A PD-10 column was pre-equilibrated with assay buffer (50 mM Tris, 100 mM NaCl, 1 mM EDTA, pH=7.4) prior to the loading of the complex. A mixture of different proteins (hFAP=2 μM, mFAP=5 μM) and conjugate 15 (100 nM) were incubated and loaded on the column. The mixture was flushed using the assay buffer. The flow through was collected in 96-well plates and the fluorescence intensity was measured immediately on a TECAN microtiter plate reader, monitoring the fluorescence at an excitation wavelength of 485 nm and an emission wavelength of 535 nm. The concentration of the proteins was estimated by measuring the absorbance at 280 nM using a Nanodrop 2000/2000c spectrophotometer.
[0272]
[0273] PART 3—Animal Experiments
Cell Cultures
[0274] Upon thawing, SK-RC-52.hFAP and SK-RC-52 cells were kept in culture in RPMI medium supplemented with fetal bovine serum (10%, FBS) and Antibiotic-Antimycotic (1%, AA) at 37° C. and 5% CO.sub.2. For passaging, cells were detached using Trypsin-EDTA 0.05% when reaching 90% confluence and re-seeded at a dilution of 1:4.
[0275] Upon thawing, HT-1080.hFAP and HT-1080 cells were kept in culture in DMEM medium supplemented with fetal bovine serum (10%, FBS) and Antibiotic-Antimycotic (1%, AA) at 37° C. and 5% CO.sub.2. For passaging, cells were detached using Trypsin-EDTA 0.05% when reaching 90% confluence and re-seeded at a dilution of 1:4.
Confocal Microscopy Analysis on SK-RC-52.hFAP, SK-RC-52, HT-1080.hFAP and HT-1080
[0276] SK-RC-52.hFAP and SK-RC-52 cells were seeded into 4-well cover slip chamber plates at a density of 104 cells per well in RPMI medium (1 mL) supplemented with 10% FCS, AA and HEPES (10 mM) and allowed to grow for 24 hours under standard culture conditions. Hoechst 33342 nuclear dye was used to stain nuclear structures.
[0277] The culture medium was replaced with fresh medium containing conjugate 15 (100 nM). Randomly selected colonies imaged on a SP8 confocal microscope equipped with an AOBS device (Leica Microsystems).
[0278] HT-1080.hFAP and HT-1080 cells were seeded into 4-well cover slip chamber plates at a density of 104 cells per well in DMEM medium (1 mL) supplemented with 10% FCS, AA and HEPES (10 mM) and allowed to grow for 24 hours under standard culture conditions. Hoechst 33342 nuclear dye was used to stain nuclear structures.
[0279] The culture medium was replaced with fresh medium containing conjugate 15 (100 nM). Randomly selected colonies imaged on a SP8 confocal microscope equipped with an AOBS device (Leica Microsystems).
[0280]
FACS Analysis
[0281] SK-RC-52.hFAP, SK-RC-52.wt, HT-1080.wt and HT-1080.hFAP were detached from culture plates using Accutase, counted and suspended to a final concentration of 1.5×10.sup.6 cells/mL in a 1% v/v solution of FCS in PBS pH 7.4. Aliquots of 3×10.sup.5 cells (200 μL) were spun down and resuspended in solutions of conjugate 15 (15 nM) in a 1% v/v solution of FCS in PBS pH 7.4 (200 μL) and incubated on ice for 1 h. Cells were washed once with 200 μL 1% v/v solution of FCS in PBS pH 7.4 (200 μL), spun down, resuspended in a 1% v/v solution of FCS in PBS pH 7.4 (300 μL) and analyzed on a CytoFLEX cytometer (Beckman Coulter). The raw data were processed with the FlowJo 10.4 software.
[0282] Results are shown in
Animal Studies
[0283] All animal experiments were conducted in accordance with Swiss animal welfare laws and regulations under the license number ZH04/2018 granted by the Veterinäramt des Kantons Zürich.
Implantation of Subcutaneous SK-RC-52.hFAP Tumours
[0284] SK-RC-52.hFAP cells were grown to 80% confluence and detached with Trypsin-EDTA 0.05%. Cells were re-suspended in HBSS medium to a final concentration of 5×10.sup.7 cells/mL. Aliquots of 5×10.sup.6 cells (100 μL of suspension) were injected subcutaneously in the right flank of female athymic BALB/C nu/nu mice (6-8 weeks of age).
Ex Vivo Experiment
[0285] Mice bearing subcutaneous SK-RC-52.hFAP tumour was injected intravenously with conjugate 15 (40 nmol in sterile PBS, pH 7.4). Animals were sacrificed by CO.sub.2 asphyxiation 1h after the intravenous injection and the organs and the tumour were excised, snap-frozen in OCT medium and stored at −80° C. Cryostat sections (7 m) were cut and nuclei were stained with Fluorescence Mounting Medium (Dako Omnis, Agilent). Images were obtained using an Axioskop2 mot plus microscope (Zeiss) and analyzed by ImageJ 1.53 software.
[0286]
Example 8: Synthesis and Characterization of Conjugate 9
[0287] PART 1—Preparation of Conjugate
Synthesis of Conjugate 9 (2,2′,2″-(10-(1-carboxy-4-((2-(4-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanamido)ethyl)amino)-4-oxobutyl)-1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetic acid labelled with 177-Lutetium)
[0288] ##STR00176##
[0289] The conjugate 8 was dissolved in acetate buffer (1M, pH=4) to a final concentration of 1 μg/μL. Stock solution of conjugate 8 (25 μg in 25 μL) was diluted with 250 μL of acetate buffer (1M, pH=4). .sup.177LuCl.sub.3 solution (250 μL, 25 MBq) was added and the mixture was heated at 95° C. for 15 minutes. The labelling mixture was diluted by the addition of sterile PBS (1975 μL, pH=7.4) and labelling efficiency was monitored via radio-HPLC (5-10 μL, 0.5-1 MBq, 0.1% TFA in water as solvent A and 0.1% TFA in acetonitrile as solvent B. program: 0-8 min, 20%-65% solvent B and flow rate 1 ml/min). Quantitative conversion to conjugate 9 was achieved (radiolabeling efficiency >99%,
[0290]
[0291] PART 2—Animal Experiments
Radiolabelling and Biodistribution Experiment in SK-RC-52.hFAP
[0292] SK-RC-52.hFAP tumour cells were implanted into female BALB/c nu/nu mice as described in Example 7, and allowed to grow for three weeks to an average volume of 250 mm.sup.3. Mice were randomized (n=4 per group) and injected intravenously with radiolabeled preparations of conjugate 9 (50, 125, 250, 500 or 1000 nmol/Kg; 0.5-2 MBq). Mice were sacrificed 10 minutes, 1 h, 3 h and 6 h after the injection by CO.sub.2 asphyxiation and organs extracted, weighted and radioactivity measured with a Packard Cobra y-counter. Values are expressed as % ID/g±SD (
[0293]
Example 9: Synthesis of Compounds 27-32
Synthesis of 2,2′,2″-(10-(1-carboxy-4-((2-(4-((4-((2-((R)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanamido)ethyl)amino)-4-oxobutyl)-1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetic acid Labelled with 69-Gallium, Conjugate 27
[0294] ##STR00177##
[0295] Conjugate 8 was dissolved in acetate buffer (1M, pH=4) to a final concentration of 1 μg/μL.
[0296] Stock solution of conjugate 8 (100 μg in 100 μL) was diluted with 250 μL of acetate buffer (1M, pH=4). GaCl.sub.3 solution (183 μg in 183 μL of HCl) was added and the mixture was heated at 90° C. for 15 minutes. The reaction was checked via LC/MS. MS(ES+) m/z 1027.30 (M+H).sup.+
Synthesis of methyl (6-methoxyquinoline-4-carbonyl) glycinate
[0297] ##STR00178##
[0298] 6-methoxyquinoline-4-carboxylic acid (200 mg, 0.985 mmol, 1.0 eq), HBTU (400 mg, 1.03 mmol, 1.05 eq), HOBt (167 mg, 1.05 mmol, 1.15 eq) and methyl glycinate hydrochloride (107 mg, 1.08 mmol, 1.1 eq) were dissolved in 5 mL of DMF and stirred at room temperature. DIPEA (613 μL, 4.42 mmol, 4.5 eq) was added dropwise and the reaction was checked via LC/MS until competition. The crude was directly purified via chromatography (DCM:MeOH 100:0 to 80:20 in 10 min) to afford a pale yellow solid (40 mg, 0.145 mmol, 14.7%). MS(ES+) m/z 275.1 (M+1H).
Synthesis of (6-methoxyquinoline-4-carbonyl) glycinate
[0299] ##STR00179##
[0300] Methyl (6-methoxyquinoline-4-carbonyl) glycinate (30 mg, 0.109 mmol, 1.0 eq), was dissolved in 2 mL THF/H.sub.2O (1:1) of a 1M LiOH solution and stirred at room temperature for 6 hours. When completed, the base was quenched with HCl 1M until a slightly acidic pH was reached and the crude was lyophilized, to obtain a white solid (quantitative yield). MS(ES+) m/z 261.08 (M+1H).sup.1+
Synthesis of (S)-N-(2-(2-cyanopyrrolidin-1-yl)-2-oxoethyl)-6-methoxyquinoline-4-carboxamide, conjugate 28
[0301] ##STR00180##
[0302] (6-methoxyquinoline-4-carbonyl) glycinate (28 mg, 0.109 mmol, 1.0 eq), (S)-pyrrolidine-2-Carbonitrile (16 mg, 0,120 mmol, 1.1 eq) and HATU (62 mg, 0.164 mmol, 1.5 eq) were dissolved in 2 mL of DMF and the suspension was stirred at room temperature. DIPEA (47 μL, 2.62 mmol, 24 eq) was added dropwise and the reaction was checked via LC/MS until competition. The crude was directly purified via reverse phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a yellow solid (2 mg, 5.91 μmol, 5.4%). MS(ES+) m/z 339.14 (M+1H).sup.1+
Synthesis of tert-butyl ((S)-1-((S)-2-cyano-4,4-difluoropyrrolidin-1-yl)-1-oxopropan-2-yl)carbamate
[0303] ##STR00181##
[0304] (S)-4,4-difluoro-pyrrolidine-2-Carbonitrile (50 mg, 0,379 mmol, 1 eq), (tert-butoxycarbonyl-L-alanine (154 mg, 0.75 mmol, 2.0 eq), and HATU (288 mg, 0.75 mmol, 2 eq) were dissolved in 4 mL of DMF and the suspension was stirred at room temperature. DIPEA (335 μL, 1.893 mmol, 5 eq) was added dropwise and the reaction was checked via LC/MS until competition. The DMF was removed under vacuum and the crude was diluted in DCM. The organic phase was washed with water and 1M HCl and then dried, to obtain a white foam (115 mg, 0.379 mmol, quantitative yield). MS(ES+) m/z 304.14 (M+1H).sup.1+
Synthesis of (S)-1-(L-alanyl)-4,4-difluoropyrrolidine-2-carbonitrile
[0305] ##STR00182##
[0306] tert-butyl ((5)-1-((S)-2-cyano-4,4-difluoropyrrolidin-1-yl)-1-oxopropan-2-yl)carbamate (115 mg, 0,379 mmol, 1 eq), was dissolved in 2 mL of DCM and TFA (203 μL, 7 eq) was added dropwise and the reaction was stirred at room temperature and checked via LC/MS until competition. The crude was diluted in DCM and the product was extracted with HCl 1M. The acidic water phase was then quenched with NaOH 1M and the product was extracted with DCM and dried, to afford a pale yellow oil (30 mg, 0.147 mmol, 38.7%). MS(ES+) m/z 204.07 (M+1H).sup.1+
Synthesis of tert-butyl ((4-(((S)-1-((S)-2-cyano-4,4-difluoropyrrolidin-1-yl)-1-oxopropan-2-yl)carbamoyl)pyridin-2-yl)methyl)carbamate
[0307] ##STR00183##
[0308] (S)-1-(L-alanyl)-4,4-difluoropyrrolidine-2-carbonitrile (30 mg, 0,147 mmol, 1 eq), 2-(((tert-butoxycarbonyl)amino)methyl)isonicotinic acid (74 mg, 0.295 mmol, 2.0 eq), and HATU (112 mg, 0.295 mmol, 2 eq) were dissolved in 1 mL of DMF and the suspension was stirred at room temperature. DIPEA (102 μL, 0.590 mmol, 4 eq) was added dropwise and the reaction was checked via LC/MS until competition. The DMF was removed under vacuum and the crude was diluted in DCM and purified via chromatography (DCM:MeOH 99:1 to 70:30 in 15 min) to afford a yellow solid (15 mg. 0.034 mmol, 19.7%). MS(ES+) m/z 438.19 (M+1H).sup.1+
Synthesis of 2-(aminomethyl)-N-((S)-1-((S)-2-cyano-4,4-difluoropyrrolidin-1-yl)-1-oxopropan-2-yl)isonicotinamide
[0309] ##STR00184##
[0310] tert-butyl ((4-(((S)-1-((S)-2-cyano-4,4-difluoropyrrolidin-1-yl)-1-oxopropan-2-yl)carbamoyl)pyridin-2-yl)methyl)carbamate (15 mg, 0.034 mmol, 1.0 eq), was dissolved in 400 μL of DCM and TFA (200 μL, 20% of volume) was added dropwise. the reaction was stirred at room temperature and checked via LC/MS until competition. The crude was dried and lyophilized in 500 μL of a 1:1 solution of water:Acetonitrile, to obtain a yellow powder (4 mg, 11.86 μmol, 34.8%). MS(ES.sup.+) m/z 338.14 (M+1H).sup.1+
Synthesis of 4-(((4-(((S)-1-((S)-2-cyano-4,4-difluoropyrrolidin-1-yl)-1-oxopropan-2-yl)carbamoyl)pyridin-2-yl)methyl)amino)-4-oxobutanoic acid, Conjugate 29
[0311] ##STR00185##
[0312] 2-(aminomethyl)-N-((S)-1-((S)-2-cyano-4,4-difluoropyrrolidin-1-yl)-1-oxopropan-2-yl)isonicotinamide (4 mg, 11.86 μmol, 1.0 eq), was dissolved in 500 μL of THF. DMAP (6 mg, 48 μmol, 4.0 eq) and succinic anhydride (3.5 mg, 35.6 μmol, 3.0 eq) were added and the reaction was stirred at room temperature and checked via LC/MS until competition. The crude was directly purified via reverse phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a yellow solid (1.3 mg, 2.97 μmol, 25%). MS(ES+) m/z 438.15 (M+1H).sup.1+
Synthesis of ESV6-Alexa Fluor 488, Conjugate 30
[0313] ##STR00186##
[0314] SH-Cys-Asp-Lys-Asp-ESV6 (293 μg, 0.32 μmol, 1.0 eq) was dissolved in PBS pH 7.4 (300 μL). Alexa Fluor™ 488 C5 Maleimide (200 μg, 0.29 μmol, 0.9 eq) was added as dry DMSO solution (200 μL). The reaction was stirred for 3 h.
[0315] The crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.10% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain an orange solid (70 nmol, 21.9%). MS(ES+) m/z 1619.39 (M+1H).sup.1+
Synthesis of ESV6-ValCit-PNU 159682 Conjugate 31
[0316] ##STR00187##
[0317] SH-Cys-Asp-Lys-Asp-ESV-6 (2 mg, 2.17 μmol, 1.2 eq) was dissolved in PBS pH 7.4 (750 μL). MA-PEG4-VC-PAB-DMAE-PNU 159682 (2.5 mg, 1.75 μmol, 1.0 eq) was added as dry DMF solution (250 μL). The reaction was stirred for 3 h.
[0318] The crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.10% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid (3 mg, 73%). MS(ES+) m/z 2348.88 (M+H).sup.+
Synthesis of QCOOH-ValCit-PNU 159682 Conjugate 32
[0319] ##STR00188##
[0320] SH-Cys-Asp-Lys-Asp-QCOOH (1.6 mg, 2.17 μmol, 1.2 eq) was dissolved in PBS pH 7.4 (750 μL). MA-PEG4-VC-PAB-DMAE-PNU 159682 (2.5 mg, 1.75 μmol, 1.0 eq) was added as dry DMF solution (250 μL). The reaction was stirred for 3 h.
[0321] The crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.10% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid (2.8 mg, 73%).
Example 10: Characterization and Biological Testing of Compounds 18, 19, 21, P4, 27, 28, 29, 30
[0322] Materials and Methods
In Vitro Inhibition Assay on hFAP
[0323] Enzymatic activity of human FAP on the Z-Gly-Pro-AMC substrate was measured at room temperature on a microtiter plate reader, monitoring the fluorescence at an excitation wavelength of 360 nm and an emission wavelength of 465 nm. The reaction mixture contained 20 μM substrate, 20 nM human FAP (constant), assay buffer (50 mM Tris, 100 mM NaCl, 1 mM EDTA, pH=7.4) and tested compound (serial dilution from 10.sup.−6 to 10.sup.−11 M, 1:2) in a total volume of 20 μL. The IC.sub.50 value is defined as the concentration of inhibitor required to reduce the enzyme activity by 50% after addition of the substrate.
Cell Cultures
[0324] Upon thawing, SK-MEL-187, SK-RC-52.hFAP and SK-RC-52.wt cells were kept in culture in RPMI medium supplemented with fetal bovine serum (10%, FBS) and Antibiotic-Antimycotic (1%, AA) at 37° C. and 5% CO.sub.2. For passaging, cells were detached using Trypsin-EDTA 0.05% when reaching 90% confluence and re-seeded at a dilution of 1:4.
[0325] Upon thawing, HT-1080.hFAP and HT-1080.wt cells were kept in culture in DMEM medium supplemented with fetal bovine serum (10%, FBS) and Antibiotic-Antimycotic (1%, AA) at 37° C. and 5% CO.sub.2. For passaging, cells were detached using Trypsin-EDTA 0.05% when reaching 90% confluence and re-seeded at a dilution of 1:4.
Animal Studies
[0326] All animal experiments were conducted in accordance with Swiss animal welfare laws and regulations under the license number ZH04/2018 granted by the Veterinäramt des Kantons Zürich.
Implantation of Subcutaneous SK-RC-52.hFAP and HT-1080.hFAP Tumors
[0327] SK-RC-52.hFAP, HT-1080.hFAP, SK-RC-52.wt cells were grown to 80% confluence and detached with Trypsin-EDTA 0.05%. Cells were re-suspended in HBSS medium to a final concentration of 5×10.sup.7 cells/mL. Aliquots of 5×10.sup.6 cells (100 μL of suspension) were injected subcutaneously in the flank of female athymic BALB/C nu/nu mice (6-8 weeks of age). SK-MEL-187 cells were grown to 80% confluence and detached with Trypsin-EDTA 0.05%. Cells were re-suspended in a 1:1 mixture of HBSS:Matrigel to a final concentration of 10×10.sup.7 cells/mL. Aliquots of 5×10.sup.6 cells (200 μL of suspension) were injected subcutaneously in the flank of female athymic BALB/C nu/nu mice (6-8 weeks of age).
IVIS Experiments
[0328] In a first experiment, HT-1080.hFAP xenografted tumors were implanted into the right flank of female athymic BALB/C nu/nu mice (6-8 weeks of age) as described above, and allowed to grow to an average volume of 0.1 mL. SK-RC-52.wt xenografted tumors were implanted into the right flank of female athymic BALB/C nu/nu mice (6-8 weeks of age) as described above, and allowed to grow to an average volume of 0.1 mL.
[0329] Mice were injected intravenously with ESV6-IRDye750 (18, 150 nmol/Kg, as 30 μM solutions prepared in sterile PBS, pH 7.4). Mice were sacrificed by CO.sub.2 asphyxiation (1 h time point) and fluorescence images of all collected organs (blood, heart, muscle, lung, kidneys, liver, spleen, stomach, a section of the intestine, SK-RC-52.wt tumor and HT-1080.hFAP) were acquired on an IVIS Spectrum imaging system (Xenogen, exposure Is, binning factor 8, excitation at 745 nm, emission filter at 800 nm, f number 2, field of view 13.1).
[0330] In a different experiment, SK-MEL-187 xenografted tumors were implanted into the right flank of female athymic BALB/C nu/nu mice (6-8 weeks of age) as described above, and allowed to grow to an average volume of 0.1 mL. SK-RC-52.hFAP xenografted tumors were implanted into the left flank of female athymic BALB/C nu/nu mice (6-8 weeks of age) as described above, and allowed to grow to an average volume of 0.1 mL. Mice were injected intravenously with ESV6-IRDye750 (18, 150 nmol/Kg, as 30 μM solutions prepared in sterile PBS, pH 7.4). Mice were sacrificed by CO.sub.2 asphyxiation (1 h time point) and fluorescence images of all collected organs (blood, heart, muscle, lung, kidneys, liver, spleen, stomach, a section of the intestine, SK-MEL-187 tumor and SK-RC-52.hFAP) were acquired on an IVIS Spectrum imaging system (Xenogen, exposure Is, binning factor 8, excitation at 745 nm, emission filter at 800 nm, f number 2, field of view 13.1).
Ex Vivo Experiments
[0331] Mice bearing subcutaneous SK-RC-52.hFAP or HT-1080.hFAP tumors on the right flank and SK-RC-52.wt tumor on the left flank were injected intravenously with conjugate 30 (40 nmol in sterile PBS, pH 7.4). Animals were sacrificed by CO.sub.2 asphyxiation 1 h after the intravenous injection and the organs and the tumors were excised, snap-frozen in OCT medium (Thermo Scientific) and stored at −80° C. Cryostat sections (7 m) were cut and nuclei were stained with Fluorescence Mounting Medium (Dako Omnis, Agilent). Images were obtained using an Axioskop2 mot plus microscope (Zeiss) and analyzed by ImageJ 1.53 software.
Therapy Experiments
[0332] SK-RC-52.hFAP xenografted tumors were implanted into female athymic BALB/C nu/nu mice (6-8 weeks of age) as described above, and allowed to grow to an average volume of 0.1 mL.
[0333] Mice were randomly assigned into 8 therapy groups of 4 animals each (5 single-agent groups, 2 combination groups and vehicle group). ESV6-ValCit-MMAE (21, 500 nmol/kg), QCOOH-ValCit-MMAE (19, 500 nmol/kg) were injected as sterile PBS solution with 2% of DMSO. L19-IL2 was diluted at 330 μg/mL in the appropriate formulation buffer and intravenously administered at the dose of 2.5 mg/kg.
[0334] Mice in single-agent groups received daily injections of ESV6-ValCit-MMAE, QCOOH-ValCit-MMAE or L 19-IL2.
[0335] Mice in combination groups received daily injections of ESV6-ValCit-MMAE on day 8,10 and 12 after tumor implantation, and of L 19-IL2 on day 9,11 and 13 after tumor implantation.
[0336] Tumors were measured with an electronic caliper and animals were weighted daily. Tumor volume (mm.sup.3) was calculated with the formula (long side, mm)×(short side, mm)×(short side, mm)×0.5.
[0337] Prism 6 software (GraphPad Software) was used for data analysis (regular two-way ANOVA followed by Bonferroni test).
Biodistribution Experiment
[0338] SK-RC-52.hFAP (right flank) and SK-RC-52.wt (left flank) xenografted tumors were implanted into female athymic BALB/C nu/nu mice (6-8 weeks of age) as described above, and allowed to grow to an average volume of 0.1 mL.
[0339] Mice were injected with ESV6-ValCit-MMAE (21, 250 nmol/kg) and sacrificed by CO.sub.2 asphyxiation 6 h after the intravenous injection and the organs and the tumors were excised and conserved at −80° C. Frozen organs were cutted with a scalpel (50 mg), and suspended in 600 μL of 95:5 Acetonitrile/water (0.1% TFA). A solution of D8-MMAE in 3:97 Acetonitrile/water (0.1% FA; internal standard, 50 μL, 50 nM) was added. The samples were mechanically lysed with a Tissue Lyser II (Qiagen, 30 Hz shaking, 15 minutes). Plasma samples (50 μL) were added with a solution of D8-MMAE in 3:97 Acetonitrile/water (0.1% FA; internal standard, 50 μL, 50 nM) and proteins were precipitated by addition of 600 μL of 95:5 Acetonitrile/water (0.1% TFA). Proteins from both organs and plasma samples were pelleted by centrifugation and supernatants were dried with a vacuum centrifuge. Solid remanences were resuspended in 1 mL of 3:97 Acetonitrile/water (0.1% TFA) and solutions were cleaned up through a first purification step on HBL Oasis columns and a second purification on C18 Macro Spin Columns. Purified dried eluates were resuspended in 150 μL of 3:97 Acetonitrile/water (0.1% FA) and analyzed by MS. All samples were analysed by liquid chromatography-tandem mass spectrometry (LC-MS/MS) using a Q Exactive Mass Spectrometer fitted with an EASY-nLC 1000 (both Thermo Fisher Scientific). Analytes were resolved with an Acclaim PepMap RSLC C18, 50 m×150 mm, 2 m analytical column (Thermo Fisher Scientific) at a flow rate of 0.3 It/min by running a linear gradient from 3% to 50% ACN over 60 min. All buffers contained 0.1% formic acid. MS spectra were recorded in SIM scan mode with a resolution of 70000 and a maximum injection time of 100 ms. MS/MS were recorded at a resolution of 35000 and a maximum injection time of 250 ms. The 4 SIM windows were centred on the doubly and triply charged ions of ESV6-ValCit-MMAE, 1119.0435 m/z and 746.3648 m/z respectively.
[0340] Raw files were then analysed with the Skyline software. MS1 areas of the two ions were used for quantification.
Mouse Serum Stability
[0341] Labelling solution of Conjugate 27 (100 μL, 200 μM) was spiked into 100 μL of mouse serum and incubated at room temperature. Right after the addition and after 10 min, 1 h, 3 h and 6 h, the proteins were precipitated by adding 100 μL of methanol and the samples were centrifuged at 16300 rpm for 10 minutes. The supernatant was collected and checked with analytical HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and the identity of the peak was assessed via LC/MS.
[0342] Results
[0343]
[0344]
[0345]
[0346]
[0347]
[0348]
[0349]
[0350]
[0351]
Example 11: Synthesis of Further Conjugates
Synthesis of Conjugate 39
[0352] ##STR00189##
[0353] (S)-4-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid (15 mg, 0.032 mmol, 1.0 eq) is dissolved in dry DMSO (400 μL). Dicyclohexylcarbodiimide (9 mg, 0.042 mmol, 1.3 eq) and N-hydroxysuccinimide (4.5 mg, 0.039 mmol, 1.3 eq) are added and the reaction is stirred overnight at room temperature, protected from light. 100 μL of PBS solution containing 2,2′-(7-(4-((2-aminoethyl)amino)-1-carboxy-4-oxobutyl)-1,4,7-triazonane-1,4-diyl)diacetic acid (16.2 mg, 0.039 mmol, 1.2 eq) are added and the reaction is stirred for 2h. The crude product is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid. MS(ES+) m/z 858.35 (M+H).sup.+
Synthesis of Conjugate 40
[0354] ##STR00190##
[0355] A solution of Conjugate 39 (1 mL, 150 μM) in sodium acetate buffer (0.1 M, pH 4) is added to a separate vial which contain a freshly prepared (Al.sup.18F).sup.2+ solution (obtained as previously described in the literature, Cleeren et al., Bioconjugate. Chem. 2016). The closed vial is heated at 95° C. temperatures for 12 min. the formation of the complex is confirmed by Radio-HPLC and radio-TLC analysis.
Synthesis of Conjugate 41
[0356] ##STR00191##
[0357] SH-Cys-Asp-Lys-Asp-ESV6 (2 mg, 2.171 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (800 μL). Maleimido-NOTA (3.0 mg, 4.343 μmol, 2.0 eq) is added as dry DMSO solution (200 μL). The reaction is stirred for 3 h. The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a yellow solid. MS(ES+) m/z 1345.48 (M+1H).sup.1+.
Synthesis of Conjugate 43a
[0358] ##STR00192##
[0359] Commercially available pre-loaded Fmoc-Lys(NeBoc) on Tentagel resin (300 mg, 0.18 mmol, RAPP Polymere) is swollen in DMF (3×5 min×5 mL), the Fmoc group removed with 20% piperidine in DMF (1×1 min×5 mL and 2×10 min×5 mL) and the resin washed with DMF (6×1 min×5 mL). The peptide is extended with Fmoc-Glu(tBu)-OH, Fmoc-Glu(tBu)-OH and (S)-4-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid in the indicated order. For this purpose, the Fmoc protected amino acid (2.0 eq), HBTU (2.0 eq), HOBt (2.0 eq) and DIPEA (4.0 eq) are dissolved in DMF (5 mL). The mixture is allowed to stand for 10 min at 0° C. and then reacted with the resin for 1 h under gentle agitation. After washing with DMF (6×1 min×5 mL) the Fmoc group is removed with 20% piperidine in DMF (1×1 min×5 min and 2×10 min×5 mL). Deprotection steps are followed by wash steps with DMF (6×1 min×5 mL) prior to coupling with the next aminoacid. The peptide is cleaved from the resin with a mixture of 20 00 TFA in DCM at room temperature for 1 h. The solvent is removed under reduced pressure and the crude precipitated in cold diethyl ether, centrifuged, dissolved in water/ACN and purify via HPLC (Water 0.10 TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 5:5 in 15 min) and lyophilized, to obtain a white solid. The compound is reacted with 2,3,5,6-tetrafluorophenyl 6-(trimethyl-λ.sup.4-azaneyl)nicotinate (2.0 eq) in dry acetonitrile (2 mL) overnight. The crude compound is reacted with [.sup.18F]TBAF (2.0 eq), TBAHCO.sub.3 (2.0 eq) in a mixture of tBuOH:MeOH (5:2) at 50° C. for 10 minutes to afford the final compound. MS(ES+) m/z 967.33 (M+1H).sup.1+
Synthesis of on-resin Cys(STrt)-Cys(STrt)-Asp(OtBu)-Lys(NHBoc)-Asp(OtBu)-NHFmoc
[0360] ##STR00193##
[0361] Commercially available pre-loaded Fmoc-Cys(Trt) on Tentagel resin (500 mg, 0.415 mmol, RAPP Polymere) was swollen in DMF (3×5 min×5 mL), the Fmoc group removed with 20% piperidine in DMF (1×1 min×5 mL and 2×10 min×5 mL) and the resin washed with DMF (6×1 min×5 mL). The peptide was extended with Fmoc-Cys(Trt), Fmoc-Asp(tBu)-OH, Fmoc-Lys(NHBoc)-OH and Fmoc-Asp(tBu)-OH in the indicated order. For this purpose, the Fmoc protected amino acid (2.0 eq), HBTU (2.0 eq), HOBt (2.0 eq) and DIPEA (4.0 eq) were dissolved in DMF (5 mL). The mixture was allowed to stand for 10 min at 0° C. and then reacted with the resin for 1 h under gentle agitation. After washing with DMF (6×1 min×5 mL) the Fmoc group was removed with 20% piperidine in DMF (1×1 min×5 min and 2×10 min×5 mL). Deprotection steps were followed by wash steps with DMF (6×1 min×5 mL) prior to coupling with the next amino acid.
Synthesis of (2R,5R,8S,11S,14S)-11-(4-aminobutyl)-8-(carboxymethyl)-14-(4-((4-((2-((S)-2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl-amino)-4-oxobutanamido)-2,5-bis(mercaptomethyl)-4,7,10,13-tetraoxo-3,6,9,12-tetraazahexadecanedioic acid (SH-Cys-SH-Cys-Asp-Lys-Asp-ESV6, P7)
[0362] ##STR00194##
[0363] On-resin Cys(STrt)-Cys(STrt)-Asp(OtBu)-Lys(NHBoc)-Asp(OtBu)-NHFmoc (80 mg, 0.04 mmol) was swollen in DMF (3×5 min×5 mL). The peptide was extended with (S)-4-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid (37 mg, 0.08 mmol, 2 eq), HATU (30 mg, 0.08 mmol, 2.0 eq), and DIPEA (28 μL, 0.16 mmol, 4.0 eq) and let react for 1 h under gentle agitation. After washing with DMF (6×1 min×5 mL), the compound was cleaved by agitating the resin with a mixture of TFA (150), TIS (2.5%) and H2O (2.5 h) in DCM for 4 h at room temperature. The resin was washed with methanol (2×5 mL) and the combined cleavage and washing solutions concentrated under vacuum. The crude product was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid (8 mg, 0.95 μmol, 2.4%). MS(ES+) m/z 1024.28 (M+H).sup.+
Synthesis of ESV6-ValCit-MMAE-bis (44)
[0364] ##STR00195##
[0365] SH-Cys-SH-Cys-Asp-Lys-Asp-ESV6 (P7, 1.2 mg, 1.175 mol, 1.0 eq) is dissolved in PBS pH 7.4 (840 μL). MC-ValCit-PAB-MMAE (4.6 mg, 3.525 μmol, 3.0 eq) is added as dry DMF solution (160 μL). The reaction is stirred for 3 h.
[0366] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 mi) and lyophilized, to obtain a white solid.
[0367] MS(ES+) m/z 3656.9 (M+H).sup.+
Synthesis of ESV6_2-ValCit-MMAE-bis (45)
[0368] ##STR00196##
[0369] SH-Cys-Asp-Lys-Asp-ESV6 (P7, 1 mg, 1.09 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (840 μL). MC-ValCit-PAB-MMAE (1.4 mg, 1.09 μmol, 1.0 eq) and OSu-Glu-ValCit-PAB-MMAE (1.4 mg, 1.09 μmol, 1.0 eq) are added as dry DMF solution (160 μL). The reaction is stirred for 3 h. The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid.
[0370] MS(ES+) m/z 3456.8 (M+H).sup.+
Synthesis of (S)-N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)-8-(hex-5-ynamido)quinoline-4-carboxamide (P8)
[0371] ##STR00197##
[0372] 5-hexynoic acid (94 mg, 0.84 mmol, 1.5 eq) was dissolved in 1.5 mL of DCM and 20 μL of DMF in a 25 mL round bottom flask. The mixture was cooled down at 0° C. and oxalyl chloride (107 mg, 0.84 mmol, 1.5 eq) was added dropwise. The ice bath was removed and the reaction stirred for 15 minutes. The mixture was then added to a cooled solution of Example 2-P4 in DMF. After 30 minutes, the crude was diluted with aqueous NaHCO.sub.3, extract with DCM, dried over Na.sub.2SO.sub.4 anhydrous, filter and concentrated. The crude was purified via chromatography (DCM/MeOH 100:0 to 90:10 in 10 min) to afford a yellow oil (78 mg. 0.267 mmol, 34%). MS(ES+) m/z 454.16 (M+1H).sup.1+
Synthesis of (S)-8-(4-(1-(5-((2-(2-(2-aminoethoxy)ethoxy)ethyl)amino)-5-oxopentyl)-1H-1,2,3-triazol-4-yl)butanamido)-N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)quinoline-4-carboxamide (P9)
[0373] ##STR00198##
[0374] Commercially available pre-loaded Amino-PEG2 on Tentagel resin (300 mg, 0.2 mmol, Novabiochem) was swollen in DMF (3×5 min×5 mL). The resin was extended with 5 azidovalerianic acid (2.0 eq), HBTU (2.0 eq), HOBt (2.0 eq) and DIPEA (4.0 eq) in DMF (5 mL). The mixture was allowed to stand for 10 min at 0° C. and then reacted with the resin for 1 h under gentle agitation. (S)-N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)-8-(hex-5-ynamido)quinoline-4-carboxamide (78 mg, 0.17 mmol, 0.86 eq), CuI (4 mg, 0.02 mmol, 0.1 eq) and TBTA (34 mg, 0.06 mmol, 0.3 eq) were dissolved in 5 mL of a mixture 1:1 DMF/THF.
[0375] The peptide was cleaved from the resin with a mixture of 20% TFA in DCM at room temperature for 1 h. The solvent was removed under reduced pressure and the crude precipitated in cold diethyl ether, centrifuged, dissolved in water/ACN and purify via HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 5:5 in 15 min) and lyophilized, to obtain a white solid (30 mg, 21%). MS(ES+) m/z 727.8 (M+H).sup.+
Synthesis of Conjugate 46
[0376] ##STR00199##
[0377] (S)-8-(4-(1-(5-((2-(2-(2-aminoethoxy)ethoxy)ethyl)amino)-5-oxopentyl)-1H-1,2,3-triazol-4-yl)butanamido)-N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)quinoline-4-carboxamide (1 mg, 1.4 μmol, 1.0 eq) was dissolved in THF (200 μL) and dry DIPEA (400 μg, 3.3 μmol, 2.4 eq) was added dropwise. FITC isomer I (0.8 mg, 2.1 μmol, 1.5 eq) was added as DMSO solution at the concentration of 1 mg in 20 μL, The reaction was stirred for 3 h, protected from light and the crude material was directly purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a yellow powder (1.1 mg, 70.4%). MS(ES+) m/z 1116.4 (M+H).sup.+
Synthesis of (S)-N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)-8-(hex-5-ynamido)quinoline-4-carboxamide (P10)
[0378] ##STR00200##
[0379] (S)-4-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid (50 mg, 0.11 mmol, 1 eq), propargylamine (7 mg, 0.13 mmol, 1.2 eq) and HATU (49 mg, 0.13 mmol, 1.2 eq) were dissolved in 2 mL of DCM and 100 μL of DMF. DIPEA (56 mg, 0.44 mmol, 4 eq) was added dropwise and the reaction was stirred for 30 minutes at room temperature. Water was added, separated from organic layer and then extracted three times with DCM. The crude was dried over sodium sulfate, filtered and evaporated. The crude was purified via chromatography (DCM/MeOH 100:0 to 95:5 in 10 min) to afford a dark oil (32 mg. 0.0638 mmol, 58%). MS(ES+) m/z 495.47 (M+1H).sup.+
Synthesis of Bi-ESV6-peptide (P11)
[0380] ##STR00201##
[0381] Commercially available pre-loaded Fmoc-Cys(Trt) on Tentagel resin (300 mg, 0.18 mmol, RAPP Polymere) was swollen in DMF (3×5 min×5 mL), the Fmoc group removed with 20% piperidine in DMF (1×1 min×5 mL and 2×10 min×5 mL) and the resin washed with DMF (6×1 min×5 mL). The peptide was extended with Fmoc-Asp(tBu)-OH, Fmoc-Lys(NHBoc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-N3-Lys, Fmoc-Asp(tBu)-OH and (S)-4-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid in the indicated order. For this purpose, the Fmoc protected amino acid (2.0 eq), HBTU (2.0 eq), HOBt (2.0 eq) and DIPEA (4.0 eq) were dissolved in DMF (5 mL). The mixture was allowed to stand for 10 min at 0° C. and then reacted with the resin for 1 h under gentle agitation. After washing with DMF (6×1 min×5 mL) the Fmoc group was removed with 20% piperidine in DMF (1×1 min×5 min and 2×10 min×5 mL). Deprotection steps were followed by wash steps with DMF (6×1 min×5 mL) prior to coupling with the next aminoacid. (S)-N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)-8-(hex-5-ynamido)quinoline-4-carboxamide (174 mg, 0.35 mmol, 2 eq), CuI (4 mg, 0.02 mmol, 0.1 eq) and TBTA (28 mg, 0.05 mmol, 0.3 eq) were dissolved in 5 mL of a mixture 1:1 DMF/THF. The peptide was cleaved from the resin with a mixture of 20% TFA in DCM at room temperature for 1 h. The solvent was removed under reduced pressure and the crude precipitated in cold diethyl ether, centrifuged, dissolved in water/ACN and purify via HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 5:5 in 15 min) and lyophilized, to obtain a white solid (18 mg, 6%). MS(ES+) m/z 1687.7 (M+H).sup.+
Synthesis of Conjugate 47
[0382] ##STR00202##
[0383] Bi-ESV6-Peptide (P11, 1 mg, 0.59 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (840 μL). Maleimido-Fluorescein (0.76 mg, 1.77 μmol, 3.0 eq) is added as dry DMF solution (160 μL). The reaction is stirred for 3 h.
[0384] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a yellow solid.
[0385] MS(ES+) m/z 2114.7 (M+H).sup.+
Synthesis of Conjugate 48
[0386] ##STR00203##
[0387] Bi-ESV6-Peptide (P11, 1 mg, 0.59 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (300 μL). Alexa Fluor™ 488 C5 Maleimide (200 μg, 0.29 μmol, 0.5 eq) is added as dry DMSO solution (200 μL). The reaction is stirred for 3 h.
[0388] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain an orange solid.
[0389] MS(ES+) m/z 2385. 8 (M+1H).sup.1+
Synthesis of Conjugate 49
[0390] ##STR00204##
[0391] Bi-ESV6-Peptide (P11, 1 mg, 0.59 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (840 μL). MC-ValCit-PAB-MMAE (1 mg, 0.76 μmol, 1.3 eq) is added as dry DMF solution (160 μL). The reaction is stirred for 3 h.
[0392] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid.
[0393] MS(ES+) m/z 3003.5 (M+H).sup.+
Synthesis of Conjugate 50
[0394] ##STR00205##
[0395] Bi-ESV6-Peptide (P11, 1 mg, 0.59 μmol, 3.3 eq) is dissolved in PBS pH 7.4 (300 μL). IRDye750 (200 μg, 0.174 μmol, 1.0 eq) is added as dry DMSO solution (200 μL). The reaction is stirred for 3 h.
[0396] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain an orange solid.
[0397] MS(ES+) m/z 2838.0 (M+1H).sup.1+
Synthesis of Conjugate 51
[0398] ##STR00206##
[0399] Bi-ESV6-Peptide (P11, 1 mg, 0.59 μmol, 1 eq) is dissolved in PBS pH 7.4 (300 μL). Maleimide-DOTA (465 μg, 0.59 μmol, 1.0 eq) is added as dry DMSO solution (200 μL). The reaction is stirred for 3 h.
[0400] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain an orange solid.
[0401] MS(ES+) m/z 2213.9 (M+1H).sup.1+
Synthesis of AlbuTag-ESV6-Peptide (P12)
[0402] ##STR00207##
[0403] Commercially available pre-loaded Fmoc-Cys(Trt) on Tentagel resin (300 mg, 0.18 mmol, RAPP Polymere) was swollen in DMF (3×5 min×5 mL), the Fmoc group removed with 20% piperidine in DMF (1×1 min×5 mL and 2×10 min×5 mL) and the resin washed with DMF (6×1 min×5 mL). The peptide was extended with Fmoc-Asp(tBu)-OH, Fmoc-Lys(NHBoc)-OH, Fmoc-Asp(tBu)-OH, Fmoc-N3-Lys, Fmoc-a(tBu)-Asp-OH, Fmoc-Glu(tBu)-OH and 4-(4-Iodophenyl) butanoic acid in the indicated order. For this purpose, the Fmoc protected amino acid (2.0 eq), HBTU (2.0 eq), HOBt (2.0 eq) and DIPEA (4.0 eq) were dissolved in DMF (5 mL). The mixture was allowed to stand for 10 min at 0° C. and then reacted with the resin for 1 h under gentle agitation. After washing with DMF (6×1 min×5 mL) the Fmoc group was removed with 20% piperidine in DMF (1×1 min×5 min and 2×10 min×5 mL). Deprotection steps were followed by wash steps with DMF (6×1 min×5 mL) prior to coupling with the next aminoacid. (S)-N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)-8-(hex-5-ynamido)quinoline-4-carboxamide
[0404] (174 mg, 0.35 mmol, 2 eq), CuI (4 mg, 0.02 mmol, 0.1 eq) and TBTA (28 mg, 0.05 mmol, 0.3 eq) were dissolved in 5 mL of a mixture 1:1 DMF/THF. The peptide was cleaved from the resin with a mixture of 20% TFA in DCM at room temperature for 1 h. The solvent was removed under reduced pressure and the crude precipitated in cold diethyl ether, centrifuged, dissolved in water/ACN and purify via HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 5:5 in 15 min) and lyophilized, to obtain a white solid (6 mg, 2%). MS(ES+) m/z 1646.6 (M+H).sup.+
Synthesis of Conjugate 52
[0405] ##STR00208##
[0406] AlbuTag-ESV6-Peptide (P12, 1 mg, 0.61 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (840 μL). Maleimido-Fluorescein (0.78 mg, 1.82 μmol, 3.0 eq) is added as dry DMF solution (160 μL). The reaction is stirred for 3h.
[0407] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a yellow solid.
[0408] MS(ES+) m/z 2073.6 (M+H).sup.+
Synthesis of Conjugate 53
[0409] ##STR00209##
[0410] AlbuTag-ESV6-Peptide (P12, 1 mg, 0.61 μmol, 1.0 eq) was dissolved in PBS pH 7.4 (300 μL). Alexa Fluor™ 488 C5 Maleimide (400 μg, 0.58 μmol, 0.95 eq) was added as dry DMSO solution (200 μL). The reaction was stirred for 3 h.
[0411] The crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.10% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain an orange solid (180 nmol, 30%). MS(ES+) m/z 2345. 7 (M+1H).sup.1+
Synthesis of Conjugate 54
[0412] ##STR00210##
[0413] AlbuTag-ESV6-Peptide (P12, 1 mg, 0.61 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (840 μL). MC-ValCit-PAB-MMAE (1 mg, 0.76 μmol, 1.25 eq) is added as dry DMF solution (160 μL). The reaction is stirred for 3 h.
[0414] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid.
[0415] MS(ES+) m/z 2963.8 (M+H).sup.+
Synthesis of Conjugate 55
[0416] ##STR00211##
[0417] AlbuTag-ESV6-Peptide (P12, 1 mg, 0.61 μmol, 1.0 eq) was dissolved in PBS pH 7.4 (300 μL). IRDye750 (400 μg, 0.384 μmol, 0.58 eq) was added as dry DMSO solution (200 μL). The reaction was stirred for 3 h.
[0418] The crude material was purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.10% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain an orange solid (55 nmol, 9%). MS(ES+) m/z 2797.9 (M+1H).sup.1+
Synthesis of Conjugate 56
[0419] ##STR00212##
[0420] AlbuTag-ESV6-Peptide (P12, 1 mg, 0.61 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (300 μL). Maleimide-DOTA (480 μg, 0.61 μmol, 1.0 eq) is added as dry DMSO solution (200 μL). The reaction is stirred for 3 h.
[0421] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain an orange solid.
[0422] MS(ES+) m/z 2172.7 (M+1H).sup.1+
Synthesis of Bi-ESV6 (P13)
[0423] ##STR00213##
[0424] Commercially available 2-Chloro-trityl chloride resin (300 mg) is swollen in DMF (3×5 min×5 mL). The resin is extended with NHFmoc-Azido-Lysine (1 mmol), HBTU (1.0 eq), HOBt (1.0 eq) and DIPEA (2.0 eq) in DMF (5 mL). The mixture is allowed to stand for 10 min at 0° C. and then react with the resin for 1 h under gentle agitation. The resin is then washed with methanol. The resin is extended with (S)-4-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid (1 mmol), HOBt (1.0 eq) and DIPEA (2.0 eq) in DMF (5 mL). (S)-N-(2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)-8-(hex-5-ynamido)quinoline-4-carboxamide (78 mg, 0.17 mmol, 0.86 eq), CuI (4 mg, 0.02 mmol, 0.1 eq) and TBTA (34 mg, 0.06 mmol, 0.3 eq) is dissolved in 5 mL of a mixture 1:1 DMF/THF. The peptide is cleaved from the resin with a mixture of 50% HFIP in DCM at room temperature for 1 h. The solvent is removed under reduced pressure and the crude precipitated in cold diethyl ether, centrifuged, dissolved in water/ACN and purify via HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 5:5 in 15 min) and lyophilized, to obtain a white solid. MS(ES+) m/z 1111.1 (M+H).sup.+
Synthesis of DOTA-GA-Bi-ESV6 (57)
[0425] ##STR00214##
[0426] Bi-ESV6 (P13, 45 mg, 40.5 μmol, 1.0 eq) is dissolved in dry DMSO (400 μL). Dicyclohexylcarbodiimide (10.9 mg, 52.7 μmol, 1.3 eq) and N-hydroxysuccinimide (14 mg, 122 μmol, 3 eq) are added and the reaction was stirred overnight at room temperature, protected from light.
[0427] 100 μL of PBS solution containing 2,2′,2″-(10-(4-((2-aminoethyl)amino)-1-carboxy-4-oxobutyl)-1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetic acid (25 mg, 48.6 μmol, 1.2 eq) is added and the reaction was stirred for 2h.
[0428] The crude product is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid.
[0429] MS(ES+) m/z 1624.8 (M+H).sup.+
General Procedure for Synthesis of MC-Aminoacids(OtBu)
[0430] ##STR00215##
[0431] The above general procedure can be performed as described below, e.g., for AA=glycine.
[0432] 6-maleimidohexanoic acid (1.0 eq) is dissolved in dry CH2Cl2 (1 mL/mmol) under argon atmosphere and the solution was cooled to 0° C. EDC HCl (1.1 eq), DIPEA (2.3 eq) and the desired H-AA-OtBu.HCl (1.1 eq) are added subsequently. The reaction is stirred at room temperature until completion. The mixture is diluted with AcOEt, washed with aqueous KHSO.sub.4 1M, saturated NaHCO.sub.3 solution and brine. The organic phase is dried and concentrated to afford the desired product as white powder.
General Procedure for Synthesis of MC-Aminoacids
[0433] ##STR00216##
[0434] The above general procedure can be performed as described below, e.g., for R corresponding to AA=glycine.
[0435] Desired MC-Aminoacid-OtBu (1.0 eq) is dissolved in dry CH2C12 (0.3 mL/mmol) under argon atmosphere. TFA (22.0 eq) is added and the mixture is stirred at room temperature for 2 hours. The solution is concentrated and precipitated with hexane, affording the product as white powder.
Synthesis of (9H-fluoren-9-yl)methyl (2S)-2-((4-(hydroxymethyl)phenyl)carbamoyl)-1λ.SUP.4.-pyrrolidine-1-carboxylate
[0436] ##STR00217##
[0437] Fmoc-Pro-OH (312 mg; 0.92 mmol; 1.0 eq) and HATU (393 mg; 1.01 mmol; 1.1 eq) were dissolved in dry DMF (4 mL) under argon atmosphere and the solution was cooled to 0° C. DIPEA (505 μL; 2.76 mmol; 3.0 eq) was added dropwise and the mixture was stirred at the same temperature for 15 minutes. 4-aminobenzyl alcohol (226 mg, 1.84 mmol, 2 eq.) was added as a solution in dry DMF. The mixture was stirred overnight at room temperature. The reaction mixture was diluted with AcOEt and washed with aqueous 1M KHSO.sub.4, saturated NaHCO.sub.3 and brine. The pooled organic phases were dried and concentrated under vacuum. The crude was purified via chromatography (DCM/MeOH 99:1 to 95:5 in 10 min) to afford the product as a white powder (274 mg; 0.66 mmol; 66% yield). MS(ES+) m/z 443.19 (M+1H).sup.1+
Synthesis of (S)-N-(4-(hydroxymethyl)phenyl)pyrrolidine-2-carboxamide
[0438] ##STR00218##
[0439] (9H-fluoren-9-yl)methyl (2S)-2-((4-(hydroxymethyl)phenyl)carbamoyl)-1λ.sup.4-pyrrolidine-1-carboxylate (274 mg; 0.66 mmol) is dissolved in dry DMF (30 mL) under argon atmosphere and cooled to 0° C. Piperidine (325 μL; 3.29 mmol) is added and the mixture is stirred at room temperature for 1 hour. The solution is concentrated under high vacuum, dissolved in AcOEt (100 mL), washed with aqueous NaHCO.sub.3 and brine. The organic phase is dried and concentrated under vacuum. The crude material is purified via chromatography (DCM/MeOH 99:1 to 90:10 with 0.5% TEA), to afford the product as a brown oil.
[0440] MS(ES+) m/z 221.12 (M+1H).sup.1+
General Procedure for Synthesis of MC-AA-Pro-PAB
[0441] ##STR00219##
[0442] Desired MC-Aminoacid (1.1 eq) is dissolved in dry DMF (0.5 mL/mmol) under argon atmosphere and the solution is cooled to 0° C. HATU (1.1 eq), (S)-N-(4-(hydroxymethyl)phenyl)pyrrolidine-2-carboxamide (1.0 eq) and DIPEA (1.5 eq) are added subsequently. The reaction is allowed to slowly reach room temperature and stirred overnight. The mixture is diluted with AcOEt and washed with 1M KHSO.sub.4 and brine. The organic phase is dried and concentrated under vacuum and the crude is purified via chromatography (DCM/MeOH 93:7) to afford the desired MC-AA-Pro-PAB
General Procedure for Synthesis of MC-AA-Pro-PAB-PNP
[0443] ##STR00220##
[0444] A solution of 4-Nitrophenyl chloroformate (2.2 eq) in dry CH.sub.2Cl.sub.2 (1 mL/mmol) is added under argon atmosphere to a suspension of the desired MC-AA-Pro-PAB (1.0 eq) in dry CH.sub.2Cl.sub.2 (1 mL/mmol) and pyridine (1.5 eq). After completion the solvent is removed under vacuum and the crude mixture is filtered over a pad of silica eluting with AcOEt to give MC-AA-Pro-PAB-PNP.
General Procedure for Synthesis of MC-AA-Pro-PAB-MMAE
[0445] ##STR00221##
[0446] Monomethyl auristatin E (MMAE-TFA 1.1 eq) is dissolved in dry DMF (200 μL) under nitrogen atmosphere. MC-AA-Pro-PAB-PNP (1.0 eq), HOAt (0.5 eq) and DIPEA (5.0 eq) are added subsequently. The mixture is stirred at room temperature for 48 hours and concentrated under vacuum. The crude is diluted with a 200 μl of a mixture 1:1 water/methanol, and purified over reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) to obtain the desired w products as white solids.
General Procedure for Synthesis of ESV6-AA-Pro-MMAE (58)
[0447] ##STR00222##
[0448] SH-Cys-Asp-Lys-Asp-ESV6 (P7, 700 μg, 0.760 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (840 μL). MC-AA-Pro-PAB-MMAE (1.0 eq) is added as dry DMF solution (160 μL). The reaction is stirred for 3 h.
[0449] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid.
[0450] The AA used, the m/z and the yield of the derivatives are listed in the table below
TABLE-US-00006 Compound AA MS(ES+) m/z (M + 1H).sup.1+ 58a Glycine 2136.0 58b Alanine 2150.0 58c Valine 2178.1 58d Isoleucine 2192.1 58e Proline 2176.1 58f Arginine 2235.1
General Procedure for Synthesis of Py-S-S-MMAE
[0451] ##STR00223##
[0452] Monomethyl auristatin E (MMAE-TFA 1.1 eq) is dissolved in dry DMF (200 μL) under nitrogen atmosphere. Variously substituted 4-nitrophenyl (2-(pyridin-2-yldisulfaneyl)ethyl) carbonate (1.0 eq), HOAt (0.5 eq) and DIPEA (5.0 eq) are added subsequently. The mixture is stirred at room temperature for 48 hours and concentrated under vacuum. The crude is diluted with a 200 μl of a mixture 1:1 water/methanol, and purified over reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min). to obtain the desired products as white solids.
General Procedure for Synthesis of ESV6-S-S-MMAE (59)
[0453] ##STR00224##
[0454] SH-Cys-Asp-Lys-Asp-ESV6 (P7, 700 μg, 0.760 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (840 μL). Desired Py-S-S-MMAE (1.0 eq) is added as dry DMF solution (160 μL). The reaction is stirred for 3 h.
[0455] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid.
[0456] The R group used, the m/z and the yield of the derivatives are listed in the table below
TABLE-US-00007 Compound R R′ MS(ES+) m/z (M + 1H).sup.1+ 59a —H —H 1740.6 59b —CH.sub.3 —H 1755.6 59c —CH.sub.3 —CH.sub.3 1770.6
Synthesis of PenCys-Asp-Lys-Asp-ESV6 peptide (P14)
[0457] ##STR00225##
[0458] Commercially available 2-Chloro-trityl chloride resin (300 mg) is swollen in DMF (3×5 min×5 mL). The resin is extended with Fmoc-PenCys(Trt), Fmoc-Asp(tBu)-OH, Fmoc-Lys(NHBoc)-OH and Fmoc-Asp(tBu)-OH in the indicated order. For this purpose, the Fmoc protected amino acid (2.0 eq), HBTU (2.0 eq), HOBt (2.0 eq) and DIPEA (4.0 eq) are dissolved in DMF (5 mL). The resin is extended with (S)-4-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid (1 mmol), HBTU (2.0 eq) and DIPEA (2.0 eq) in DMF (5 mL). The peptide is cleaved from the resin with a mixture of 50% HFIP in DCM at room temperature for 1 h. The solvent is removed under reduced pressure and the crude precipitated in cold diethyl ether, centrifuged, dissolved in water/ACN and purify via HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 5:5 in 15 min) and lyophilized, to obtain a white solid. MS(ES+) m/z 949.3 (M+H).sup.+
General Procedure for Synthesis Synthesis of PenESV6-S-S-MMAE (60)
[0459] ##STR00226##
[0460] PenCys-Asp-Lys-Asp-ESV6 (700 μg, 0.760 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (840 μL). Desired Py-S-S-MMAE (1.0 eq) was added as dry DMF solution (160 μL). The reaction is stirred for 3 h.
[0461] The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a white solid.
[0462] The R group used and the m/z of the derivatives are listed in the table below
TABLE-US-00008 Compound R R′ MS(ES+) m/z (M + 1H).sup.1+ 60a —H —H 1770.6 60b —CH.sub.3 —H 1785.6 60c —CH.sub.3 —CH.sub.3 1800.6
Synthesis of (S)-N.SUP.1.-(4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)-N.SUP.4.-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)ethyl)succinimide (P15)
[0463] ##STR00227##
[0464] (S)-4-((4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)amino)-4-oxobutanoic acid (65 mg, 0.14 mmol, 1 eq), HATU (54 mg, 0.14 mmol, 1 eq) and 1-(2-Aminoethyl)maleimide HCl (25 mg, 0.14 mmol, 1 eq) were dissolved in 1.5 mL of DCM and 500 μL of DMF. DIPEA (54 mg, 0.43 mmol, 3 eq) was added dropwise and the reaction was stirred for 30 minutes at room temperature. Water was added, separated from organic layer and then extracted three times with DCM. The crude was dried over sodium sulfate, filtered and evaporated. The crude was purified via chromatography (DCM/MeOH 100:0 to 95:5 in 10 min) to afford a yellow oil (50 mg. 0.0868 mmol, 62%). MS(ES+) m/z 582.6 (M+1H).sup.1+
Synthesis of Conjugate 66
[0465] ##STR00228##
[0466] SH-Cys-Asp-Lys-Asp-ESV6 (2 mg, 2.171 μmol, 1.0 eq) is dissolved in PBS pH 7.4 (800 μL). Maleimido-NODAGA (3.3 mg, 4.343 μmol, 2.0 eq) is added as dry DMSO solution (200 μL). The reaction is stirred for 3 h. The crude material is purified by reversed-phase HPLC (Water 0.1% TFA/Acetonitrile 0.1% TFA 9.5:0.5 to 2:8 in 20 min) and lyophilized, to obtain a yellow solid. MS(ES+) m/z 1346.36 (M+1H).sup.1+
General synthesis of Protein-OncoFAP
[0467] ##STR00229##
[0468] The protein is reduced overnight at 4° C. using 30 equivalents of TCEP-HCl per cysteine residue. The product is purified via FPLC and the fractions containing the products are merged.
[0469] The reduced protein is then reacted with 20 equivalents per cysteine residue with (S)-N-(4-((2-(2-cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)carbamoyl)quinolin-8-yl)-N.sup.4-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)ethyl)succinamide for 1 hour at room temperature, under gentle shaking.
[0470] The product is then purified via FPLC and analyzed with LC/MS to confirm the identity.
[0471] The described protocol can be used to functionalize proteins, enzymes, targets, antibodies, immunocytokines, pro-inflammatory proteins and peptides containing one or more cysteine residues.
[0472] Further examples of protein conjugates according to the present invention are: protein coupled to FAP targeting agent (e.g., conjugate 63, 63a), and protein coupled to multiple FAP targeting agents (e.g., 69, 69a), as exemplified below. The ball represents a generic protein structure.
##STR00230##