Immune cell compositions and methods of using same

11648268 · 2023-05-16

Assignee

Inventors

Cpc classification

International classification

Abstract

Disclosed herein are cells that are immunoinhibitory cell, which cells recombinantly express a dominant negative form of an inhibitor of a cell-mediated immune response of the cell. In certain embodiments, the immunoinhibitory cell is a regulatory T cell. In another aspect, provided herein is a regulatory T cell that recombinantly expresses a dominant negative form of an inhibitor of a regulatory T cell-mediated immune response. The cells can be sensitized to an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder. Additionally provided are methods of using such cells to treat an immune-mediated disorder in a subject in need thereof.

Claims

1. A cell that is an immunoinhibitory cell that recombinantly expresses (a) a dominant negative form of programmed death 1 (PD-1), wherein the dominant negative form of PD-1 comprises (i) at least a portion of an extracellular domain of PD-1, said portion comprising the ligand binding region, and (ii) a transmembrane domain derived from a heterologous polypeptide; wherein the dominant negative form of PD-1 lacks any functional signaling domain; and (b) a chimeric antigen receptor (CAR) that binds to an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder.

2. The cell of claim 1, wherein the immunoinhibitory cell is a regulatory T cell.

3. A polyclonal population of human regulatory T cells that are CD4.sup.+CD25.sup.+, and recombinantly express (a) a dominant negative form of programmed death 1 (PD-1), wherein the dominant negative form of PD-1 comprises (a) at least a portion of an extracellular domain of PD-1, said portion comprising the ligand binding region, and (b) a transmembrane domain derived from a heterologous polypeptide; wherein the dominant negative form of PD-1 lacks any functional signaling domain; and (b) a chimeric antigen receptor (CAR) that binds to an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder.

4. A pharmaceutical composition comprising a therapeutically effective amount of the cell of claim 1; and a pharmaceutically acceptable carrier.

5. A method of treating an immune-mediated disorder in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of the cell of claim 1.

6. The method of claim 5, wherein the immune-mediated disorder is selected from the group consisting of organ transplant rejection, an autoimmune disorder, multiple sclerosis, type 1 diabetes, rheumatoid arthritis, primary biliary cirrhosis, myasthenia gravis, vitiligo, lupus, an allergic disorder, fetomaternal intolerance, and Alzheimer's disease.

7. A method of decreasing the risk of organ transplant rejection in an organ transplant recipient in need thereof comprising administering to the recipient a therapeutically effective amount of the cell of claim 1, which cell expresses a CAR that binds to an antigen of the organ transplant associated with organ transplant rejection.

8. A method of promoting self-tolerance or reestablishing immunological tolerance to a self-antigen in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of the cell of claim 1, wherein the cell is a regulatory T cell specific to the self-antigen, or the population comprises regulatory T cells specific to the self-antigen.

9. A method of treating arthritis in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of the cell of claim 1, wherein the cell is administered intraarticularly or directly at a tendon insertion site of an arthritic joint.

10. The cell of claim 1, wherein the transmembrane domain is the transmembrane domain of CD8.

11. The cell of claim 2, wherein the transmembrane domain is the transmembrane domain of CD8.

12. The polyclonal population of claim 3, wherein the transmembrane domain is the transmembrane domain of CD8.

13. A pharmaceutical composition comprising a therapeutically effective amount of the cell of claim 2; and a pharmaceutically acceptable carrier.

14. A pharmaceutical composition comprising a therapeutically effective amount of the polyclonal population of claim 3; and a pharmaceutically acceptable carrier.

15. A pharmaceutical composition comprising a therapeutically effective amount of the cell of claim 10; and a pharmaceutically acceptable carrier.

16. A pharmaceutical composition comprising a therapeutically effective amount of the cell of claim 11; and a pharmaceutically acceptable carrier.

17. A pharmaceutical composition comprising a therapeutically effective amount of the cell of claim 12; and a pharmaceutically acceptable carrier.

18. The cell of claim 2, wherein the regulatory T cell is a human CD4.sup.+CD25.sup.+ T cell.

19. The cell of claim 2, wherein the regulatory T cell is a human CD4.sup.+CD127.sup.lo/−CD25.sup.+ T cell.

20. The cell of claim 1, wherein the immunoinhibitory cell is a follicular regulatory T cell.

21. The cell of claim 1, wherein the cell is FoxP3.sup.+.

22. The cell of claim 1, wherein the immunoinhibitory cell is a regulatory B cell.

23. The cell of claim 1, wherein the immune-mediated disorder is selected from the group consisting of organ transplant rejection, an autoimmune disorder, multiple sclerosis, type 1 diabetes, rheumatoid arthritis, primary biliary cirrhosis, myasthenia gravis, vitiligo, lupus, and an allergic disorder.

Description

5. DESCRIPTION OF THE DRAWINGS

(1) FIGS. 1A-1E show that chimeric antigen receptors (CARs) with CD28 or 4-1BB costimulation exhibit equivalent effector cytokine secretion and proliferation in vitro upon initial antigen stimulation. FIG. 1A. First- and second-generation CARs. FIG. 1B. Mesothelin (MSLN)-targeted CARs contain the CD3ζ endodomain either alone (Mz, first-generation CAR) or in combination with the CD28 (M28z) or 4-1BB (MBBz) costimulatory domain (second-generation CAR). A prostate-specific membrane antigen (PSMA)-directed CAR with CD28 costimulation (P28z) as well as PSMA-expressing targets (PSMA+) are included in experiments as negative controls. CYT, cytoplasmic domain; LS, leader sequence; LTR, long terminal repeat; SA, splice acceptor; SD, splice donor; TM, transmembrane. FIGS. 1C-1E. Antigen-specific effector functions of CAR-transduced T cells. FIG. 1C. Lysis of MSLN-expressing targets (MSLN+), but not PSMA+ targets, as measured by chromium-release assays. FIG. 1D. 4-1BB and CD28 costimulations enhance cytokine secretion, as assessed by Luminex assay, after coculture of CAR T cells with MSLN+ cells. FIG. 1E. M28z and MBBz CARs facilitate robust T-cell accumulation after stimulation with MSLN+ cells. Data represent the mean±SEM (FIGS. 1C, 1E) of three replicates or are plotted as individual points (FIG. 1D). ***P<0.001, comparing costimulated CAR T cells (M28z or MBBz) with the first-generation receptor (Mz), by Student's t test; significance was determined using the Bonferroni correction for multiple comparisons.

(2) FIG. 2 shows efficient retroviral transduction of human T cells to express Mz, M28z, and MBBz CARs. (Top) Shown is representative FACS analysis 4 days after gene transfer. Fluorescence minus one staining was used to set positive gates after a live/dead stain excluded nonviable cells. All experiments used T cells with 50% to 70% CAR transduction efficiency; transduction percentages between T-cell groups were within 5% of each other. (Bottom) Both CD4+ and CD8+ T-cell subsets were efficiently transduced. CD4+ and CD8+ percentages after gating for CAR T cells are shown.

(3) FIGS. 3A-3D show that CAR T cells become exhausted following in vivo antigen exposure, although MBBz CAR T cells preferentially retain effector cytokine secretion and cytotoxicity. FIG. 3A. Six days after intrapleural administration of CAR T cells, M28z and MBBz CAR T cells were isolated from the tumor and spleen and subjected to ex vivo antigen stimulation. FIG. 3B. Chromium-release assay upon ex vivo stimulation demonstrates a decrease in M28z but persistent MBBz cytolytic function (E:T ratio 1:5). FIG. 3C. Cytokine secretion measurements demonstrate decreases in effector cytokine secretion by CAR T cells, although MBBz CAR T cells are better able to retain secretion. FIG. 3D. RT-PCR measurements of GzB, IFN-γ, and IL-2 expression by harvested CAR T cells correlate well with protein level measurements. Data represent the fold-change relative to the mRNA expression of unstimulated M28z CAR T cell in vitro. Data represent the mean±SEM of three individual wells per condition. Student's t tests were performed, and statistical significance was determined using the Bonferroni correction for multiple comparisons (*P<0.05; **P<0.01; ***P<0.001). Results are reproduced in two separate cohorts of mice used for each of the two experiments. In each of FIGS. 3B-3D, each pair of bar graphs show, from left to right, M28z, MBBZ.

(4) FIGS. 4A-4E show that CAR T cells become exhausted upon repeated antigen stimulation in vitro, although MBBz CAR T cells preferentially retain effector cytokine secretion and cytotoxicity in vitro and upon tumor rechallenge in vivo. FIG. 4A. Both M28z and MBBz CAR T cells retain proliferative capacity in vitro upon repeated antigen stimulation. T cells were also tested for cytotoxicity by chromium-release assay and for cytokine secretion by Luminex assay (FIGS. 4B-4D). FIG. 4B. CAR T cells demonstrate equal killing at the first stimulation (left) and loss of cytolytic function upon repeated antigen stimulation, although MBBz CAR T cells are better able to retain cytolytic function as measured by chromium-release assay (circles, MZ; triangles, M28z; diamonds, MBBz). FIG. 4C. Cytotoxic granule release as measured by CD107a expression (shown at the third stimulation) correlates with chromium release assay (FIG. 4B). Data represent the mean±SD (triplicates) of the fold-change relative to the CD107a MFI of unstimulated CAR T cells (each pair of bar graphs shows, from left to right, M28z, MBBz). FIG. 4D. Cytokine secretion measurements similarly demonstrate loss of CAR T-cell effector function upon repeated antigen encounter; again, MBBz CAR T cells are better able to preserve their function (each set of symbols above “Stim 1,” “Stim 2” and “Stim 3” are, from left to right, Mz, M28z, MBBz). FIG. 4E. Although equally persistent, MBBz CAR T cells demonstrate superior functional persistence. Twenty-eight days after pleural tumor eradication (following a single dose of 1e.sup.5 CAR T cells), 1e.sup.6 MSLN+ tumor cells were injected into the pleural cavity (tumor rechallenge). MBBz CAR T cells prevented tumor growth in all mice, whereas tumor growth and death were observed in 2 of 4 mice initially treated with M28z CAR T cells. Student's t tests were performed and statistical significance was determined using the Bonferroni correction (*P<0.05; ***P<0.001). Data represent the mean±SEM of three replicates or are plotted as individual points.

(5) FIG. 5 shows that MBBz CAR T cells express a less exhausted, more potent phenotype compared to M28z CAR T cells. 4-1BB- and CD28-costimulated T cells were expanded with repeated antigen stimulation, and mRNA was extracted and subjected to RT-PCR analysis 20 h after the third stimulation. Data are represented in fold change relative to the mRNA expression of CD4+ unstransduced T cells. MBBz CAR T cells express higher levels of EOMES (Eomesodermin) and TBX21 (T-bet), and lower levels of PDCD1 (PD-1) and FOXP3 (Foxp3). All comparisons were significant at P<0.001. Results were similar in 3 separate experiments using different donors. Each group of bar graphs shows, left to right, UT (untransduced T cells used as a control), M28z, MBBz.

(6) FIGS. 6A-6F show that PD-1 receptor and its ligands are upregulated in vivo (FIGS. 6A-6D, harvested T cells; FIGS. 6E-6F, tumor cells). FIG. 6A. Tumor-infiltrating M28z and MBBz CAR T cells express inhibitory receptors 6 days after their administration, but MBBz CART cells express lower levels of PD-1. FIG. 6B. Mean fluorescence intensity (MFI) of PD-1 receptor expression of tumor-infiltrating CAR T cells (TIL) 6 days after intrapleural administration. FIG. 6C. Relative expression of PD-1 mRNA in CD4 and CD8 subsets of tumor-infiltrating CAR T cells 6 days after intrapleural administration. Data are represented in fold-change relative to the PD-1 mRNA expression of unstimulated M28z T cells (for each pair of bar graphs, M28z, left, MBBz, right). FIG. 6D. Tumor-infiltrating M28z CAR T cells isolated from progressing tumors express inhibitory receptors PD-1, Tim-3, and Lag-3. FIG. 6E. Single-cell tumor suspensions harvested from mice treated with M28z CAR T cells express high levels of PD-1 binding ligands. FIG. 6F. In vitro cultured mesothelioma tumor cells express the ligands (PD-L1, PD-L2) for the PD-1 receptor, and expression is further upregulated following incubation for 24 h with IFN-γ and TNF-α.

(7) FIG. 7 shows M28z and MBBz CAR T cells coexpress PD-1 along with other inhibitory receptors. Tumor-infiltrating M28z and MBBz CAR T cells were harvested 6 days following intrapleural administration to pleural tumor bearing mice. Cells were costained with antibodies for PD-1 and for either LAG-3 (left) or TIM-3 (right) and analyzed by flow cytometry. Isotype staining controls (top) were used to establish positive gates.

(8) FIGS. 8A-8D show that PD-L1 inhibits CAR T-cell effector function. FIG. 8A. 3T3 fibroblasts were transduced to either express mesothelin alone (MSLN+, left) or coexpress MSLN in addition to PD-L1 (MSLN+PD-L1+, right). FIGS. 8B-8D. M28z and MBBz CAR T-cell effector functions were assessed after stimulation with 3T3 MSLN+ or MSLN+PD-L1+ targets. PD-L1 inhibits M28z and MBBz CAR T-cell accumulation upon repeated antigen stimulation (FIG. 8B), cytolytic function following two stimulations with MSLN+PD-L1+ tumor cells (FIG. 8C), and Th1 effector cytokine secretion upon the first stimulation (FIG. 8D). Data represent the mean±SEM of three replicates or are plotted as individual points.

(9) FIGS. 9A-9E show that cotransduction of a PD-1 dominant negative receptor (PD-1 DNR) rescues M28z CAR T cells from PD-1 Ligand-mediated inhibition in vitro and in vivo. FIG. 9A. (Left) Schematic representations of CD28-costimulated T cells binding tumor ligand via the endogenous PD-1 receptor (transmitting a coinhibitory signal) or a cotransduced PD-1 DNR lacking an inhibitory signaling domain. (Right) For in vitro and in vivo experiments, M28z CAR T cells were cotransduced with either empty vector (EV; SFG-mCherry) or PD-1 DNR (SFG-2A-PD-1 DNR). CAR T cells sorted for mCherry expression were then incubated for 24 h with MSLN+ tumor cells that had been treated with IFN-γ and TNF-α to upregulate PD-1 ligands. M28z PD-1 DNR CAR T cells demonstrated a small but statistically significant enhancement in accumulation upon repeated antigen stimulation (FIG. 9B; triangles, M28z EV; squares, M28z PD-1 DNR), an enhanced cytolytic function, as measured by chromium release assay upon the 3rd stimulation with MSLN+PD-L1+ tumor cells (FIG. 9C; triangles, M28z EV; squares, M28z PD-1 DNR), and an increased expression of Th1 supernatant cytokines upon initial stimulation (FIG. 9D). Student's t tests were performed, and statistical significance was determined using the Bonferroni correction for multiple comparisons (*P<0.05; **P<0.01; ***P<0.001). Data represent the mean±SEM of triplicates or are plotted as individual points. FIG. 9E. Tumor BLI (left) and Kaplan-Meier survival analysis (right) comparing the in vivo efficacy of a single dose of 5e4 M28z EV (n=19) or M28z PD-1 DNR (n=16) pleurally administrated. Data shown are a combination of two independent experiments. The (custom character) symbol indicates death. Median survival is shown in days. The survival curve was analyzed using the log-rank test (P=0.001). The log-rank test for each independent experiment was significant to the P<0.05 level; two experiments are combined for illustration. A cohort of the mice (M28z PD-1 DNR) in this experiment survived beyond 450 days in spite of repeated tumor rechallenge, demonstrating the “functional persistence” of CAR T cells transduced with PD-1 DNR.

(10) FIGS. 10A-10E show that cotransduction of PD-1 receptor-targeting shRNAs rescues M28z CAR T cells from PD-L1/PD-1-mediated inhibition in vitro. FIG. 10A. (Left) Schematic representation of CD28-costimulated T cells binding tumor-expressed PD-L1 via endogenous PD-1 receptor, with or without coexpression of PD-1-targeting shRNA. (Right) All experiments included M28z CAR T cells cotransduced with one of two PD-1-targeting shRNAs (sh1 or sh2 coexpressing a dsRED reporter) or with an shRNA targeting a bacterial sequence (KanR). FIG. 10B. Compared with KanR-transduced cells, M28z CAR T cells cotransduced with PD-1-targeting shRNAs demonstrated a 60% to 70% knockdown in PD-1 receptor protein expression upon stimulation with phytohemagglutinin (graphs left to right correspond to 430, 722, 813 and 1411). Cells were incubated with either 3T3 fibroblasts overexpressing PD-L1 (3T3 MSLN+PD-L1+) or mesothelioma tumor cells that had been treated with IFN-γ and TNF-α in order to upregulate PD-L1 and PD-L2. M28z PD1 shRNA CAR T cells demonstrate enhanced accumulation upon repeated antigen stimulation (FIG. 10C), enhanced cytolytic function at low effector to target ratios, as measured by luciferase activity of remaining live tumor cells (FIG. 10D; each group of bar grafts, from left to right, Sh1, Sh2, ShK), and increased Th1 cytokine secretion (FIG. 10E; each group of bar grafts, from left to right, Sh1, Sh2, ShK) (**P<0.01; ***P<0.001). Student's t tests were performed and statistical significance was determined using the Bonferroni correction for multiple comparisons. Data represent the mean±SEM of three replicates.

(11) FIG. 11 shows an adhesion assay of PD-1 DNR to PD-L1 and PD-L2 recombinant proteins fused to an Fc domain. T cells labeled with mCherry and transduced with PD-1 DNR were exposed to plates coated with PD-L1 fused to Fc (“PD-L1 Fc”), PD-L2 fused to Fc (“PD-L2 Fc”), or control isotype Fc (“Iso Fc”). T cells bound to the plates were measured as absolute mcherry+ T cell count in the presence (“+PD-1 Ab”) or absence of PD-1 antibody. The bar graphs show the binding for each of the respectively coated plates, from left to right, T cells alone (“T cells”), T cells in the presence of PD-1 antibody (T cells+PD-1 ab”), T cells transduced with PD-1 DNR (“PD-1 DNR T cells”), and T cells transduced with PD-1 DNR in the presence of PD-1 antibody (“PD-1 DNR T cells+PD-1 Ab”).

(12) FIGS. 12A-12D show that a PD-1 DNR, which inhibits PD-L1- or PD-L2-mediated inhibition of T cell activation, can be converted into a positive co-stimulatory signal. FIG. 12A shows a schematic diagram illustrating co-expression of a CAR and a PD-1 DNR. FIG. 12B shows a schematic diagram illustrating co-expression of a CAR and a PD-1 DNR converted into a costimulatory construct by fusing a costimulatory domain, exemplified as 4-1 BB, to a transmembrane domain fused to the ligand binding domain of PD-1. FIG. 12C shows accumulation of CAR T cells at day 0 and day 7 in T cells transduced with M28z CAR, M28z CAR plus PD-1 DNR, or M28z CAR plus a PD-1 4-1BB switch receptor construct. Bars left to right respectively: M28z CAR, M28z CAR+PD-1 DNR, and M28z CAR+PD-1 4-1BB switch receptor construct. FIG. 12D shows cytokine secretion of interferon gamma (IFN-γ), interleukin 2 (IL-2), tumor necrosis factor alpha (TNF-α) and granulocyte-macrophage colony-stimulating factor (GM-CSF) in T cells transduced with M28z CAR, M28z CAR plus PD-1 DNR or M28z CAR plus a PD-1 4-1BB switch receptor construct. Bars left to right respectively: M28z CAR, M28z CAR+PD-1 DNR, and M28z CAR+PD-1 4-1BB switch receptor construct.

6. DETAILED DESCRIPTION OF THE INVENTION

(13) The present invention relates to compositions and methods for treating immune-mediated disorders. Such disorders include, but are not limited to, organ transplant rejection, autoimmune disorders, allergic disorders, fetomaternal intolerance, and Alzheimer's disease. As described herein, immunoinhibitory cells can be genetically engineered to intrinsically express proteins that are dominant negative mutants and that inhibit blockades that limit the immunosuppressive effect of the immunoinhibitory cells. By inhibiting the blockade, the genetically engineered immunoinhibitory cells are permitted to provide a more effective immunosuppressive activity against pathological immune responses in immune-mediated disorders.

(14) In one aspect, provided herein is a cell that is an immunoinhibitory cell, which cell recombinantly expresses a dominant negative form of an inhibitor of a cell-mediated immune response of the cell. In another aspect, provided herein is a population (preferably, a polyclonal population) of human regulatory T cells that are CD4.sup.+CD25.sup.+, and recombinantly express a dominant negative form of an inhibitor of a regulatory T cell-mediated immune response. In a specific embodiment, the polyclonal population is purified. In a specific embodiment, the polyclonal population is ex vivo. In a specific embodiment, the polyclonal population is present in a population enriched for the polyclonal population. In another aspect, provided herein is a regulatory T cell that recombinantly expresses a dominant negative form of an inhibitor of a regulatory T cell-mediated immune response. In another aspect, provided herein are pharmaceutical compositions comprising a therapeutically effective amount of a cell or population of the invention; and a pharmaceutically acceptable carrier.

(15) In yet another aspect, provided herein is a method of treating an immune-mediated disorder in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of the cell or population of the invention. In certain embodiments, the immune-mediated disorder is selected from the group consisting of organ transplant rejection, an autoimmune disorder, multiple sclerosis, type 1 diabetes, arthritis, for example, rheumatoid arthritis or other types of arthritis, primary biliary cirrhosis, myasthenia gravis, vitiligo, lupus, an allergic disorder, fetomaternal intolerance and Alzheimer's disease. In another aspect, provided herein is a method of promoting self-tolerance or reestablishing immunological tolerance to a self-antigen in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of the cell or population of the invention, wherein the cell is a pathologic self-antigen specific regulatory T cell, or the population comprises pathologic self-antigen specific regulatory T cells. In another aspect, the invention provides a method of treating arthritis in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of the cell or population of the invention, wherein the cell or population is administered intraarticularly or directly at a tendon insertion site of an arthritic joint. In another aspect, the invention provides a method of treating an immune-mediated disorder in a patient in need thereof, comprising isolating regulatory T cells from the patient, expanding the regulatory T cells in cell culture in vitro, and administering the expanded regulatory T cells to the patient in a therapeutically effective amount, wherein the isolated regulatory T cells are transduced to express a dominant negative form of an inhibitor of a regulatory T cell-mediated immune response.

(16) 6.1 Cells

(17) The invention provides cells that are immunoinhibitory cells that recombinantly express a dominant negative form (hereinafter “DN form”) of an inhibitor of a cell-mediated immune response, preferably of the immunoinhibitory cell. In one embodiment, the immunoinhibitory cells recognize and are sensitized to an antigen that is the target of a pathologic (or undesirable) immune response associated with an immune-mediated disorder. Such cells can be isolated, for example, from a patient, in particular a human patient, having such an immune-mediated disorder. In another embodiment, the immunoinhibitory cells expressing a DN form additionally recombinantly express a CAR that binds to an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder. Such cells can be isolated, for example, from a patient, in particular a human patient, having such an immune-mediated disorder. The recombinant cells can be used to treat the immune-mediated disorder. Preferably, the cells are derived from a human (are of human origin prior to being made recombinant) (and human-derived cells are particularly preferred for administration to a human in the methods of treatment of the invention).

(18) The immunoinhibitory cells of the invention can be cells of the lymphoid lineage. Non-limiting examples of cells of the lymphoid lineage that can be used as immunoinhibitory cells include regulatory T cells, follicular regulatory T cells, regulatory B cells, and the like. The immunoinhibitory cells of the invention express an inhibitor of a cell-mediated immune response, for example, an immune checkpoint inhibitor pathway receptor, e.g., PD-1 (while not intending to be bound by mechanism, it is submitted that expression of the DN form in the cell inhibits the inhibitor of the the cell-mediated immune response to promote sustained activation of the cell).

(19) Immunoinhibitory cells can be isolated by methods well known in the art, including commercially available isolation methods (see, for example, Rowland-Jones et al., Lymphocytes: A Practical Approach, Oxford University Press, New York (1999)). Sources for the immunoinhibitory cells thereof include, but are not limited to, peripheral blood, umbilical cord blood, bone marrow, or other sources of cells of the lymphoid lineage. Various techniques can be employed to separate the cells to isolate or enrich for desired immunoinhibitory cells. For instance, negative selection methods can be used to remove cells that are not the desired immunoinhibitory cells. Additionally, positive selection methods can be used to isolate or enrich for desired immunoinhibitory cells, or a combination of positive and negative selection methods can be employed. Monoclonal antibodies (MAbs) are particularly useful for identifying markers associated with particular cell lineages and/or stages of differentiation and can be used as reagents for both positive and negative selections. A particular type of immunoinhibitory cell can be isolated based on various cell surface markers or combinations of markers, or the absence of markers, including but not limited to CD4 and/or CD8 for positive selection combined with CD127 for negative selection, as is well known in the art (see Kearse, T Cell Protocols: Development and Activation, Humana Press, Totowa N.J. (2000); De Libero, T Cell Protocols, Vol. 514 of Methods in Molecular Biology, Humana Press, Totowa N.J. (2009); Su et al., Methods Mol. Biol. 806:287-299 (2012); Bluestone et al., Sci. Transl. Med. 7(315) (doi: 10.1126/scitranslmed.aad4134)(2015); Miyara et al., Nat. Rev. Rheumatol. 10:543-551 (2014); Liu et al., J. Exp. Med. 203:1701-1711 (2006); Seddiki et al., J. Exp. Med. 203:1693-1700 (2006); Ukena et al., Exp. Hematol. 39:1152-1160 (2011); Chen et al., J Immunol. 183:4094-4102 (2009); Putnam et al., Diabetes 58:652-662 (2009); Putnam et al., Am. J Tranplant. 13:3010-3020 (2013)). In a specific embodiment, CD4.sup.+CD25.sup.+ regulatory T cells are isolated, for example, using a CD4.sup.+CD25.sup.+ Regulatory T Cell Isolation Kit (Dynal brand, Invitrogen, Carlsbad, Calif.) (see Lee et al., Cancer Res. 71:2871-2881 (2011)). In vitro generation of regulatory T cells (iTregs) have also been described (see, for example, Lan et al., J Mol. Cell. Biol. 4:22-28 (2012); Yamagiwa et al., J Immunol. 166:7282-7289 (2001); Zheng et al., Immunol. 169:4183-4189 (2002)). Various methods for isolating immune cells that can be used for recombinant expression of a CAR have been described previously (Sadelain et al., Nat. Rev. Cancer 3:35-45 (2003); Morgan et al., Science 314:126-129 (2006); Panelli et al., J. Immunol. 164:495-504 (2000); Panelli et al., J. Immunol. 164:4382-4392 (2000); Dupont et al., Cancer Res. 65:5417-5427 (2005); Papanicolaou et al., Blood 102:2498-2505 (2003); MacDonald et al., J. Clin. Invest. 126:1413-1424 (2016)).

(20) Methods for isolating and expanding regulatory T cells are well known in the art (see, for example, Su et al., Methods Mol. Biol. 806:287-299 (2012); Bluestone et al., Sci. Transl. Med. 7(315) (doi: 10.1126/scitranslmed.aad4134)(2015); Miyara et al., Nat. Rev. Rheumatol. 10:543-551 (2014); Liu et al., J Exp. Med. 203:1701-1711 (2006); Seddiki et al., J Exp. Med. 203:1693-1700 (2006); Ukena et al., Exp. Hematol. 39:1152-1160 (2011); Chen et al., J. Immunol. 183:4094-4102 (2009); Putnam et al., Diabetes 58:652-662 (2009); Putnam et al., Am. J. Tranplant. 13:3010-3020 (2013); Lee et al., Cancer Res. 71:2871-2881 (2011); MacDonald et al., J Clin. Invest. 126:1413-1424 (2016)). In vitro generation of regulatory T cells (iTregs) have also been described (see, for example, Lan et al., J Mol. Cell. Biol. 4:22-28 (2012); Yamagiwa et al., J. Immunol. 166:7282-7289 (2001); Zheng et al., J. Immunol. 169:4183-4189 (2002)). Generally, regulatory T cells of the invention are CD4.sup.+, for example, CD4.sup.+CD25.sup.+, and in particular CD4.sup.+CD127.sup.lo/−CD25.sup.+. Such regulatory T cells express Foxp3 (forkhead box P3), which is in the forkhead/winged-helix family of transcription factors (Bluestone et al., J. Clin. Invest. 125:2250-2260 (2015); Riley et al., Immunity 30:656-665 (2009)). A regulatory T cell that is an immunoinhibitory cell of the invention can also be a CD8.sup.+ regulatory T cell (Guillonneau et al., Curr. Opin. Organ Transplant. 15:751-756 (2010)). Methods for isolating and expanding regulatory T cells are also commercially available (see, for example, BD Biosciences, San Jose, Calif.; STEMCELL Technologies Inc., Vancouver, Canada; eBioscience, San Diego, Calif.; Invitrogen, Carlsbad, Calif.). An immunoinhibitory cell of the invention can also be a follicular regulatory T cell (T(FR)) (Sage et al., Nat. Immunol. 14:152-161 (2013)). In a particular embodiment, the follicular regulatory T cells of the invention are CD4.sup.+CXCR5.sup.+ and express Foxp3 (Sage et al., supra, 2013).

(21) In some embodiments, the immunoinhibitory cells of the invention are regulatory B cells. Regulatory B cells have the unique ability in B cells to produce interleukin 10 (IL10) (see, for example, Lykken et al., International Immunol. 27:471-477 (2015); Miyagaki et al., International Immunol. 27:495-504 (2015)). Methods of isolating regulatory B cells have been described (see, for example, Masson et al., in Regulatory B Cells: Methods and Protocols, Vitale and Mion, eds., Chapter 4, pp. 45-52, Humana Press, New York (2014)). Such methods are based on the expression of cell surface markers, such as CD24.sup.highCD38.sup.high, and the expression of IL10 (Masson et al., supra, 2014). Other markers for regulatory B cells include CD24.sup.hiCD27.sup.+ (see Lykken et al., supra, 2015).

(22) Procedures for separation of cells include, but are not limited to, density gradient centrifugation, coupling to particles that modify cell density, magnetic separation with antibody-coated magnetic beads, affinity chromatography; cytotoxic agents joined to or used in conjunction with a monoclonal antibody (mAb), including, but not limited to, complement and cytotoxins, and panning with an antibody attached to a solid matrix, for example, a plate or chip, elutriation, flow cytometry, or any other convenient technique (see, for example, Recktenwald et al., Cell Separation Methods and Applications, Marcel Dekker, Inc., New York (1998)). It is understood that the immunoinhibitory cells used in methods of the invention can be a substantially pure or can be a polyclonal population (see, for example, Bluestone et al., Sci. Transl. Med. 7(315) (doi: 10.1126/scitranslmed.aad4134)(2015)). In some embodiments, a polyclonal population can be enriched for a desired immunoinhibitory cell. Such an enrichment can take place prior to or after genetically engineering the cells to express a DN form, or a CAR and DN form, as desired.

(23) The immunoinhibitory cells can be autologous or non-autologous to the subject to which they are administered in the methods of treatment of the invention. Autologous cells are isolated from the subject to which the engineered cells recombinantly expressing a DN form, or a CAR and DN form, are to be administered. Optionally, the cells can be obtained by leukapheresis, where leukocytes are selectively removed from withdrawn blood, made recombinant, and then retransfused into the donor. Alternatively, allogeneic cells from a non-autologous donor that is not the subject can be used. In the case of a non-autologous donor, the cells are typed and matched for human leukocyte antigen (HLA) to determine an appropriate level of compatibility, as is well known in the art. For both autologous and and non-autologous cells, the cells can optionally be cryopreserved until ready to be used for genetic manipulation and/or administration to a subject using methods well known in the art.

(24) In one embodiment, the invention provides regulatory T cells that recognize and are sensitized to an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder, and also which recombinantly express a DN form of an inhibitor of a regulatory T cell-mediated immune response. Such regulatory T cells can but need not express a CAR that binds to an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder, since the cells already are antigen-specific so that the regulatory T cells are targeted to the antigen. T cells that recognize and are sensitized to an antigen can be obtained by known methods, for example, obtained from a subject that has been exposed to and is mounting a pathologic immune response associated with an immune-mediated disorder. Methods for isolating an antigen-specific regulatory T cell from a subject are well known in the art (see, for example, Noyan et al., Eur. J. Immunol. 44:2592-2602 (2014); Brusko et al., PLoS One 5(7) e11726 (doi: 10.1371) (2010); Bacher et al., Mucosal Immunol. 7:916-928 (2014); Koenen et al., J. Immunol. 174:7573-7583 (2005)). The antigen-specific regulatory T cells can be isolated using well known techniques as described above for isolating immunoinhibitory cells, which include, but are not limited to, flow cytometry, magnetic beads, panning on a solid phase, and so forth.

(25) In a specific embodiment, isolated immunoinhibitory cells are genetically engineered ex vivo for recombinant expression of a DN form and a CAR. In a specific embodiment, isolated regulatory T cells that are antigen-specific are genetically engineered ex vivo for recombinant expression of a DN form. The cells can be genetically engineered for recombinant expression by methods well known in the art. In an embodiment where the sensitized regulatory T cells are isolated from in vivo sources, it will be self-evident that genetic engineering occurs of the already-sensitized regulatory T cells.

(26) The immunoinhibitory cells can be subjected to conditions that favor maintenance or expansion of the immunoinhibitory cells (see Kearse, T Cell Protocols: Development and Activation, Humana Press, Totowa N.J. (2000); De Libero, T Cell Protocols, Vol. 514 of Methods in Molecular Biology, Humana Press, Totowa N.J. (2009); Parente-Pereira et al., J. Biol. Methods 1(2) e7 (doi 10.14440/jbm.2014.30) (2014); Movassagh et al., Hum. Gene Ther. 11:1189-1200 (2000); Rettig et al., Mol. Ther. 8:29-41 (2003); Agarwal et al., J. Virol. 72:3720-3728 (1998); Pollok et al., Hum. Gene Ther. 10:2221-2236 (1999); Quinn et al., Hum. Gene Ther. 9:1457-1467 (1998); Su et al., Methods Mol. Biol. 806:287-299 (2012); Bluestone et al., Sci. Transl. Med. 7(315) (doi: 10.1126/scitranslmed.aad4134)(2015); Miyara et al., Nat. Rev. Rheumatol. 10:543-551 (2014); Liu et al., J. Exp. Med. 203:1701-1711 (2006); Seddiki et al., J. Exp. Med. 203:1693-1700 (2006); Ukena et al., Exp. Hematol. 39:1152-1160 (2011); Chen et al., J. Immunol. 183:4094-4102 (2009); Putnam et al., Diabetes 58:652-662 (2009); Putnam et al., Am. J. Tranplant. 13:3010-3020 (2013); Lee et al., Cancer Res. 71:2871-2881 (2011); MacDonald et al., J. Clin. Invest. 126:1413-1424 (2016)). The immunoinhibitory cells, or antigen sensitized regulatory T cells, can optionally be expanded prior to or after ex vivo genetic engineering. Expansion of the cells is particularly useful to increase the number of cells for administration to a subject. Such methods for expansion of immunoinhibitory cells are well known in the art (see Kaiser et al., Cancer Gene Therapy 22:72-78 (2015); Wolfl et al., Nat. Protocols 9:950-966 (2014); Su et al., Methods Mol. Biol. 806:287-299 (2012); Bluestone et al., Sci. Transl. Med. 7(315) (doi: 10.1126/scitranslmed.aad4134)(2015); Miyara et al., Nat. Rev. Rheumatol. 10:543-551 (2014); Liu et al., J. Exp. Med. 203:1701-1711 (2006); Seddiki et al., J. Exp. Med. 203:1693-1700 (2006); Ukena et al., Exp. Hematol. 39:1152-1160 (2011); Chen et al., J. Immunol. 183:4094-4102 (2009); Putnam et al., Diabetes 58:652-662 (2009); Putnam et al., Am. J. Tranplant. 13:3010-3020 (2013); Lee et al., Cancer Res. 71:2871-2881 (2011)). Furthermore, the cells can optionally be cryopreserved after isolation and/or genetic engineering, and/or expansion of genetically engineered cells (see Kaiser et al., supra, 2015)). Methods for cyropreserving cells are well known in the art (see, for example, Freshney, Culture of Animal Cells: A Manual of Basic Techniques, 4th ed., Wiley-Liss, New York (2000); Harrison and Rae, General Techniques of Cell Culture, Cambridge University Press (1997)).

(27) With respect to generating cells recombinantly expressing a DN form, or a CAR and DN form, one or more nucleic acids encoding the DN form or the CAR and DN form is introduced into the immunoinhibitory cell using a suitable expression vector. The immunoinhibitory cells (for example, regulatory T cells or regulatory B cells) are preferably transduced with one or more nucleic acids encoding a DN form, or a CAR and DN form. In the case of expressing both a CAR and DN form, the CAR and DN form encoding nucleic acids can be on separate vectors or on the same vector, as desired. For example, a polynucleotide encoding a CAR or DN form of the invention can be cloned into a suitable vector, such as a retroviral vector, and introduced into the immunoinhibitory cell using well known molecular biology techniques (see Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1999)). Any vector suitable for expression in a cell of the invention, particularly a human immunoinhibitory cell, can be employed. The vectors contain suitable expression elements such as promoters that provide for expression of the encoded nucleic acids in the immunoinhibitory cell. In the case of a retroviral vector, cells can optionally be activated to increase transduction efficiency (see Parente-Pereira et al., J. Biol. Methods 1(2) e7 (doi 10.14440/jbm.2014.30) (2014); Movassagh et al., Hum. Gene Ther. 11:1189-1200 (2000); Rettig et al., Mol. Ther. 8:29-41 (2003); Agarwal et al., J. Virol. 72:3720-3728 (1998); Pollok et al., Hum. Gene Ther. 10:2221-2236 (1998); Quinn et al., Hum. Gene Ther. 9:1457-1467 (1998)). Methods for use in expressing a polypeptide, such as a CAR, in a regulatory T cell can be any known in the art, e.g., those described in Lee et al., Cancer Res. 71:2871-2881 (2011).

(28) In one embodiment, the vector is a retroviral vector, for example, a gamma retroviral or lentiviral vector, which is employed for the introduction of a CAR or DN form into the immunoinhibitory cell. For genetic modification of the cells to express a CAR and/or DN form, a retroviral vector is generally employed for transduction. However, it is understood that any suitable viral vector or non-viral delivery system can be used. Combinations of a retroviral vector and an appropriate packaging line are also suitable, where the capsid proteins will be functional for infecting human cells. Various amphotropic virus-producing cell lines are known, including, but not limited to, PA12 (Miller et al., Mol. Cell. Biol. 5:431-437 (1985)); PA317 (Miller et al., Mol. Cell. Biol. 6:2895-2902(1986)); and CRIP (Danos et al., Proc. Natl. Acad. Sci. USA 85:6460-6464 (1988)). Non-amphotropic particles are suitable too, for example, particles pseudotyped with VSVG, RD114 or GALV envelope and any other known in the art (Relander et al., Mol. Therap. 11:452-459 (2005)). Possible methods of transduction also include direct co-culture of the cells with producer cells (for example, Bregni et al., Blood 80:1418-1422 (1992)), or culturing with viral supernatant alone or concentrated vector stocks with or without appropriate growth factors and polycations (see, for example, Xu et al., Exp. Hemat. 22:223-230 (1994); Hughes, et al. J. Clin. Invest. 89:1817-1824 (1992)).

(29) Generally, the chosen vector exhibits high efficiency of infection and stable integration and expression (see, for example, Cayouette et al., Human Gene Therapy 8:423-430 (1997); Kido et al., Current Eye Research 15:833-844 (1996); Bloomer et al., J. Virol. 71:6641-6649 (1997); Naldini et al., Science 272:263 267 (1996); and Miyoshi et al., Proc. Natl. Acad. Sci. U.S.A. 94:10319-10323 (1997)). Other viral vectors that can be used include, for example, adenoviral, lentiviral, and adeno-associated viral vectors, vaccinia virus, a bovine papilloma virus derived vector, or a herpes virus, such as Epstein-Barr Virus (see, for example, Miller, Hum. Gene Ther. 1(1):5-14 (1990); Friedman, Science 244:1275-1281 (1989); Eglitis et al., BioTechniques 6:608-614 (1988); Tolstoshev et al., Current Opin. Biotechnol. 1:55-61 (1990); Sharp, Lancet 337:1277-1278 (1991); Cornetta et al., Prog. Nucleic Acid Res. Mol. Biol. 36:311-322 (1989); Anderson, Science 226:401-409 (1984); Moen, Blood Cells 17:407-416 (1991); Miller et al., Biotechnology 7:980-990 (1989); Le Gal La Salle et al., Science 259:988-990 (1993); and Johnson, Chest 107:77S-83S (1995)). Retroviral vectors are particularly well developed and have been used in clinical settings (Rosenberg et al., N. Engl. J. Med. 323:370 (1990); Anderson et al., U.S. Pat. No. 5,399,346).

(30) Particularly useful vectors for expressing a CAR and/or DN form of the invention include vectors that have been used in human gene therapy. In one non-limiting embodiment, a vector is a retroviral vector. The use of retroviral vectors for expression in T cells or other immune cells, including engineered CAR T cells, has been described (see Scholler et al., Sci. Transl. Med. 4:132-153 (2012; Parente-Pereira et al., J. Biol. Methods 1(2):e7 (1-9)(2014); Lamers et al., Blood 117(1):72-82 (2011); Reviere et al., Proc. Natl. Acad. Sci. USA 92:6733-6737 (1995)). In one embodiment, the vector is an SGF retroviral vector such as an SGF γ-retroviral vector, which is Moloney murine leukemia-based retroviral vector. SGF vectors have been described previously (see, for example, Wang et al., Gene Therapy 15:1454-1459 (2008)).

(31) The vectors of the invention employ suitable promoters for expression in a particular host cell. The promoter can be an inducible promoter or a constitutive promoter. In a particular embodiment, the promoter of an expression vector provides expression in an immunoinhibitory cell, such as a regulatory T cell or regulatory B cell. Non-viral vectors can be used as well, so long as the vector contains suitable expression elements for expression in the immunoinhibitory cell. Some vectors, such as retroviral vectors, can integrate into the host genome. If desired, targeted integration can be implemented using technologies such as a nuclease, transcription activator-like effector nucleases (TALENs), Zinc-finger nucleases (ZFNs), and/or clustered regularly interspaced short palindromic repeats (CRISPRs), by homologous recombination, and the like (Gersbach et al., Nucl. Acids Res. 39:7868-7878 (2011); Vasileva, et al. Cell Death Dis. 6:e1831. (Jul. 23 2015); Sontheimer, Hum. Gene Ther. 26(7):413-424 (2015)).

(32) The vectors and constructs can optionally be designed to include a reporter. For example, the vector can be designed to express a reporter protein, which can be useful to identify cells comprising the vector or nucleic acids provided on the vector, such as nucleic acids that have integrated into the host chromosome. In one embodiment, the reporter can be expressed as a bicistronic or multicistronic expression construct with the CAR or DN form. Exemplary reporter proteins include, but are not limited to, fluorescent proteins, such as mCherry, green fluorescent protein (GFP), blue fluorescent protein, for example, EBFP, EBFP2, Azurite, and mKalamal, cyan fluorescent protein, for example, ECFP, Cerulean, and CyPet, and yellow fluorescent protein, for example, YFP, Citrine, Venus, and YPet. In an additional embodiment, a vector construct can comprise a P2A sequence, which provides for optional co-expression of a reporter molecule. P2A is a self-cleaving peptide sequence, which can be used for bicistronic or multicistronic expression of protein sequences (see Szymczak et al., Expert Opin. Biol. Therapy 5(5):627-638 (2005)).

(33) Assays can be used to determine the transduction efficiency of a CAR and/or DN form using routine molecular biology techniques. If a marker has been included in the construct, such as a fluorescent protein, gene transfer efficiency can be monitored by FACS analysis to quantify the fraction of transduced (for example, GFP.sup.+) immunoinhibitory cells, such as regulatory T cells or regulatory B cells, and/or by quantitative PCR.

(34) If desired, a nucleic acid encoding a polypeptide for genetic engineering of a cell of the invention, such as a DN form or a CAR, can be codon optimized to increase efficiency of expression in an immunoinhibitory cell. Codon optimization can be used to achieve higher levels of expression in a given cell. Factors that are involved in different stages of protein expression include codon adaptability, mRNA structure, and various cis-elements in transcription and translation. Any suitable codon optimization methods or technologies that are known to one skilled in the art can be used to modify the polynucleotides encoding the polypeptides. Such codon optimization methods are well known, including commercially available codon optimization services, for example, OptimumGene™ (GenScript; Piscataway, N.J.), Encor optimization (EnCor Biotechnology; Gainseville Fla.), Blue Heron (Blue Heron Biotech; Bothell, Wash.), and the like. Optionally, multiple codon optimizations can be performed based on different algorithms, and the optimization results blended to generate a codon optimized nucleic acid encoding a polypeptide.

(35) Further modification can be introduced to the immunoinhibitory cells of the invention. For example, the cells can be modified to address immunological complications and/or targeting by the CAR to non-target tissues that express the same target antigens. For example, a suicide gene can be introduced into the cells to provide for depletion of the cells when desired. Suitable suicide genes include, but are not limited to, Herpes simplex virus thymidine kinase (hsv-tk), inducible Caspase 9 Suicide gene (iCasp-9), and a truncated human epidermal growth factor receptor (EGFRt) polypeptide. Agents are administered to the subject to which the cells containing the suicide genes have been administered, including but not limited to, gancilovir (GCV) for hsv-tk (Greco et al., Frontiers Pharmacol. 6:95 (2015); Barese et al., Mol. Therapy 20:1932-1943 (2012)), AP1903 for iCasp-9 (Di Stasi et al., N. Engl. J. Med. 365:1673-1683 (2011), and cetuximab for EGFRt (U.S. Pat. No. 8,802,374), to promote cell death. In one embodiment, administration of a prodrug designed to activate the suicide gene, for example, a prodrug such as AP1903 that can activate iCasp-9, triggers apoptosis in the suicide gene-activated cells. In one embodiment, iCasp9 consists of the sequence of the human FK506-binding protein (FKBP12; GenBank number, AH002818 (AH002818.1, M92422.1, GI:182645; AH002818.2, GI:1036032368)) with an F36V mutation, connected through a Ser-Gly-Gly-Gly-Ser (SEQ ID NO:28) linker to the gene encoding human caspase 9 (CASP9; GenBank number, NM001229 (NM_001229.4, GI:493798577)), which has had its endogenous caspase activation and recruitment domain deleted. FKBP12-F36V binds with high affinity to an otherwise bioinert small-molecule dimerizing agent, AP1903. In the presence of AP1903, the iCasp9 promolecule dimerizes and activates the intrinsic apoptotic pathway, leading to cell death (Di Stasi et al., N. Engl. J. Med. 365:1673-1683 (2011)). In another embodiment, the suicide gene is an EGFRt polypeptide. The EGFRt polypeptide can provide for cell elimination by administering anti-EGFR monoclonal antibody, for example, cetuximab. The suicide gene can be expressed on a separate vector or, optionally, expressed within the vector encoding a CAR or DN form, and can be a bicistronic or multicistronic construct joined to a CAR or DN form encoding nucleic acid.

(36) 6.2 Chimeric Antigen Receptors (CARs)

(37) The CAR that is recombinantly expressed by a cell of the invention has an antigen binding domain that binds to an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder. In specific embodiments, the CAR can be a “first generation,” “second generation” or “third generation” CAR (see, for example, Sadelain et al., Cancer Discov. 3(4):388-398 (2013); Jensen et al., Immunol. Rev. 257:127-133 (2014); Sharpe et al., Dis. Model Mech. 8(4):337-350 (2015); Brentjens et al., Clin. Cancer Res. 13:5426-5435 (2007); Gade et al., Cancer Res. 65:9080-9088 (2005); Maher et al., Nat. Biotechnol. 20:70-75 (2002); Kershaw et al., J. Immunol. 173:2143-2150 (2004); Sadelain et al., Curr. Opin. Immunol. 21(2):215-223 (2009); Hollyman et al., J. Immunother. 32:169-180 (2009)).

(38) “First generation” CARs are typically composed of an extracellular antigen binding domain, for example, a single-chain variable fragment (scFv), fused to a transmembrane domain, which is fused to a cytoplasmic/intracellular domain of the T cell receptor chain. “First generation” CARs typically have the intracellular domain from the CD3ζ-chain, which is the primary transmitter of signals from endogenous T cell receptors (TCRs) (see exemplary first generation CAR in FIG. 1A). “First generation” CARs can provide de novo antigen recognition and cause activation of T cells through their CD3ζ chain signaling domain in a single fusion molecule, independent of HLA-mediated antigen presentation. “Second-generation” CARs for use in the invention comprise an antigen-binding domain fused to an intracellular signaling domain capable of activating immunoinhibitory cells and a co-stimulatory domain designed to augment immune cell, such as T cell, potency and persistence (Sadelain et al., Cancer Discov. 3:388-398 (2013)). CAR design can therefore combine antigen recognition with signal transduction, two functions that are physiologically borne by two separate complexes, the TCR heterodimer and the CD3 complex. “Second generation” CARs include an intracellular domain from various co-stimulatory molecules, for example, CD28, 4-1BB, ICOS, OX40, and the like, in the cytoplasmic tail of the CAR to provide additional signals to the cell (see exemplary second generation CAR in FIG. 1A). “Second generation” CARs provide both co-stimulation, for example, by CD28 or 4-1BB domains, and activation, for example, by a CD3ζ signaling domain “Third generation” CARs provide multiple co-stimulation, for example, by comprising both CD28 and 4-1BB domains, and activation, for example, by comprising a CD3ζ activation domain.

(39) In the embodiments disclosed herein, the CARs generally comprise an extracellular antigen binding domain, a transmembrane domain and an intracellular domain, as described above, where the extracellular antigen binding domain binds to an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder. In a particular non-limiting embodiment, the extracellular antigen-binding domain is an scFv.

(40) As disclosed herein, the methods of the invention involve administering cells that have been engineered to express a dominant negative form (“DN form”) of an inhibitor of a cell-mediated immune response, or to co-express the DN form of an inhibitor and a CAR that binds an antigen that is a target of a pathologic immune response associated with an immune-mediated disorder. The extracellular antigen-binding domain of a CAR is usually derived from a monoclonal antibody (mAb) or from receptors or their ligands.

(41) The design of CARs is well known in the art (see, for example, reviews by Sadelain et al., Cancer Discov. 3(4):388-398 (2013); Jensen et al., Immunol. Rev. 257:127-133 (2014); Sharpe et al., Dis. Model Mech. 8(4):337-350 (2015), and references cited therein). A CAR directed to a desired antigen can be generated using well known methods for designing a CAR, including those as described herein. A CAR, whether a first, second or third generation CAR, can be readily designed by fusing an antigen binding activity, for example, an scFv antibody directed to the antigen, to an immune cell signaling domain, such as a T cell receptor cytoplasmic/intracellular domain. As described above, the CAR generally has the structure of a cell surface receptor, with the antigen binding activity, such as an scFv, as at least a portion of the extracellular domain, fused to a transmembrane domain, which is fused to an intracellular domain that has cell signaling activity in an immunoinhibitory cell. The CAR can include co-stimulatory molecules, as described herein. One skilled in the art can readily select appropriate transmembrane domains, as described herein and known in the art, and intracellular domains to provide the desired signaling capability in the immunoinhibitory cell of the invention.

(42) A CAR for use in the present invention comprises an extracellular domain that includes an antigen binding domain that binds to an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder. Such an antigen binding domain is generally derived from an antibody. In one embodiment, the antigen binding domain can be an scFv or a Fab, or any suitable antigen binding fragment of an antibody (see Sadelain et al., Cancer Discov. 3:388-398 (2013)). Many antibodies or antigen binding domains derived from antibodies that bind to a desired antigen are known in the art. Alternatively, such antibodies or antigen binding domains can be produced by routine methods. Methods of generating an antibody are well known in the art, including methods of producing a monoclonal antibody or screening a library to obtain an antigen binding polypeptide, including screening a library of human Fabs (Winter and Harris, Immunol. Today 14:243-246 (1993); Ward et al., Nature 341:544-546 (1989); Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press (1988); Hilyard et al., Protein Engineering: A practical approach (IRL Press 1992); Borrabeck, Antibody Engineering, 2nd ed. (Oxford University Press 1995); Huse et al., Science 246:1275-1281 (1989)). For the CAR, the antigen binding domain derived from an antibody can be human, humanized, chimeric, CDR-grafted, and the like, as desired. For example, if a mouse monoclonal antibody is a source antibody for generating the antigen binding domain of a CAR, such an antibody can be humanized by grafting CDRs of the mouse antibody onto a human framework (see Borrabeck, supra, 1995), which can be beneficial for administering the CAR to a human subject. In a preferred embodiment, the antigen binding domain is an scFv. The generation of scFvs is well known in the art (see, for example, Huston, et al., Proc. Nat. Acad. Sci. USA 85:5879-5883 (1988); Ahmad et al., Clin. Dev. Immunol. 2012: ID980250 (2012); U.S. Pat. Nos. 5,091,513, 5,132,405 and 4,956,778; and U.S. Patent Publication Nos. 20050196754 and 20050196754).

(43) With respect to obtaining an antigen binding activity, one skilled in the art can readily obtain a suitable antigen binding activity, such as an antibody, using any of the well known methods for generating and screening for an antibody that binds to a desired antigen, as disclosed herein, including the generation of an scFv that binds to an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder, which is particularly useful in a CAR. In addition, a number of antibodies, in particular monoclonal antibodies directed to the target antigens listed in Table 1, are commercially available and can also be used as a source for an antigen binding activity, such as an scFv, to generate a CAR.

(44) Alternatively to using an antigen binding domain derived from an antibody, a CAR extracellular domain can comprise a ligand or extracellular ligand binding domain of a receptor (see Sadelain et al., Cancer Discov. 3:388-398 (2013); Sharpe et al., Dis. Model Mech. 8:337-350 (2015)). In this case, the ligand or extracellular ligand binding domain of a receptor provides to the CAR the ability to target the cell expressing the CAR to the corresponding receptor or ligand. The ligand or extracellular ligand binding domain is selected such that the cell expressing the CAR is targeted to a desired site of action, such as a target tissue (see Sadelain et al., Cancer Discov. 3:388-398 (2013); Sharpe et al., Dis. Model Mech. 8:337-350 (2015), and references cited therein). In an embodiment of the invention, the ligand or extracellular ligand binding domain is selected to bind to an antigen that is the corresponding receptor or ligand (see Sadelain et al, Cancer Discov. 3:388-398 (2013)).

(45) For a CAR directed to an antigen, the antigen binding domain of the CAR is selected to bind to an antigen expressed on a target cell or at the site of a pathologic immune response associated with an immune-mediated disorder. Such an antigen can be uniquely expressed on a target cell, or the antigen can be overexpressed in a target cell relative to non-target cells or tissues. The target antigen to be bound by the CAR is chosen to provide targeting of the cell expressing the CAR over non-target cells or tissues. In one embodiment of the methods of the invention for treating a disorder, an immunoinhibitory cell is designed to treat a patient by expressing in the cell a CAR that binds to a suitable antigen to target a desired site in the patient, along with a DN form, as described herein.

(46) Any suitable target antigen can be chosen based on the type of disorder to be treated. It is understood that the selected target antigen is expressed in a manner such that the antigen is accessible for binding by the CAR. Generally, the antigen to be targeted by a cell expressing a CAR is expressed on the cell surface of a target cell or is an intracellular antigen that becomes available due to cell lysis at the site of a pathologic immune response associated with an immune-mediated disorder. It is understood that any target antigen that is accessible for binding to a CAR is suitable for targeting the CAR-expressing cell to a target cell or target site. Exemplary antigens that are targets of pathologic immune responses associated with immune-mediated disorders and exemplary disorders are provided below in Table 1.

(47) TABLE-US-00001 TABLE 1 Immune-Mediated Disorders and Antigens that are Targets of Pathologic Immune Responses Associated with Immune-Mediated Disorders. Antigens that are Targets of Pathologic Immune Immune-Mediated Responses Associated with Immune-Mediated Disorder Disorders Ref. organ lung MHC class I, II (HLA DR, HLA A2); collagen type V; 1, 2 transplant K alpha1 tubulin (Kalpha1T; Kα1T); MHC class I related chain A (MICA) kidney MHC class I, II; fibronectin; collagen type IV, VI; vimentin; angiotensin II type 1 receptor (AGTR1); perlecan; agrin liver MHC class I, II; collagen type I, II, III, V heart MHC class I, II; cardiac myosin; vimentin; collagen type V; K alpha1 tubulin (Kalpha1T; Kα1T); MHC class I related chain A (MICA) pancreas MHC class I, II; islet cell autoantibody (ICA) antigens; insulin; glutamic acid decarboxylase (GAD) autoimmune multiple myelin; myelin basic protein; myelin oligodendrocyte 3, 6, 9 disorders sclerosis glycoprotein; proteolipid protein; astrocyte proteins; glial fibrillary protein (GFAP); S100beta (S100β) type 1 beta cell antigens; insulin B chain; insulin B chain 3, 5, diabetes derived epitope; glutamic acid decarboxylase-65 8, 9 (GAD65); insulin; proinsulin; islet-associated antigen 2; preproinsulin; islet-specific glucose-6-phosphatase catalytic subunit-related protein (IGRP); zinc transporter 8 (ZnT8); islet antigen 2 (IA-2) (receptors on pancreatic B cells); heat shock protein 60 (HSP60); chromogranin A rheumatoid dnaJ (heat shock protein); citrullinated-vimentin;  9 arthritis human cartilage glycoprotein-39 primary mitochondrial components; pyruvate dehydrogenase  7 biliary (mitochondrial); E2 component (subunit) of pyruvate cirrhosis dehydrogenase; E2 component (subunit) of branched chain 2-oxo acid dehydrogenase; E2 component (subunit) of 2-oxo-glutarate dehydrogenase complex; E3 binding protein of dihydrolipoamide dehydrogenase; nuclear components; nuclear protein sp100; nuclear pore complex protein gp120; centromere myasthenia acetylcholine receptor (AChR); aquaporin-4 (AQP-4); 3, 4 gravis targets for therapy: CTLA-4; ICAM; LFA-3; CD40/CD154; ICOS/ICOSL; CD52; nuclear factor of activated T cells (NFAT); phospholipase C (PLC); CD25; Janus kinase; B cell activating factor (BAFF); a proliferating inducing ligand (APRIL); IL6R; IL17; IL12/IL23; integrins; sphingosin receptors vitiligo melanocyte antigens 10 lupus Toll-like receptors: TLR2, TLR3, TLR4, TLR5, TLR7, 11 TLR8, TLR9, MyD88, IL-1R-associated kinases (IRAKS) allergic allergen 8, 9 disorders 1. Angaswamy, et al., Hum. Immunol., 74(11): 1478-1485 (2013) 2. Kuo, et al., Immunol. Res., 32(1-3): 179-185 (2005) 3. Bluestone, et al., J. Clin. Invest., 125(6): 2250-2260 (2015) 4. Dalakas, Ther. Adv. Neurol. Disord., 8(6): 316-327 (2015) 5. Gomez-Tourino, et al., J. Autoimmun., (Sep 3. pii: S0896-8411(15)30030-5. doi: 10.1016/j.jaut.2015.08.012): 1-10 (2015) 6. Huseby, et al., Front. Cell. Neurosci., 9(295): 1-7 (2015) 7. Webb, et al., J. Autoimmun., 64: 42-52 (2015) 8. Odegard, et al., Clin. Immunol., 161(1): 44-50 (2015) 9. MacLeod, et al., Curr. Opin. Pharmacol., 23: 11-16 (2015) 10. Dwivedi et al., Autimmun. Rev. 14: 49-56 (2015) 11. Wu et al., Acta Pharmacologica Sinica 36: 1395-1407 (2015)

(48) Suitable antigens include, but are not limited to, those described in Table 1 or known in the art (see references 1-11 of Table 1 and, for example, Snir et al., Arthritis Rheum. 63:2873-2883 (2011); Yamagiwa et al., World J. Gastroenterol. 20:2606-2612 (2014); Mallone et al., Clin. Develop. Immunol. 2011:513210 (doi: 10.1155/2011/513210)(2011); Pihoker et al., Diabetes 54:Suppl 2:S52-61 (2005)). It is understood that these or other antigens that target a pathologic immune response associated with an immune-mediated disorder can be utilized for targeting an antigen with a CAR.

(49) As described above, a CAR also contains a signaling domain that functions in the immunoinhibitory cell thereof expressing the CAR. Such a signaling domain can be, for example, derived from CDζ or Fc receptor γ (see Sadelain et al., Cancer Discov. 3:388-398 (2013)). In general, the signaling domain will induce persistence, trafficking and/or effector functions in the transduced immunoinhibitory cells of the invention (Sharpe et al., Dis. Model Mech. 8:337-350 (2015); Finney et al., J. Immunol. 161:2791-2797 (1998); Krause et al., J. Exp. Med. 188:619-626 (1998)). In the case of CDζ or Fc receptor γ, the signaling domain corresponds to the intracellular domain of the respective polypeptides, or a fragment of the intracellular domain that is sufficient for signaling. Exemplary signaling domains are described below in more detail.

(50) Exemplary polypeptides are described herein with reference to GenBank numbers, GI numbers and/or SEQ ID NOS. It is understood that one skilled in the art can readily identify homologous sequences by reference to sequence sources, including but not limited to GenBank (ncbi.nlm.nih.gov/genbank/) and EMBL (embl.org/).

(51) CD3ζ.

(52) In a non-limiting embodiment, a CAR can comprise a signaling domain derived from a CD3ζ polypeptide, for example, a signaling domain derived from the intracellular domain of CD3ζ, which can activate or stimulate an immunoinhibitory cell of the invention. CD3ζ comprises 3 Immune-receptor-Tyrosine-based-Activation-Motifs (ITAMs), and transmits an activation signal to the cell, for example, a cell of the lymphoid lineage such as a T cell, after antigen is bound. A CD3ζ polypeptide can have an amino acid sequence corresponding to the sequence having GenBank No. NP_932170 (NP_932170.1, GI:37595565; see below), or fragments thereof. In one embodiment, the CD3ζ polypeptide has an amino acid sequence of amino acids 52 to 164 of the CD3ζ polypeptide sequence provided below, or a fragment thereof that is sufficient for signaling activity. An exemplary CAR is Mz, which has an intracellular domain comprising a CD3ζ polypeptide comprising amino acids 52 to 164 of the CD3ζ polypeptide sequence provided below. Another exemplary CAR is M28z, which has an intracellular domain comprising a CD3ζ polypeptide comprising amino acids 52 to 164 of the CD3ζ polypeptide provided below. Still another exemplary CAR is MBBz, which has an intracellular domain comprising a CD3ζ polypeptide comprising amino acids 52 to 164 of the CD3ζ polypeptide provided below. Yet another exemplary CAR is P28z, which has an intracellular domain derived from a CD3ζ polypeptide. See GenBank NP_932170 for reference to domains within CD3, for example, signal peptide, amino acids 1 to 21; extracellular domain, amino acids 22 to 30; transmembrane domain, amino acids 31 to 51; intracellular domain, amino acids 52 to 164.

(53) TABLE-US-00002 (NP_932170; SEQ ID NO: 1) 1 MKWKALFTAA ILQAQLPITE AQSFGLLDPK LCYLLDGILF IYGVILTALF LRVKFSRSAD 61 APAYQQGQNQ LYNELNLGRR EEYDVLDKRR GRDPEMGGKP QRRKNPQEGL YNELQKDKMA 121 EAYSEIGMKG ERRRGKGHDG LYQGLSTATK DTYDALHMQA LPPR

(54) It is understood that a “CD3ζ nucleic acid molecule” refers to a polynucleotide encoding a CD3ζ polypeptide. In one embodiment, the CD3ζ nucleic acid molecule encoding the CD3ζ polypeptide comprised in the intracellular domain of a CAR, including exemplary CARs Mz, M28z, or MBBz, comprises a nucleotide sequence as set forth below.

(55) TABLE-US-00003 (SEQ ID NO: 2) AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCC AGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGA TGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCG AGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATA AGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAG GGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAG GACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAA

(56) In certain non-limiting embodiments, an intracellular domain of a CAR can further comprise at least one co-stimulatory signaling domain. Such a co-stimulatory signaling domain can provide increased activation of an immunoinhibitory cell. A co-stimulatory signaling domain can be derived from a CD28 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP10 polypeptide, a 2B4 polypeptide, and the like. CARs comprising an intracellular domain that comprises a co-stimulatory signaling region comprising 4-1BB, ICOS or DAP-10 have been described previously (see U.S. Pat. No. 7,446,190, which is incorporated herein by reference, which also describes representative sequences for 4-1BB, ICOS and DAP-10). In some embodiments, the intracellular domain of a CAR can comprise a co-stimulatory signaling region that comprises two co-stimulatory molecules, such as CD28 and 4-1BB (see Sadelain et al., Cancer Discov. 3(4):388-398 (2013)), or CD28 and OX40, or other combinations of co-stimulatory ligands, as disclosed herein.

(57) CD28.

(58) Cluster of Differentiation 28 (CD28) is a protein expressed on T cells that provides co-stimulatory signals for T cell activation and survival. CD28 is the receptor for CD80 (B7.1) and CD86 (B7.2) proteins. In one embodiment, a CAR can comprise a co-stimulatory signaling domain derived from CD28. For example, as disclosed herein, a CAR can include at least a portion of an intracellular/cytoplasmic domain of CD28, for example an intracellular/cytoplasmic domain that can function as a co-stimulatory signaling domain (see FIG. 1B). A CD28 polypeptide can have an amino acid sequence corresponding to the sequence having GenBank No. P10747 (P10747.1, GI:115973) or NP_006130 (NP_006130.1, GI:5453611), as provided below, or fragments thereof. If desired, CD28 sequences additional to the intracellular domain can be included in a CAR of the invention. For example, a CAR can comprise the transmembrane of a CD28 polypeptide. In one embodiment, a CAR can have an amino acid sequence comprising the intracellular domain of CD28 corresponding to amino acids 180 to 220 of CD28, or a fragment thereof. In another embodiment, a CAR can have an amino acid sequence comprising the transmembrane domain of CD28 corresponding to amino acids 153 to 179, or a fragment thereof. M28z is an exemplary CAR, which comprises a co-stimulatory signaling domain corresponding to an intracellular domain of CD28 (see FIG. 1B). M28z also comprises a transmembrane domain derived from CD28 (see FIG. 1B). Thus, M28z exemplifies a CAR that comprises two domains from CD28, a co-stimulatory signaling domain and a transmembrane domain. In one embodiment, a CAR has an amino acid sequence comprising the transmembrane domain and the intracellular domain of CD28 and comprises amino acids 153 to 220 of CD28. In another embodiment, a CAR is exemplified by M28z CAR and comprises amino acids 117 to 220 of CD28. Another exemplary CAR having a transmembrane domain and intracellular domain of CD28 is P28z (see FIG. 1B). In one embodiment, a CAR can comprise a transmembrane domain derived from a CD28 polypeptide comprising amino acids 153 to 179 of the CD28 polypeptide provided below. See GenBank NP_006130 for reference to domains within CD28, for example, signal peptide, amino acids 1 to 18; extracellular domain, amino acids 19 to 152; transmembrane domain, amino acids 153 to 179; intracellular domain, amino acids 180 to 220. It is understood that sequences of CD28 that are shorter or longer than a specific delineated domain can be included in a CAR, if desired.

(59) TABLE-US-00004 (NP_006130; SEQ ID NO: 3) 1 MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSC KYSYNLFSRE FRASLHKGLD 61 SAVEVCVVYG NYSQQLQVYS KTGFNCDGKL GNESVTFYLQ NLYVNQTDIY FCKIEVMYPP 121 PYLDNEKSNG TIIHVKGKHL CPSPLFPGPS KPFWVLVVVG GVLACYSLLV TVAFIIFWVR 181 SKRSRLLHSD YMNMTPRRPG PTRKHYQPYA PPRDFAAYRS

(60) It is understood that a “CD28 nucleic acid molecule” refers to a polynucleotide encoding a CD28 polypeptide. In one embodiment, the CD28 nucleic acid molecule encoding the CD28 polypeptide of M28z comprising the transmembrane domain and the intracellular domain, for example, the co-stimulatory signaling region, comprises a nucleotide sequence as set forth below.

(61) TABLE-US-00005 (SEQ ID NO: 4) ATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATG GAACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATT TCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTC CTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGG TGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGAC TCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCA CCACGCGACTTCGCAGCCTATCGCTCC

(62) 4-1BB.

(63) 4-1BB, also referred to as tumor necrosis factor receptor superfamily member 9, can act as a tumor necrosis factor (TNF) ligand and have stimulatory activity. In one embodiment, a CAR can comprise a co-stimulatory signaling domain derived from 4-1BB. A 4-1BB polypeptide can have an amino acid sequence corresponding to the sequence having GenBank No. P41273 (P41273.1, GI:728739) or NP_001552 (NP_001552.2, GI:5730095) or fragments thereof. In one embodiment, a CAR can have a co-stimulatory domain comprising the intracellular domain of 4-1BB corresponding to amino acids 214 to 255, or a fragment thereof. In another embodiment, a CAR can have a transmembrane domain of 4-1BB corresponding to amino acids 187 to 213, or a fragment thereof. An exemplary CAR is MBBz, which has an intracellular domain comprising a 4-1BB polypeptide (for example, amino acids 214 to 255 of NP_001552, SEQ ID NO:5) (see FIG. 1B). See GenBank NP_001552 for reference to domains within 4-1BB, for example, signal peptide, amino acids 1 to 17; extracellular domain, amino acids 18 to 186; transmembrane domain, amino acids 187 to 213; intracellular domain, amino acids 214 to 255. It is understood that sequences of 4-1BB that are shorter or longer than a specific delineated domain can be included in a CAR, if desired. It is also understood that a “4-1BB nucleic acid molecule” refers to a polynucleotide encoding a 4-1BB polypeptide.

(64) TABLE-US-00006 (NP_001552; SEQ ID NO: 5) 1 MGNSCYNIVA TLLLVLNFER TRSLQDPCSN CPAGTFCDNN RNQICSPCPP NSFSSAGGQR 61 TCDICRQCKG VFRTRKECSS TSNAECDCTP GFHCLGAGCS MCEQDCKQGQ ELTKKGCKDC 121 CFGTFNDQKR GICRPWTNCS LDGKSVLVNG TKERDVVCGP SPADLSPGAS SVTPPAPARE 181 PGHSPQIISF FLALTSTALL FLLFFLTLRF SVVKRGRKKL LYIFKQPFMR PVQTTQEEDG 241 CSCRFPEEEE GGCEL

(65) OX40.

(66) OX40, also referred to as tumor necrosis factor receptor superfamily member 4 precursor or CD134, is a member of the TNFR-superfamily of receptors. In one embodiment, a CAR can comprise a co-stimulatory signaling domain derived from OX40. An OX40 polypeptide can have an amino acid sequence corresponding to the sequence having GenBank No. P43489 (P43489.1, GI:1171933) or NP_003318 (NP_003318.1, GI:4507579), provided below, or fragments thereof. In one embodiment, a CAR can have a co-stimulatory domain comprising the intracellular domain of OX40 corresponding to amino acids 236 to 277, or a fragment thereof. In another embodiment, a CAR can have an amino acid sequence comprising the transmembrane domain of OX40 corresponding to amino acids 215 to 235 of OX40, or a fragment thereof. See GenBank NP_003318 for reference to domains within OX40, for example, signal peptide, amino acids 1 to 28; extracellular domain, amino acids 29 to 214; transmembrane domain, amino acids 215 to 235; intracellular domain, amino acids 236 to 277. It is understood that sequences of OX40 that are shorter or longer than a specific delineated domain can be included in a CAR, if desired. It is also understood that an “OX40 nucleic acid molecule” refers to a polynucleotide encoding an OX40 polypeptide.

(67) TABLE-US-00007 (NP_003318; SEQ ID NO: 6) 1 MCVGARRLGR GPCAALLLLG LGLSTVTGLH CVGDTYPSND RCCHECRPGN GMVSRCSRSQ 61 NTVCRPCGPG FYNDVVSSKP CKPCTWCNLR SGSERKQLCT ATQDTVCRCR AGTQPLDSYK 121 PGVDCAPCPP GHFSPGDNQA CKPWTNCTLA GKHTLQPASN SSDAICEDRD PPATQPQETQ 181 GPPARPITVQ PTEAWPRTSQ GPSTRPVEVP GGRAVAAILG LGLVLGLLGP LAILLALYLL 241 RRDQRLPPDA HKPPGGGSFR TPIQEEQADA HSTLAKI

(68) ICOS.

(69) Inducible T-cell costimulator precursor (ICOS), also referred to as CD278, is a CD28-superfamily costimulatory molecule that is expressed on activated T cells. In one embodiment, a CAR can comprise a co-stimulatory signaling domain derived from ICOS. An ICOS polypeptide can have an amino acid sequence corresponding to the sequence having GenBank No. NP_036224 (NP_036224.1, GI:15029518), provided below, or fragments thereof. In one embodiment, a CAR can have a co-stimulatory domain comprising the intracellular domain of ICOS corresponding to amino acids 162 to 199 of ICOS. In another embodiment, a CAR can have an amino acid sequence comprising the transmembrane domain of ICOS corresponding to amino acids 141 to 161 of ICOS, or a fragment thereof. See GenBank NP_036224 for reference to domains within ICOS, for example, signal peptide, amino acids 1 to 20; extracellular domain, amino acids 21 to 140; transmembrane domain, amino acids 141 to 161; intracellular domain, amino acids 162 to 199. It is understood that sequences of ICOS that are shorter or longer than a specific delineated domain can be included in a CAR, if desired. It is also understood that an “ICOS nucleic acid molecule” refers to a polynucleotide encoding an ICOS polypeptide.

(70) TABLE-US-00008 (NP_036224; SEQ ID NO: 7) 1 MKSGLWYFFL FCLRIKVLTG EINGSANYEM FIFHNGGVQI LCKYPDIVQQ FKMQLLKGGQ 61 ILCDLTKTKG SGNTVSIKSL KFCHSQLSNN SVSFFLYNLD HSHANYYFCN LSIFDPPPFK 121 VTLTGGYLHI YESQLCCQLK FWLPIGCAAF VVVCILGCIL ICWLTKKKYS SSVHDPNGEY 181 MFMRAVNTAK KSRLTDVTL

(71) DAP10.

(72) DAP10, also referred to as hematopoietic cell signal transducer, is a signaling subunit that associates with a large family of receptors in hematopoietic cells. In one embodiment, a CAR can comprise a co-stimulatory domain derived from DAP10. A DAP10 polypeptide can have an amino acid sequence corresponding to the sequence having GenBank No. NP_055081.1 (GI:15826850), provided below, or fragments thereof. In one embodiment, a CAR can have a co-stimulatory domain comprising the intracellular domain of DAP10 corresponding to amino acids 70 to 93, or a fragment thereof. In another embodiment, a CAR can have a transmembrane domain of DAP10 corresponding to amino acids 49 to 69, or a fragment thereof. See GenBank NP_055081.1 for reference to domains within DAP10, for example, signal peptide, amino acids 1 to 19; extracellular domain, amino acids 20 to 48; transmembrane domain, amino acids 49 to 69; intracellular domain, amino acids 70 to 93. It is understood that sequences of DAP10 that are shorter or longer than a specific delineated domain can be included in a CAR, if desired. It is also understood that a “DAP10 nucleic acid molecule” refers to a polynucleotide encoding an DAP10 polypeptide.

(73) TABLE-US-00009 (NP_055081.1; SEQ ID NO: 8) 1 MIHLGHILFL LLLPVAAAQT TPGERSSLPA FYPGTSGSCS GCGSLSLPLL AGLVAADAVA 61 SLLIVGAVFL CARPRRSPAQ EDGKVYINMP GRG

(74) The extracellular domain of a CAR can be fused to a leader or a signal peptide that directs the nascent protein into the endoplasmic reticulum and subsequent translocation to the cell surface. It is understood that, once a polypeptide containing a signal peptide is expressed at the cell surface, the signal peptide has generally been proteolytically removed during processing of the polypeptide in the endoplasmic reticulum and translocation to the cell surface. Thus, a polypeptide such as a CAR is generally expressed at the cell surface as a mature protein lacking the signal peptide, whereas the precursor form of the polypeptide includes the signal peptide. A signal peptide or leader can be essential if a CAR is to be glycosylated and/or anchored in the cell membrane. The signal sequence or leader is a peptide sequence generally present at the N-terminus of newly synthesized proteins that directs their entry into the secretory pathway. The signal peptide is covalently joined to the N-terminus of the extracellular antigen-binding domain of a CAR as a fusion protein. In one embodiment, the signal peptide comprises a CD8 polypeptide comprising amino acids MALPVTALLLPLALLLHAARP (SEQ ID NO:9). It is understood that use of a CD8 signal peptide is exemplary. Any suitable signal peptide, as are well known in the art, can be applied to a CAR to provide cell surface expression in an immunoinhibitory cell (see Gierasch Biochem. 28:923-930 (1989); von Heijne, J. Mol. Biol. 184 (1):99-105 (1985)). Particularly useful signal peptides can be derived from cell surface proteins naturally expressed in the immunoinhibitory cell, including any of the signal peptides of the polypeptides disclosed herein. Thus, any suitable signal peptide can be utilized to direct a CAR to be expressed at the cell surface of an immunoinhibitory cell.

(75) In certain non-limiting embodiments, an extracellular antigen-binding domain of a CAR can comprise a linker sequence or peptide linker connecting the heavy chain variable region and light chain variable region of the extracellular antigen-binding domain. In one non-limiting example, the linker comprises amino acids having the sequence set forth in GGGGSGGGGSGGGGS (SEQ ID NO:10).

(76) In certain non-limiting embodiments, a CAR can also comprise a spacer region or sequence that links the domains of the CAR to each other. For example, a spacer can be included between a signal peptide and an antigen binding domain, between the antigen binding domain and the transmembrane domain, between the transmembrane domain and the intracellular domain, and/or between domains within the intracellular domain, for example, between a stimulatory domain and a co-stimulatory domain. The spacer region can be flexible enough to allow interactions of various domains with other polypeptides, for example, to allow the antigen binding domain to have flexibility in orientation in order to facilitate antigen recognition. The spacer region can be, for example, the hinge region from an IgG, the CH.sub.2CH.sub.3 (constant) region of an immunoglobulin, and/or portions of CD3 (cluster of differentiation 3) or some other sequence suitable as a spacer.

(77) The transmembrane domain of a CAR generally comprises a hydrophobic alpha helix that spans at least a portion of the membrane. Different transmembrane domains result in different receptor stability. After antigen recognition, receptors cluster and a signal is transmitted to the cell. In an embodiment, the transmembrane domain of a CAR can be derived from another polypeptide that is naturally expressed in the immunoinhibitory cell. In one embodiment, a CAR can have a transmembrane domain derived from CD8, CD28, CD3ζ, CD4, 4-1BB, OX40, ICOS, CTLA-4, PD-1, LAG-3, 2B4, BTLA, or other polypeptides expressed in the immunoinhibitory cell having a transmembrane domain, including others as disclosed herein. Optionally, the transmembrane domain can be derived from a polypeptide that is not naturally expressed in the immunoinhibitory cell, so long as the transmembrane domain can function in transducing signal from antigen bound to the CAR to the intracellular signaling and/or co-stimulatory domains. It is understood that the portion of the polypeptide that comprises a transmembrane domain of the polypeptide can include additional sequences from the polypeptide, for example, additional sequences adjacent on the N-terminal or C-terminal end of the transmembrane domain, or other regions of the polypeptide, as desired.

(78) CD8.

(79) Cluster of differentiation 8 (CD8) is a transmembrane glycoprotein that serves as a co-receptor for the T cell receptor (TCR). CD8 binds to a major histocompatibility complex (MHC) molecule and is specific for the class I MHC protein. In one embodiment, a CAR can comprise a transmembrane domain derived from CD8. A CD8 polypeptide can have an amino acid sequence corresponding to the sequence having GenBank No. NP_001139345.1 (GI:225007536), as provided below, or fragments thereof. In one embodiment, a CAR can have an amino acid sequence comprising the transmembrane domain of CD8 corresponding to amino acids 183 to 203, or fragments thereof. In one embodiment, an exemplary CAR is Mz, which has a transmembrane domain derived from a CD8 polypeptide (see FIG. 1B). In another embodiment, an exemplary CAR is MBBz, which has a transmembrane domain derived from a CD8 polypeptide (see FIG. 1B). In one non-limiting embodiment, a CAR can comprise a transmembrane domain derived from a CD8 polypeptide comprising amino acids 183 to 203. In addition, a CAR can comprise a hinge domain comprising amino acids 137-182 of the CD8 polypeptide provided below. In another embodiment, a CAR can comprise amino acids 137-203 of the CD8 polypeptide provided below. In yet another embodiment, a CAR can comprise amino acids 137 to 209 of the CD8 polypeptide provided below. See GenBank NP_001139345.1 for reference to domains within CD8, for example, signal peptide, amino acids 1 to 21; extracellular domain, amino acids 22 to 182; transmembrane domain amino acids, 183 to 203; intracellular domain, amino acids 204 to 235. It is understood that additional sequence of CD8 beyond the transmembrane domain of amino acids 183 to 203 can be included in a CAR, if desired. It is further understood that sequences of CD8 that are shorter or longer than a specific dilineated domain can be included in a CAR, if desired. It also is understood that a “CD8 nucleic acid molecule” refers to a polynucleotide encoding a CD8 polypeptide.

(80) TABLE-US-00010 (NP_001139345.1; SEQ ID NO: 11) 1 MALPVTALLL PLALLLHAAR PSQFRVSPLD RTWNLGETVE LKCQVLLSNP TSGCSWLFQP 61 RGAAASPTFL LYLSQNKPKA AEGLDTQRFS GKRLGDTFVL TLSDFRRENE GYYFCSALSN 121 SIMYFSHFVP VFLPAKPTTT PAPRPPTPAP TIASQPLSLR PEACRPAAGG AVHTRGLDFA 181 CDIYIWAPLA GTCGVLLLSL VITLYCNHRN RRRVCKCPRP VVKSGDKPSL SARYV

(81) CD4.

(82) Cluster of differentiation 4 (CD4), also referred to as T-cell surface glycoprotein CD4, is a glycoprotein found on the surface of immune cells such as T helper cells, monocytes, macrophages, and dendritic cells. In one embodiment, a CAR can comprise a transmembrane domain derived from CD4. CD4 exists in various isoforms. It is understood that any isoform can be selected to achieve a desired function. Exemplary isoforms include isoform 1 (NP_000607.1, GI:10835167), isoform 2 (NP_001181943.1, GI:303522479), isoform 3 (NP_001181944.1, GI:303522485; or NP_001181945.1, GI:303522491; or NP_001181946.1, GI:303522569), and the like. One exemplary isoform sequence, isoform 1, is provided below. In one embodiment, a CAR can have an amino acid sequence comprising the transmembrane domain of CD4 corresponding to amino acids 397 to 418, or fragments thereof. See GenBank NP_000607.1 for reference to domains within CD4, for example, signal peptide, amino acids 1 to 25; extracellular domain, amino acids 26 to 396; transmembrane domain amino acids, 397 to 418; intracellular domain, amino acids 419 to 458. It is understood that additional sequence of CD4 beyond the transmembrane domain of amino acids 397 to 418 can be included in a CAR, if desired. It is further understood that sequences of CD4 that are shorter or longer than a specific dilineated domain can be included in a CAR, if desired. It also is understood that a “CD4 nucleic acid molecule” refers to a polynucleotide encoding a CD4 polypeptide.

(83) TABLE-US-00011 (NP_000607.1; SEQ ID NO: 12) 1 MNRGVPFRHL LLVLQLALLP AATQGKKVVL GKKGDTVELT CTASQKKSIQ FHWKNSNQIK 61 ILGNQGSFLT KGPSKLNDRA DSRRSLWDQG NFPLIIKNLK IEDSDTYICE VEDQKEEVQL 121 LVFGLTANSD THLLQGQSLT LTLESPPGSS PSVQCRSPRG KNIQGGKTLS VSQLELQDSG 181 TWTCTVLQNQ KKVEFKIDIV VLAFQKASSI VYKKEGEQVE FSFPLAFTVE KLTGSGELWW 241 QAERASSSKS WITFDLKNKE VSVKRVTQDP KLQMGKKLPL HLTLPQALPQ YAGSGNLTLA 301 LEAKTGKLHQ EVNLVVMRAT QLQKNLTCEV WGPTSPKLML SLKLENKEAK VSKREKAVWV 361 LNPEAGMWQC LLSDSGQVLL ESNIKVLPTW STPVQPMALI VLGGVAGLLL FIGLGIFFCV 421 RCRHRRRQAE RMSQIKRLLS EKKTCQCPHR FQKTCSPI

(84) As disclosed herein, mesothelin CARs exemplify CARs that can target an antigen, and CARs directed to other antigens can be generated using similar methods and others well known in the art, as described above. It is understood that domains of the polypeptides described herein can be used in a CAR, as useful to provide a desired function such as a signal peptide, antigen binding domain, transmembrane domain, intracellular signaling domain and/or co-stimulatory domain. For example, a domain can be selected such as a signal peptide, a transmembrane domain, an intracellular signaling domain, or other domain, as desired, to provide a particular function to a CAR of the invention. Possible desirable functions can include, but are not limited to, providing a signal peptide and/or transmembrane domain.

(85) 6.3. Dominant Negative Forms of an Inhibitor of a Cell-Mediated Immune Response

(86) According to the invention, an immunoinhibitory cell is engineered to express a dominant negative form (DN form) of an inhibitor of a cell-mediated immune response. It has been shown that PD-1 activation inhibits the suppressor function of regulatory T cells (Amaranth et al., Sci. Transl. Med. 3(111) (111ra120. doi: 10.1126/scitranslmed.3003130) (2011)). A DN form of an inhibitor of a cell-mediated immune response, such as PD-1 or another inhibitor disclosed herein, can be transduced into immunoinhibitory cells, such as regulatory T cells or other immunoinhibitory cells, as disclosed herein, to potentiate antigen-specific or non-specific immune inhibitory responses. The cells transduced with a DN form of an inhibitor of a cell-mediated immune response, such as PD-1, can have enhanced immunosuppressive effects that can benefit patients with a number of immune-mediated disorders, as described herein. Such immune-mediated disorders are described herein and include, but are not limited to, organ transplant rejection, an autoimmune disorder, multiple sclerosis, type 1 diabetes, arthritis, including rheumatoid arthritis or other forms of arthritis, primary biliary cirrhosis, myasthenia gravis, vitiligo, lupus, an allergic disorder, fetomaternal intolerance, and Alzheimer's disease. The immunoinhibitory cells of the invention expressing a DN form of an inhibitor of a cell-mediated immune response can be readily translated to the clinic. Without being bound by a particular mechanism or theory, the immunoinhibitory cells of the invention can be administered to a patient having an immune-mediated disorder without adding toxicity since the DN form simply binds (consumes) a negative signal induced by the ligand corresponding to the inhibitor molecule (e.g., PD-L1 in the case of PD-1) and avoids downstream signaling.

(87) An inhibitor of a cell-mediated immune response of the immunoinhibitory cell refers to a molecule that acts to inhibit or suppress the immune response effected by the immunoinhibitory cell. In one embodiment, the inhibitor of a cell-mediated immune response is an immune checkpoint inhibitor, also referred to as a checkpoint blockade.

(88) In one embodiment, the invention provides immunoinhibitory cells that co-express a CAR and a dominant negative form of an inhibitor of a cell-mediated immune response of the immunoinhibitory cell, for example, a receptor that functions in an immune checkpoint inhibitor pathway. Immune checkpoint pathways are inhibitory pathways that suppress the immune response of an immunoinhibitory cell. The pathways deliver negative signals to the immunoinhibitory cells and attenuate TCR-mediated signals, leading to decreased cell proliferation, cytokine production and cell cycle progression (see Pardoll, Nat. Rev. 12:252-264 (2012); Wu et al., Int. J. Biol. Sci. 8:1420-1430 (2012)). The immune checkpoint inhibitor pathway generally involves a ligand-receptor pair. Exemplary immune checkpoint inhibitor pathway receptors include, for example, PD-1, CTLA-4, BTLA, TIM-3, LAG-3, CD160, TIGIT, LAIR1, 2B4, and the like (see Chen et al., Nat. Rev. Immunol. 13(4):227-242 (2013)). The corresponding ligands for these receptors include, for example, PD-L1 (for PD-1); PD-L2 (for PD-1); CD80, CD86 (for CTLA-4); HVEM (for BTLA); Galectin-9, HMGB1 (for TIM-3); MHC II (for LAG-3); HVEM (for CD160); CD155, CD112, CD113 (for TIGIT); C1q, collagen (for LAIR1); CD48 (for 2B4), and the like (Chen et al., supra, 2013). Expression of a DN form in the immunoinhibitory cell provides for inhibition of a checkpoint inhibitor pathway that is intrinsic to the cell.

(89) A DN form of an inhibitor of a cell-mediated immune response that is a cell-surface receptor such as an immune checkpoint inhibitor pathway receptor can be generated by deleting some portion of the receptor to prevent intracellular signaling, thereby suppressing the immune checkpoint pathway and sustaining activation of the immunoinhibitory cell. In a specific embodiment, a DN form of the invention is a polypeptide comprising (a) at least a portion of an extracellular domain of an immune checkpoint inhibitor, where the portion comprises the ligand binding region, and (b) a transmembrane domain, where the polypeptide is a dominant negative form of the immune checkpoint inhibitor. Generally, a DN form of an inhibitor of an immune checkpoint inhibitor pathway receptor retains most or all of an extracellular domain of the receptor such that the extracellular domain retains sufficient protein interaction activity to bind to its respective ligand. Thus, in a specific embodiment, a polypeptide encoding a DN form comprises substantially all of an extracellular domain of an immune checkpoint inhibitor. It is understood that a polypeptide comprising “substantially all” of an extracellular domain includes a polypeptide that comprises the entire extracellular domain or a portion of the extracellular domain in which one to a few amino acids have been deleted from the N-terminus and/or C-terminus of the extracellular domain, for example deletion of 1, 2, 3, 4, or 5 amino acids from the N-terminus and/or C-terminus, so long as the remaining portion of the extracellular domain retains sufficient protein interaction activity to bind to its respective ligand. A DN form of the invention generally also lacks some portion or all of a signaling domain, such as the intracellular/cytoplasmic domain, such that the DN form has reduced activity or is inactive for signaling in the immune checkpoint pathway. Without being bound by a particular mechanism or theory, binding of the ligand to the DN form decreases binding of the ligand to the intact endogenous receptor, and/or the DN form complexes with signaling molecules, including the endogenous receptor, resulting in decreased signaling of an immune checkpoint pathway.

(90) A DN form of the invention generally has certain functional characteristics including, but not limited to, the ability to be expressed at the cell surface of an immunoinhibitory cell, the ability to bind to its respective ligand, and the inability or reduced ability to propagate an intracellular signal of an immune checkpoint pathway. One skilled in the art can readily generate a DN form of an inhibitor of a cell-mediated immune response by engineering the inhibitor to have such functional characteristics. In one embodiment, a DN form is constructed to retain the extracellular domain of inhibitor of a cell-mediated immune response, or at least a sufficient portion of the extracellular domain to retain ligand binding activity. In an exemplary embodiment, a DN form can be constructed using the extracellular domain of an inhibitor of a cell-mediated immune response, including, but not limited to, the extracellular domains of PD-1, CTLA-4, BTLA, TIM-3, LAG-3, CD160, TIGIT, LAIR1, 2B4, as disclosed herein. One skilled in the art will readily understand that it is not required to retain the entire extracellular domain of an inhibitor of a cell-mediated immune response, and that deletions from the N-terminus and/or C-terminus of the extracellular domain can be introduced so long as ligand binding activity is retained. One skilled in the art can readily determine the appropriateness of such N-terminal and/or C-terminal deletions based on the analysis of the receptor sequence to identify protein motifs known to provide ligand binding activity (see, for example, ExPASy (expasy.org), in particular PROSITE (prosite.expasy.org)). In addition or alternatively, suitable N-terminal and/or C-terminal deletions can be determined empirically by introducing deletions in a polypeptide and measuring binding activity for the respective ligand. Thus, one skilled in the art can readily determine an appropriate sequence of an inhibitor of a cell-mediated immune response to provide ligand binding activity to a DN form of the invention.

(91) It is understood that, whether an entire extracellular domain or a portion of the extracellular domain of a receptor is used in a DN form, additional sequences can optionally be included in the extracellular domain of the DN form. Such additional sequences can be derived from the parent polypeptide of the DN form, or the additional sequences can be derived from a different polypeptide. Such a polypeptide comprising sequences from a parent polypeptide and a different polypeptide is a non-naturally occurring, chimeric polypeptide. For example, a signal peptide or leader peptide is generally included so that the DN form will be expressed at the cell surface of the immunoinhibitory cell. It is understood that, once a polypeptide containing a signal peptide is expressed at the cell surface, the signal peptide has generally been proteolytically removed during processing of the polypeptide in the endoplasmic reticulum and translocation to the cell surface. Thus, a polypeptide such as a DN form is generally expressed at the cell surface as a mature protein lacking the signal peptide, whereas the precursor form of the polypeptide includes the signal peptide. The signal peptide can be the naturally occurring signal peptide of the receptor, or alternatively can be derived from a different protein. Exemplary signal peptides are described herein, including those described herein as being suitable for a CAR. To additionally provide expression at the cell surface, the DN form will generally include a transmembrane domain that provides for retention of the DN form at the cell surface. The transmembrane domain can be the naturally occurring transmembrane of the receptor, or alternatively can be derived from a different protein. In a particular embodiment, the transmembrane domain derived from another protein is derived from another receptor expressed on the cell surface of the immunoinhibitory cell. Exemplary transmembrane domains are described herein, including those described herein as being suitable for a CAR.

(92) In the case of an immune checkpoint pathway receptor, generally the signaling domain resides within the intracellular/cytoplasmic domain. The signaling activity of an immune checkpoint pathway receptor is generally mediated by protein-protein interactions with cell surface receptor(s) and/or intracellular signaling molecules. In one embodiment, a DN form lacks the entire intracellular domain, or a portion thereof, that functions in propagating the signal of an immune checkpoint pathway. It is understood that it is not necessary to delete the entire intracellular domain of the receptor so long as a sufficient portion of the intracellular signaling domain is deleted to inhibit or reduce signaling from the DN form. In addition or alternatively, mutations can be introduced into the intracellular signaling domain to inhibit or reduce signaling from the DN form. In addition or alternatively, a heterologous sequence with no signaling activity can be substituted for the intracellular signaling domain of the receptor to generate a DN form. One skilled in the art will readily understand that these and other well known methods can be utilized to generate a DN form of the invention.

(93) One exemplary embodiment of a dominant negative form of an immune checkpoint inhibitor is a dominant negative form of PD-1. A dominant negative form of PD-1 is exemplary of a DN form of an inhibitor of a cell-mediated immune response, including an immune checkpoint inhibitor. It is understood that a PD-1 DN form as disclosed herein is exemplary.

(94) As described herein, a DN form of an inhibitor of a cell-mediated immune response is designed to have reduced or inhibited intracellular signaling. The DN forms of the invention are generally based on inhibiting a receptor of an immune checkpoint pathway, which function to inhibit activation of an immunoinhibitory cell, for example, cell proliferation, cytokine production and/or cell cycle progression, in particular the immunosuppressive function of an immunoinhibitory cell of the invention. The DN forms of the invention are designed to remove the intracellular signaling domain, or a portion thereof, so that the signaling ability of the receptor is reduced or inhibited. The DN form also functions to inhibit signaling of the endogenous receptor. In a particular embodiment, the reduced or inhibited signaling overcomes the checkpoint blockade, resulting in sustained signaling and activation of the immunoinhibitory cell. It is understood that the signaling activity of the DN form can be completely knocked out or partially knocked out, so long as the partial reduction in activity is sufficient for the effect of providing enhanced activation of the immunoinhibitory cell in comparison to the absence of the DN form. Also, the DN form is not required to result in complete inactivation of signaling from the endogenous receptor but can reduce the activation of the endogenous receptor sufficient to overcome the checkpoint blockade and allow activation of the immunoinhibitory cell. One skilled in the art can readily determine the effect of a DN form on the activity of a parent receptor using assay methods well known in the art, including assays using in vivo models, such as animal models, to assess the effect of the DN form on the effectiveness of CAR expressing cells.

(95) As with a CAR for use in the invention, optional linker or spacer sequences can be included in a DN form, for example, a linker or spacer between a signal peptide and the extracellular ligand binding domain, particularly when heterologous sequences are fused. A linker or spacer can also optionally be included between the extracellular ligand binding domain and the transmembrane domain. Similarly, a linker or spacer can optionally be included between the transmembrane domain and any remaining intracellular domain. Such optional linkers or spacers are described herein. In addition, such linkers or spacers can be derived from a heterologous sequence. For example, as described above, a transmembrane domain derived from a heterologous polypeptide can optionally include additional sequences at the N-terminus and/or C-terminus derived from the heterologous polypeptide. Such additional sequences can function as a linker or spacer.

(96) In one embodiment, a dominant negative form of the invention can optionally further comprise a fusion to a co-stimulatory signaling domain, wherein the co-stimulatory signaling domain is carboxy-terminal to the transmembrane domain of the dominant negative form. Such a DN form is also referred to herein as a “switch receptor.” Such a DN form, or switch receptor, comprises at least a ligand binding domain of the extracellular region of an inhibitor of a cell-mediated immune response of the cell, such as an immune checkpoint inhibitor, fused to a transmembrane domain, fused to a co-stimulatory domain (i.e., cytoplasmic signaling domain) of an immunostimulatory molecule, thereby switching the activity upon ligand binding from inhibitory of the cell immune activity to stimulatory of the cell immune activity (see e.g., Liu et al., Cancer Res. 76:1578-1590 (2016)). A DN form further comprising a fusion to a co-stimulatory domain (i.e., switch receptor) also functions as a dominant negative form in such a construct since the signaling domain of the immune checkpoint inhibitor has been deleted. In one embodiment, a DN form further comprising a fusion to a co-stimulatory signaling domain is expressed in an immunoinhibitory cell. In another embodiment, a DN form further comprising a fusion to a co-stimulatory signaling domain is co-expressed with a CAR in an immunoinhibitory cell.

(97) A co-stimulatory signaling domain in a DN form fusion polypeptide can be derived, for example, from a cytoplasmic signaling domain of a receptor such as the co-stimulatory molecules described herein for use in a CAR, including but not limited to a 4-1BB polypeptide, a CD28 polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP10 polypeptide, and a 2B4 polypeptide. In a DN form comprising a fusion to a co-stimulatory signaling domain, the transmembrane domain can be derived from the polypeptide from which the co-stimulatory domain is derived, from the polypeptide from which the extracellular ligand binding domain of DN form is derived, or it can be a transmembrane domain from another polypeptide, similar to the description herein of the transmembrane domains that can be utilized to generate a CAR or DN form.

(98) In one embodiment, the invention provides an immunoinhibitory cell that recombinantly expresses a DN form, wherein the DN form further comprises a fusion to a co-stimulatory signaling domain, wherein the co-stimulatory signaling domain is fused carboxy-terminal to the transmembrane domain of the DN form. In certain embodiments of the invention, the cell or population of the invention recombinantly expresses a dominant negative form of an inhibitor of a cell-mediated immune response of the cell, wherein the dominant negative form further comprises a co-stimulatory signaling domain, wherein the co-stimulatory signaling domain is fused to the transmembrane domain of the dominant negative form (which in turn is fused to the at least a portion of the extracellular domain of an immune checkpoint inhibitor containing the ligand binding region of the dominant negative form). Such cells can be used to treat an immune-mediated disorder as disclosed herein. The invention provides for recombinant expression by an immunoinhibitory cell of a switch receptor (i.e., a DN form further comprising a co-stimulatory signaling domain), which switch receptor comprises (i) at least the extracellular ligand binding domain of an immune checkpoint inhibitor, (ii) a transmembrane domain, and (iii) a co-stimulatory signaling domain. The invention also provides for recombinant expression by an immunoinhibitory cell of both a CAR and a DN form further comprising a fusion to a co-stimulatory signaling domain (switch receptor), which comprises (i) at least the extracellular ligand binding domain of an immune checkpoint inhibitor, (ii) a transmembrane domain, and (iii) a co-stimulatory signaling domain. It is understood that, in such immunoinhibitory cells co-expressing a CAR and a DN form further comprising a fusion to a co-stimulatory signaling domain (switch receptor), the CAR binds to an antigen of the same disease or disorder as being treated. In one embodiment of cells co-expressing a CAR and a DN form comprising a fusion to a co-stimulatory signaling domain, the co-stimulatory signaling domain of the DN form is different from the co-stimulatory signaling domain of the CAR. In a particular embodiment, the co-stimulatory signaling domain of the DN form is the intracellular signaling domain of 4-1BB. In another particular embodiment, in an immunoinhibitory cell co-expressing a CAR and a DN form that further comprises a fusion to a co-stimulatory signaling domain, the co-stimulatory signaling domain of the CAR is the intracellular signaling domain of CD28. In another particular embodiment, the invention provides an immunoinhibitory cell co-expressing a CAR and a DN form that further comprises a fusion to a co-stimulatory signaling domain and a CAR, where the co-stimulatory signaling domain of the DN form is the intracellular signaling domain of 4-1BB and the co-stimulatory signaling domain of the CAR is the intracellular signaling domain of CD28.

(99) Exemplary DN forms of immune checkpoint inhibitors are described below in more detail. DN forms consisting essentially of the described sequences are also envisioned.

(100) PD-1.

(101) Programmed cell death protein 1 (PD-1) is a negative immune regulator of activated T cells upon engagement with its corresponding ligands, PD-L1 and PD-L2, expressed on endogenous macrophages and dendritic cells. PD-1 is a type I membrane protein of 268 amino acids. PD-1 has two ligands, PD-L1 and PD-L2, which are members of the B7 family. The protein's structure comprises an extracellular IgV domain followed by a transmembrane region and an intracellular tail. The intracellular tail contains two phosphorylation sites located in an immunoreceptor tyrosine-based inhibitory motif and an immunoreceptor tyrosine-based switch motif. PD-1 negatively regulates TCR signals. SHP-1 and SHP-2 phosphatases bind to the cytoplasmic tail of PD-1 upon ligand binding. Upregulation of PD-L1 is one mechanism tumor cells use to evade the host immune system. In pre-clinical and clinical trials, PD-1 blockade by antagonistic antibodies induced anti-tumor responses mediated through the host endogenous immune system.

(102) A PD-1 polypeptide can have an amino acid corresponding to GenBank No. NP_005009.2 (GI:167857792), as provided below, or fragments thereof. See GenBank NP_005009.2 for reference to domains within PD-1, for example, signal peptide, amino acids 1 to 20; extracellular domain, amino acids 21 to 170; transmembrane domain, amino acids 171 to 191; intracellular domain, amino acids 192 to 288. It is understood that an “PD-1 nucleic acid molecule” refers to a polynucleotide encoding an PD-1 polypeptide.

(103) TABLE-US-00012 (NP_005009.2; SEQ ID NO: 13) 1 MQIPQAPWPV VWAVLQLGWR PGWFLDSPDR PWNPPTFSPA LLVVTEGDNA TFTCSFSNTS 61 ESFVLNWYRM SPSNQTDKLA AFPEDRSQPG QDCRFRVTQL PNGRDFHMSV VRARRNDSGT 121 YLCGAISLAP KAQIKESLRA ELRVTERRAE VPTAHPSPSP RPAGQFQTLV VGVVGGLLGS 181 LVLLVWVLAV ICSRAARGTI GARRTGQPLK EDPSAVPVFS VDYGELDFQW REKTPEPPVP 241 CVPEQTEYAT IVFPSGMGTS SPARRGSADG PRSAQPLRPE DGHCSWPL

(104) In one embodiment, the invention provides an inhibitor of a cell-mediated immune response that is a PD-1 dominant negative form (DN form). In one embodiment, the PD-1 DN form comprises the extracellular ligand binding domain of PD-1. In one embodiment, the PD-1 DN form comprises the extracellular ligand binding domain of PD-1 and a transmembrane domain (e.g., mature form). In another embodiment, the PD-1 DN form comprises the extracellular ligand binding domain of PD-1, a transmembrane domain and a signal peptide (e.g., precursor form). The invention also provides encoding polypeptides and nucleic acids of the PD-1 DN forms of the invention. In a particular embodiment, the PD-1 extracellular ligand binding domain is fused to one or more heterologous polypeptide sequences, that is, the PD-1 DN form is a chimeric sequence. For example, the PD-1 extracellular ligand binding domain can be fused at its N-terminus to a signal peptide that is optionally a heterologous signal peptide, including various signal peptides described herein. In addition, a PD-1 DN form can comprise a transmembrane domain that is optionally a heterologous transmembrane domain, including any of various transmembrane domains described herein. Although the PD-1 DN form exemplified in the Example herein comprises heterologous sequences fused to the extracellular domain of PD-1, it is understood that a PD-1 DN form can comprise PD-1 sequence only.

(105) In one embodiment, the invention provides a PD-1 DN form that comprises the extracellular domain, or a ligand binding portion thereof, of PD-1, for example, amino acids 21 to 170 corresponding to the extracellular domain of PD-1 (GenBank NP_005009.2; SEQ ID NO:13). A cell expressing such a PD-1 DN form should lack the ability or have reduced ability to signal in a PD-1 immune checkpoint pathway. In one embodiment, a PD-1 DN form is a deletion mutant having a deletion of the intracellular domain, for example, amino acids 192 to 288 of PD-1 (GenBank NP_005009.2; SEQ ID NO:13), or a portion thereof, such that intracellular signaling of the immune checkpoint pathway mediated by PD-1 is reduced or inhibited. Additional embodiments of a DN form of PD-1 are described below.

(106) In one embodiment, a PD-1 DN form comprises an amino acid sequence comprising the extracellular domain of PD-1 fused to the transmembrane and hinge domains of CD8. In one embodiment, a PD-1 DN form comprises amino acids 21 to 165 of a PD-1 sequence (NP_005009.2; SEQ ID NO:13). Such a PD-1 DN form comprises the extracellular domain of PD-1. In another embodiment, the invention provides a PD-1 DN form comprising amino acids 1 to 165 (precursor form) or amino acids 21 to 165 (mature form) of a PD-1 sequence (NP_005009.2; SEQ ID NO:13). Such a DN form comprises the signal peptide of PD-1, amino acids 1 to 20, and extracellular domain amino acids 21 to 165, whereas the mature form lacks the signal peptide. In one embodiment, a PD-1 DN form comprises amino acids 21 to 151 of a PD-1 sequence (NP_005009.2; SEQ ID NO:13). In another embodiment, the invention provides a PD-1 DN form comprising amino acids 1 to 151 (precursor form) or amino acids 21 to 151 (mature form) of a PD-1 sequence (NP_005009.2; SEQ ID NO:13). Optionally, a PD-1 DN form comprises an extracellular ligand binding domain starting at amino acid 21 through an amino acid between amino acids 151 to 165 of a PD-1 sequence (NP_005009.2; SEQ ID NO:13). In another embodiment, a PD-1 DN form comprises the transmembrane domain of CD8, amino acids 183 to 203 of a CD8 sequence (NP_001139345.1; SEQ ID NO:11). Such an embodiment is representative of a chimeric DN form comprising a transmembrane domain from a different (heterologous) polypeptide. As described above, a DN form comprising a heterologous domain such as a transmembrane domain can optionally include additional sequence from the heterologous polypeptide. In one such embodiment, a DN form is provided that comprises additional sequence from the heterologous polypeptide N-terminal of the transmembrane domain. In one embodiment, the DN form comprises the hinge domain of CD8. In a particular embodiment, the heterologous sequence comprises additional N-terminal sequence of amino acids 137 to 182, or optionally starting at amino acids 138 or 139, of a CD8 sequence (NP_001139345.1; SEQ ID NO:11). In another embodiment, a DN form is provided that comprises additional sequence from the heterologous polypeptide C-terminal of the transmembrane domain. In a particular embodiment, the heterologous sequence comprises additional C-terminal sequence from amino acids 204 to 209 of a CD8 sequence (NP_001139345.1; SEQ ID NO:11). In one embodiment, the PD-1 DN form comprises the transmembrane domain of CD8, amino acids 183 to 203, optionally a hinge domain comprising amino acids 137 to 182 (or optionally starting at amino acids 138 or 139), and/or additional C-terminal sequence comprising amino acids 204 to 209. In a particular embodiment of the invention, a PD-1 DN form is provided that comprises amino acids 1 to 165 of a PD-1 sequence (NP_005009.2; SEQ ID NO:13), and amino acids 137 to 209, optionally starting at amino acids 138 or 139, of a CD8 sequence (NP_001139345.1; SEQ ID NO:11).

(107) In a further particular embodiment, the invention provides a PD-1 DN form comprising the sequence provided below, where the underlined sequence is derived from PD-1 and the italicized sequence is derived from CD8.

(108) TABLE-US-00013 (SEQ ID NO: 14) MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNA TFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQL PNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE VPTAHPSPSPRPAGQAAAPTTTPAPRPPTPAPTIASQPLSLRPEACRPAA GGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRRIQ

(109) In an additional embodiment, a DN form of the invention optionally comprises a P2A sequence, which provides for optional co-expression of a reporter molecule. P2A is a self-cleaving peptide sequence, which can be used for bicistronic or multicistronic expression of protein sequences (see Szymczak et al., Expert Opin. Biol. Therapy 5(5):627-638 (2005)). An exemplary P2A sequence is GSGATNFSLLKQAGDVEENPGPM (SEQ ID NO:15). In a further embodiment, a DN form of the invention is co-expressed with a reporter protein. In a particular embodiment, the reporter protein is mCherry fluorescent protein. In a particular embodiment, the mCherry polypeptide sequence is as provided below. It is understood that mCherry is merely exemplary and that any desired reporter molecule, such as a fluorescent protein can be included as a reporter, as described herein.

(110) TABLE-US-00014 (SEQ ID NO: 16) MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWER VMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEA SSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNV NIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

(111) In a further particular embodiment, a PD-1 DN form is expressed as a polypeptide construct as provided below, where the underlined sequence is derived from PD-1, the italicized sequence is derived from CD8, the P2A sequence is double underlined, and the mCherry sequence is underlined and italicized.

(112) TABLE-US-00015 (SEQ ID NO: 17) MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNA TFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQL PNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE VPTAHPSPSPRPAGQAAAPTTTPAPRPPTPAPTIASQPLSLRPEACRPAA GGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRRIQGSGATN FSLLKQAGDVEENPGPMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEI EGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADI PDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNF PSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKT TYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDEL YK

(113) In a particular embodiment, a nucleic acid encoding a PD-1 DNR form construct is provided below, where the underlined sequence encodes amino acids derived from PD-1 DN, the italicized sequence encodes amino acids derived from CD8, the P2A encoding sequence is double underlined, the mCherry encoding sequence is underlined and italicized, a Kozak sequence is bolded with a dashed underline, and restriction sites Age I and Xho I are underlined with a dotted line at the 5′ and 3′ ends, respectively.

(114) TABLE-US-00016 (SEQ ID NO: 18) embedded image AGACTAAGAACCTAGAACCTCGCTGGAAAGGACCTTACACAGTCCTGCTGACCACC CCCACCGCCCTCAAAGTAGACGGCATCGCAGCTTGGATACACGCCGCCCACGTGAA embedded image AGGCGCCCTGGCCAGTCGTCTGGGCGGTGCTACAACTGGGCTGGCGGCCAGGATGG TTCTTAGACTCCCCAGACAGGCCCTGGAACCCCCCACCTTCTCCCCAGCCCTGCTC GTGGTGACCGAAGGGGACAACGCCACCTTCACCTGCAGCTTCTCCAACACATCGGA GAGCTTCGTGCTAAACTGGTACCGCATGAGCCCCAGCAACCAGACGGACAAGCTGG CCGCTTTCCCCGAGGACCGCAGCCAGCCCGGCCAGGACTGCCGCTTCCGTGTCACAC AACTGCCCAACGGGCGTGACTTCCACATGAGCGTGGTCAGGGCCCGGCGCAATGAC AGCGGCACCTACCTCTGTGGGGCCATCTCCCTGGCCCCCAAGGCGCAGATCAAAGA GAGCCTGCGGGCAGAGCTCAGGGTGACAGAGAGAAGGGCAGAAGTGCCCACAGCC CACCCCAGCCCCTCACCCAGGCCAGCCGGCCAGGCGGCCGCACCCACCACGACGCCA GCGCCGCGACCACCAACCCCGGCGCCCACGATCGCGTCGCAGCCCCTGTCCCTGCGCC CAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCG CCTGTGATATCTACATCTGGGCGCCCCTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCAC TGGTTATCACCCTTTACTGCAACCACAGGCGGATCCAAGGATCTGGAGCAACAAACTT CTCACTACTCAAACAAGCAGGTGACGTGGAGGAGAATCCCGGCCCCATGGTGAGCAA GGGCGAGGAGGATAACATGGCCATCATCAAGGAGTTCATGCGCTTCAAGGTGCACATGGA GGGCTCCGTGAACGGCCACGAGTTCGAGATCGAGGGCGAGGGCGAGGGCCGCCCCTAC GAGGGCACCCAGACCGCCAAGCTGAAGGTGACCAAGGGTGGCCCCCTGCCCTTCGCCT GGGACATCCTGTCCCCTCAGTTCATGTACGGCTCCAAGGCCTACGTGAAGCACCCCGCC GACATCCCCGACTACTTGAAGCTGTCCTTCCCCGAGGGCTTCAAGTGGGAGCGCGTGATG AACTTCGAGGACGGCGGCGTGGTGACCGTGACCCAGGACTCCTCCCTGCAGGACGGCG AGTTCATCTACAAGGTGAAGCTGCGCGGCACCAACTTCCCCTCCGACGGCCCCGTAATGC AGAAGAAGACCATGGGCTGGGAGGCCTCCTCCGAGCGGATGTACCCCGAGGACGGCGC CCTGAAGGGCGAGATCAAGCAGAGGCTGAAGCTGAAGGACGGCGGCCACTACGACGCT GAGGTCAAGACCACCTACAAGGCCAAGAAGCCCGTGCAGCTGCCCGGCGCCTACAACGT CAACATCAAGTTGGACATCACCTCCCACAACGAGGACTACACCATCGTGGAACAGTACGA embedded image

(115) CTLA-4.

(116) Cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) is an inhibitory receptor expressed by activated T cells, which when engaged by its corresponding ligands (CD80 and CD86; B7-1 and B7-2, respectively), mediates activated T cell inhibition or anergy. In both preclinical and clinical studies, CTLA-4 blockade by systemic antibody infusion enhanced the endogenous anti-tumor response albeit, in the clinical setting, with significant unforeseen toxicities. CTLA-4 contains an extracellular V domain, a transmembrane domain, and a cytoplasmic tail. Alternate splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. The intracellular domain is similar to that of CD28, in that it has no intrinsic catalytic activity and contains one YVKM (SEQ ID NO:29) motif able to bind PI3K, PP2A and SHP-2 and one proline-rich motif able to bind SH3 containing proteins. One role of CTLA-4 in inhibiting T cell responses seems to be directly via SHP-2 and PP2A dephosphorylation of TCR-proximal signaling proteins such as CD3 and LAT. CTLA-4 can also affect signaling indirectly via competing with CD28 for CD80/86 binding. CTLA-4 has also been shown to bind and/or interact with PI3K, CD80, AP2M1, and PPP2R5A.

(117) A CTLA-4 polypeptide can have an amino acid sequence corresponding to GenBank No. AAH69566.1 (GI:46854814) or NP_005205.2 (GI:21361212), sequence as provided below, or fragments thereof. See GenBank NP_005205.2 for reference to domains within CTLA-4, for example, signal peptide, amino acids 1 to 35; extracellular domain, amino acids 36 to 161; transmembrane domain, amino acids 162 to 182; intracellular domain, amino acids 183 to 223. It is understood that a “CTLA-4 nucleic acid molecule” refers to a polynucleotide encoding a CTLA-4 polypeptide.

(118) TABLE-US-00017 (NP_005205.2; SEQ ID NO: 19) 1 MACLGFQRHK AQLNLATRTW PCTLLFFLLF IPVFCKAMHV AQPAVVLASS RGIASFVCEY 61 ASPGKATEVR VTVLRQADSQ VTEVCAATYM MGNELTFLDD SICTGTSSGN QVNLTIQGLR 121 AMDTGLYICK VELMYPPPYY LGIGNGTQIY VIDPEPCPDS DFLLWILAAV SSGLFFYSFL 181 LTAVSLSKML KKRSPLTTGV YVKMPPTEPE CEKQFQPYFI PIN

(119) In one embodiment, the invention provides a CTLA-4 DN form. In one embodiment, the CTLA-4 DN form comprises the extracellular ligand binding domain of CTLA-4. In one embodiment, the CTLA-4 DN form comprises the extracellular ligand binding domain of CTLA-4 and a transmembrane domain (e.g., mature form). In another embodiment, the CTLA-4 DN form comprises the extracellular ligand binding domain of CTLA-4, a transmembrane domain and a signal peptide (e.g., precursor form). The invention also provides encoding polypeptides and nucleic acids of the CTLA-4 DN forms of the invention. In a particular embodiment, the CTLA-4 extracellular ligand binding domain is fused to one or more heterologous polypeptide sequences, that is, the CTLA-4 DN form is chimeric. For example, the CTLA-4 extracellular ligand binding domain can be fused at its N-terminus to a signal peptide that is optionally a heterologous signal peptide, including various signal peptides described herein. In addition, a CTLA-4 DN form can comprise a transmembrane domain that is optionally a heterologous transmembrane domain, including any of various transmembrane domains described herein.

(120) In an embodiment of the invention, the CTLA-4 DN form can comprise the extracellular domain, or a ligand binding portion thereof, of CTLA-4, for example, amino acids 36 to 161 corresponding to the extracellular domain of CTLA-4 (GenBank NP_005205.2; SEQ ID NO:19). A cell expressing such a CTLA-4 DN form should lack the ability or have reduced ability to signal in a CTLA-4 immune checkpoint pathway. In one embodiment, a CTLA-4 DN form is a deletion mutant having a deletion of the intracellular domain, for example, amino acids 183 to 223 of CTLA-4 (GenBank NP_005205.2; SEQ ID NO:19), or a portion thereof, such that intracellular signaling of the immune checkpoint pathway mediated by CTLA-4 is reduced or inhibited.

(121) BTLA.

(122) B- and T-lymphocyte attenuator (BTLA) expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. BTLA interacts with a B7 homolog, B7H4. BTLA displays T-Cell inhibition via interaction with tumor necrosis family receptors (TNF-R), not just the B7 family of cell surface receptors. BTLA is a ligand for tumor necrosis factor (receptor) superfamily, member 14 (TNFRSF14), also known as herpes virus entry mediator (HVEM). BTLA-HVEM complexes negatively regulate T-cell immune responses. BTLA activation has been shown to inhibit the function of human CD8.sup.+ cancer-specific T cells. BTLA has also been designated as CD272 (cluster of differentiation 272).

(123) A BTLA polypeptide can have an amino acid sequence corresponding homologous to GenBank No. AAP44003.1 (GI:31880027) or NP_861445.3 (GI:145580621), sequence provided below, or fragments thereof. See GenBank NP_861445.3 for reference to domains within BTLA, for example, signal peptide, amino acids 1 to 30; extracellular domain, amino acids 31 to 157; transmembrane domain, amino acids 158 to 178; intracellular domain, amino acids 179 to 289. It is understood that a “BTLA nucleic acid molecule” refers to a polynucleotide encoding a BTLA polypeptide.

(124) TABLE-US-00018 (NP_861445.3; SEQ ID NO: 20) 1 MKTLPAMLGT GKLFWVFFLI PYLDIWNIHG KESCDVQLYI KRQSEHSILA GDPFELECPV 61 KYCANRPHVT WCKLNGTTCV KLEDRQTSWK EEKNISFFIL HFEPVLPNDN GSYRCSANFQ 121 SNLIESHSTT LYVTDVKSAS ERPSKDEMAS RPWLLYSLLP LGGLPLLITT CFCLFCCLRR 181 HQGKQNELSD TAGREINLVD AHLKSEQTEA STRQNSQVLL SETGIYDNDP DLCFRMQEGS 241 EVYSNPCLEE NKPGIVYASL NHSVIGPNSR LARNVKEAPT EYASICVRS

(125) In one embodiment, the invention provides a BTLA DN form. In one embodiment, the BTLA DN form comprises the extracellular ligand binding domain of BTLA. In one embodiment, the BTLA DN form comprises the extracellular ligand binding domain of BTLA and a transmembrane domain (e.g., mature form). In another embodiment, the BTLA DN form comprises the extracellular ligand binding domain of BTLA, a transmembrane domain and a signal peptide (e.g., precursor form). The invention also provides encoding polypeptides and nucleic acids of the BTLA DN forms of the invention. In a particular embodiment, the BTLA extracellular ligand binding domain is fused to one or more heterologous polypeptide sequences, that is, the BTLA DN form is chimeric. For example, the BTLA extracellular ligand binding domain can be fused at its N-terminus to a signal peptide that is optionally a heterologous signal peptide, including various signal peptides described herein. In addition, a BTLA DN form can comprise a transmembrane domain that is optionally a heterologous transmembrane domain, including any of various transmembrane domains described herein.

(126) In an embodiment of the invention, the BTLA DN form can comprise the extracellular domain, or a ligand binding portion thereof, of BTLA, for example, amino acids 31 to 157 corresponding to the extracellular domain of BTLA (GenBank NP_861445.3; SEQ ID NO:20). A cell expressing such a BTLA DN form should lack the ability or have reduced ability to signal in a BTLA immune checkpoint pathway. In one embodiment, a BTLA DN form is a deletion mutant having a deletion of the intracellular domain, for example, amino acids 179 to 289 of BTLA (GenBank NP_861445.3; SEQ ID NO:20), or a portion thereof, such that intracellular signaling of the immune checkpoint pathway mediated by BTLA is reduced or inhibited.

(127) TIM-3.

(128) T cell immunoglobulin mucin-3 (TIM-3), also referred to as hepatitis A virus cellular receptor 2 precursor, is a Th1-specific cell surface protein that regulates macrophage activation. Tim-3 was first identified as a molecule selectively expressed on IFN-γ-producing CD4+T helper 1 (Th1) and CD8+T cytotoxic 1 (Tc1) T cells. TIM-3 possess an N-terminal Ig domain of the V type, followed by a mucin domain.

(129) A TIM-3 polypeptide can have an amino acid sequence corresponding to GenBank No. NP_116171.3 (GI:49574534), sequence provided below, or fragments thereof. See GenBank NP_116171.3 for reference to domains within TIM-3, for example, signal peptide, amino acids 1 to 21; extracellular domain, amino acids 22 to 202; transmembrane domain, amino acids 203 to 223; intracellular domain, amino acids 224 to 301. It is understood that a “TIM-3 nucleic acid molecule” refers to a polynucleotide encoding a TIM-3 polypeptide.

(130) TABLE-US-00019 (NP_116171.3; SEQ ID NO: 21) 1 MFSHLPFDCV LLLLLLLLTR SSEVEYRAEV GQNAYLPCFY TPAAPGNLVP VCWGKGACPV 61 FECGNVVLRT DERDVNYWTS RYWLNGDFRK GDVSLTIENV TLADSGIYCC RIQIPGIMND 121 EKFNLKLVIK PAKVTPAPTR QRDFTAAFPR MLTTRGHGPA ETQTLGSLPD INLTQISTLA 181 NELRDSRLAN DLRDSGATIR IGIYIGAGIC AGLALALIFG ALIFKWYSHS KEKIQNLSLI 241 SLANLPPSGL ANAVAEGIRS EENIYTIEEN VYEVEEPNEY YCYVSSRQQP SQPLGCRFAM 301 P

(131) In one embodiment, the invention provides a TIM-3 DN form. In one embodiment, the TIM-3 DN form comprises the extracellular ligand binding domain of TIM-3. In one embodiment, the TIM-3 DN form comprises the extracellular ligand binding domain of TIM-3 and a transmembrane domain (e.g., mature form). In another embodiment, the TIM-3 DN form comprises the extracellular ligand binding domain of TIM-3, a transmembrane domain and a signal peptide (e.g., precursor form). The invention also provides encoding polypeptides and nucleic acids of the TIM-3 DN forms of the invention. In a particular embodiment, the TIM-3 extracellular ligand binding domain is fused to one or more heterologous polypeptide sequences, that is, the TIM-3 DN form is chimeric. For example, the TIM-3 extracellular ligand binding domain can be fused at its N-terminus to a signal peptide that is optionally a heterologous signal peptide, including various signal peptides described herein. In addition, a TIM-3 DN form can comprise a transmembrane domain that is optionally a heterologous transmembrane domain, including any of various transmembrane domains described herein.

(132) In an embodiment of the invention, the TIM-3 DN form can comprise the extracellular domain, or a ligand binding portion thereof, of TIM-3, for example, amino acids 22 to 202 corresponding to the extracellular domain of TIM-3 (GenBank NP_116171.3; SEQ ID NO:21). A cell expressing such a TIM-3 DN form should lack the ability or have reduced ability to signal in a TIM-3 immune checkpoint pathway. In one embodiment, a TIM-3 DN form is a deletion mutant having a deletion of the intracellular domain, for example, amino acids 224 to 301 of TIM-3 (GenBank NP_116171.3; SEQ ID NO:21), or a portion thereof, such that intracellular signaling of the immune checkpoint pathway mediated by TIM-3 is reduced or inhibited.

(133) LAG-3.

(134) Lymphocyte-activation protein 3 (LAG-3) is a negative immune regulator of immune cells. LAG-3 belongs to the immunoglobulin (Ig) superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG-3 to CD4. LAG-3 has also been designated CD223 (cluster of differentiation 223).

(135) A LAG-3 polypeptide can have an amino acid sequence corresponding to GenBank No. CAA36243.3 (GI:15617341) or NP_002277.4 (GI:167614500), sequence provided below, or fragments thereof. See GenBank NP_002277.4 for reference to domains within LAG-3, for example, signal peptide, amino acids 1 to 22; extracellular domain, amino acids 23 to 450; transmembrane domain, amino acids 451 to 471; intracellular domain, amino acids 472 to 525. It is understood that a “LAG-3 nucleic acid molecule” refers to a polynucleotide encoding a LAG-3 polypeptide.

(136) TABLE-US-00020 (NP_002277.4; SEQ ID NO: 22) 1 MWEAQFLGLL FLQPLWVAPV KPLQPGAEVP VVWAQEGAPA QLPCSPTIPL QDLSLLRRAG 61 VTWQHQPDSG PPAAAPGHPL APGPHPAAPS SWGPRPRRYT VLSVGPGGLR SGRLPLQPRV 121 QLDERGRQRG DFSLWLRPAR RADAGEYRAA VHLRDRALSC RLRLRLGQAS MTASPPGSLR 181 ASDWVILNCS FSRPDRPASV HWFRNRGQGR VPVRESPHHH LAESFLFLPQ VSPMDSGPWG 241 CILTYRDGFN VSIMYNLTVL GLEPPTPLTV YAGAGSRVGL PCRLPAGVGT RSFLTAKWTP 301 PGGGPDLLVT GDNGDFTLRL EDVSQAQAGT YTCHIHLQEQ QLNATVTLAI ITVTPKSFGS 361 PGSLGKLLCE VTPVSGQERF VWSSLDTPSQ RSFSGPWLEA QEAQLLSQPW QCQLYQGERL 421 LGAAVYFTEL SSPGAQRSGR APGALPAGHL LLFLILGVLS LLLLVTGAFG FHLWRRQWRP 481 RRFSALEQGI HPPQAQSKIE ELEQEPEPEP EPEPEPEPEP EPEQL

(137) In one embodiment, the invention provides a LAG-3 DN form. In one embodiment, the LAG-3 DN form comprises the extracellular ligand binding domain of LAG-3. In one embodiment, the LAG-3 DN form comprises the extracellular ligand binding domain of LAG-3 and a transmembrane domain (e.g., mature form). In another embodiment, the LAG-3 DN form comprises the extracellular ligand binding domain of LAG-3, a transmembrane domain and a signal peptide (e.g., precursor form). The invention also provides encoding polypeptides and nucleic acids of the LAG-3 DN forms of the invention. In a particular embodiment, the LAG-3 extracellular ligand binding domain is fused to one or more heterologous polypeptide sequences, that is, the LAG-3 DN form is chimeric. For example, the LAG-3 extracellular ligand binding domain can be fused at its N-terminus to a signal peptide that is optionally a heterologous signal peptide, including various signal peptides described herein. In addition, a LAG-3 DN form can comprise a transmembrane domain that is optionally a heterologous transmembrane domain, including any of various transmembrane domains described herein.

(138) In an embodiment of the invention, the LAG-3 DN form can comprise the extracellular domain, or a ligand binding portion thereof, of LAG-3, for example, amino acids 23 to 450 corresponding to the extracellular domain of LAG-3 (GenBank NP_002277.4; SEQ ID NO:22). A cell expressing such a LAG-3 DN form should lack the ability or have reduced ability to signal in a LAG-3 immune checkpoint pathway. In one embodiment, a LAG-3 DN form is a deletion mutant having a deletion of the intracellular domain, for example, amino acids 472 to 525 of LAG-3 (GenBank NP_002277.4; SEQ ID NO:22), or a portion thereof, such that intracellular signaling of the immune checkpoint pathway mediated by LAG-3 is reduced or inhibited.

(139) TIGIT.

(140) T-cell immunoreceptor with Ig and ITIM domains (TIGIT) is a cell surface protein that suppresses T-cell activation. It belongs to the poliovirus receptor (PVR) family of immunoglobulin (Ig) proteins that share 3 conserved sequence motifs in their N-terminal Ig domains. A TIGIT polypeptide can have an amino acid sequence corresponding to GenBank No. NP_776160.2 (GI:256600228), sequence provided below, or fragments thereof. See GenBank NP_776160.2 for reference to domains within TIGIT, for example, signal peptide, amino acids 1 to 21; extracellular domain, amino acids 22 to 141; transmembrane domain, amino acids 142 to 162; intracellular domain, amino acids 163 to 244. It is understood that a “TIGIT nucleic acid molecule” refers to a polynucleotide encoding a TIGIT polypeptide.

(141) TABLE-US-00021 (NP_776160.2; SEQ ID NO: 23) 1 MRWCLLLIWA QGLRQAPLAS GMMTGTIETT GNISAEKGGS IILQCHLSST TAQVTQVNWE 61 QQDQLLAICN ADLGWHISPS FKDRVAPGPG LGLTLQSLTV NDTGEYFCIY HTYPDGTYTG 121 RIFLEVLESS VAEHGARFQI PLLGAMAATL VVICTAVIVV VALTRKKKAL RIHSVEGDLR 181 RKSAGQEEWS PSAPSPPGSC VQAEAAPAGL CGEQRGEDCA ELHDYFNVLS YRSLGNCSFF 241 TETG

(142) In one embodiment, the invention provides a TIGIT DN form. In one embodiment, the TIGIT DN form comprises the extracellular ligand binding domain of TIGIT. In one embodiment, the TIGIT DN form comprises the extracellular ligand binding domain of TIGIT and a transmembrane domain (e.g., mature form). In another embodiment, the TIGIT DN form comprises the extracellular ligand binding domain of TIGIT, a transmembrane domain and a signal peptide (e.g., precursor form). The invention also provides encoding polypeptides and nucleic acids of the TIGIT DN forms of the invention. In a particular embodiment, the TIGIT extracellular ligand binding domain is fused to one or more heterologous polypeptide sequences, that is, the TIGIT DN form is chimeric. For example, the TIGIT extracellular ligand binding domain can be fused at its N-terminus to a signal peptide that is optionally a heterologous signal peptide, including various signal peptides described herein. In addition, a TIGIT DN form can comprise a transmembrane domain that is optionally a heterologous transmembrane domain, including any of various transmembrane domains described herein.

(143) In an embodiment of the invention, the TIGIT DN form can comprise the extracellular domain, or a ligand binding portion thereof, of TIGIT, for example, amino acids 22 to 141 corresponding to the extracellular domain of TIGIT (GenBank NP_776160.2; SEQ ID NO:23). A cell expressing such a TIGIT DN form should lack the ability or have reduced ability to signal in a TIGIT immune checkpoint pathway. In one embodiment, a TIGIT DN form is a deletion mutant having a deletion of the intracellular domain, for example, amino acids 163 to 244 of TIGIT (GenBank NP_776160.2; SEQ ID NO:23), or a portion thereof, such that intracellular signaling of the immune checkpoint pathway mediated by TIGIT is reduced or inhibited.

(144) LAIR1.

(145) Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) is an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of natural killer (NK) cells, B-cells and T-cells. LAIR exists in various isoforms. It is understood that any isoform can be selected to achieve a desired function. Exemplary isoforms include isoform a (NP_002278.2, GI:612407859), isoform b (NP_068352.2, GI:612407861), isoform c (NP_001275952.2, GI:612407867), isoform e (NP_001275954.2, GI:612407869), isoform f (NP_001275955.2, GI:612407863), isoform g (NP_001275956.2, GI:612407865), and the like. One exemplary isoform sequence, isoform a, is provided below. In one embodiment, a LAIR1 polypeptide can have an amino acid sequence corresponding to NP_002278.2, sequence provided below, or fragments thereof. See GenBank NP_002278.2 for reference to domains within LAIR1, for example, signal peptide, amino acids 1 to 21; extracellular domain, amino acids 22 to 165; transmembrane domain, amino acids 166 to 186; intracellular domain, amino acids 187 to 287. It is understood that a “LAIR1 nucleic acid molecule” refers to a polynucleotide encoding a LAIR1 polypeptide.

(146) TABLE-US-00022 (NP_002278.2; SEQ ID NO: 24) 1 MSPHPTALLG LVLCLAQTIH TQEEDLPRPS ISAEPGTVIP LGSHVTFVCR GPVGVQTFRL 61 ERDSRSTYND TEDVSQASPS ESEARFRIDS VREGNAGLYR CIYYKPPKWS EQSDYLELLV 121 KESSGGPDSP DTEPGSSAGP TQRPSDNSHN EHAPASQGLK AEHLYILIGV SVVFLFCLLL 181 LVLFCLHRQN QIKQGPPRSK DEEQKPQQRP DLAVDVLERT ADKATVNGLP EKDRETDTSA 241 LAAGSSQEVT YAQLDHWALT QRTARAVSPQ STKPMAESIT YAAVARH

(147) In one embodiment, the invention provides a LAIR1 DN form. In one embodiment, the LAIR1 DN form comprises the extracellular ligand binding domain of LAIR1. In one embodiment, the LAIR1 DN form comprises the extracellular ligand binding domain of LAIR1 and a transmembrane domain (e.g., mature form). In another embodiment, the LAIR1 DN form comprises the extracellular ligand binding domain of LAIR1, a transmembrane domain and a signal peptide (e.g., precursor form). The invention also provides encoding polypeptides and nucleic acids of the LAIR1 DN forms of the invention. In a particular embodiment, the LAIR1 extracellular ligand binding domain is fused to one or more heterologous polypeptide sequences, that is, the LAIR1 DN form is chimeric. For example, the LAIR1 extracellular ligand binding domain can be fused at its N-terminus to a signal peptide that is optionally a heterologous signal peptide, including various signal peptides described herein. In addition, a LAIR1 DN form can comprise a transmembrane domain that is optionally a heterologous transmembrane domain, including any of various transmembrane domains described herein.

(148) In an embodiment of the invention, the LAIR1 DN form can comprise the extracellular domain, or a ligand binding portion thereof, of LAIR1, for example, amino acids 22 to 165 corresponding to the extracellular domain of LAIR1 (GenBank NP_002278.2; SEQ ID NO:24). A cell expressing such a LAIR1 DN form should lack the ability or have reduced ability to signal in a LAIR1 immune checkpoint pathway. In one embodiment, a LAIR1 DN form is a deletion mutant having a deletion of the intracellular domain, for example, amino acids 187 to 287 of LAIR1 (GenBank NP_002278.2; SEQ ID NO:24), or a portion thereof, such that intracellular signaling of the immune checkpoint pathway mediated by LAIR1 is reduced or inhibited.

(149) 2B4.

(150) Natural Killer Cell Receptor 2B4 (2B4) mediates non-MHC restricted cell killing on NK cells and subsets of T cells. The 2B4-S isoform is believed to be an activating receptor, and the 2B4-L isoform is believed to be a negative immune regulator of immune cells. 2B4 becomes engaged upon binding its high-affinity ligand, CD48. 2B4 contains a tyrosine-based switch motif, a molecular switch that allows the protein to associate with various phosphatases. 2B4 has also been designated CD244 (cluster of differentiation 244).

(151) A 2B4 polypeptide can have an amino acid sequence corresponding to GenBank No. NP_001160135.1 (GI:262263435), sequence provided below, or fragments thereof. See GenBank NP_001160135.1 for reference to domains within 2B4, for example, signal peptide, amino acids 1 to 18; extracellular domain, amino acids 19 to 229; transmembrane domain, amino acids 230 to 250; intracellular domain, amino acids 251 to 370. It is understood that a “2B4 nucleic acid molecule” refers to a polynucleotide encoding a 2B4 polypeptide.

(152) TABLE-US-00023 (NP_001160135.1; SEQ ID NO: 25) 1 MLGQVVTLIL LLLLKVYQGK GCQGSADHVV SISGVPLQLQ PNSIQTKVDS IAWKKLLPSQ 61 NGFHHILKWE NGSLPSNTSN DRFSFIVKNL SLLIKAAQQQ DSGLYCLEVT SISGKVQTAT 121 FQVFVFESLL PDKVEKPRLQ GQGKILDRGR CQVALSCLVS RDGNVSYAWY RGSKLIQTAG 181 NLTYLDEEVD INGTHTYTCN VSNPVSWESH TLNLTQDCQN AHQEFRFWPF LVIIVILSAL 241 FLGTLACFCV WRRKRKEKQS ETSPKEFLTI YEDVKDLKTR RNHEQEQTFP GGGSTIYSMI 301 QSQSSAPTSQ EPAYTLYSLI QPSRKSGSRK RNHSPSFNST IYEVIGKSQP KAQNPARLSR 361 KELENFDVYS

(153) In one embodiment, the invention provides a 2B4 DN form. In one embodiment, the 2B4 DN form comprises the extracellular ligand binding domain of 2B4. In one embodiment, the 2B4 DN form comprises the extracellular ligand binding domain of 2B4 and a transmembrane domain (e.g., mature form). In another embodiment, the 2B4 DN form comprises the extracellular ligand binding domain of 2B4, a transmembrane domain and a signal peptide (e.g., precursor form). The invention also provides encoding polypeptides and nucleic acids of the 2B4 DN forms of the invention. In a particular embodiment, the 2B4 extracellular ligand binding domain is fused to one or more heterologous polypeptide sequences, that is, the 2B4 DN form is chimeric. For example, the 2B4 extracellular ligand binding domain can be fused at its N-terminus to a signal peptide that is optionally a heterologous signal peptide, including various signal peptides described herein. In addition, a 2B4 DN form can comprise a transmembrane domain that is optionally a heterologous transmembrane domain, including any of various transmembrane domains described herein.

(154) In an embodiment of the invention, the 2B4 DN form can comprise the extracellular domain, or a ligand binding portion thereof, of 2B4, for example, amino acids 19 to 229 corresponding to the extracellular domain of 2B4 (GenBank NP_001160135.1; SEQ ID NO:25). A cell expressing such a 2B4 DN form should lack the ability or have reduced ability to signal in a 2B4 immune checkpoint pathway. In one embodiment, a 2B4 DN form is a deletion mutant having a deletion of the intracellular domain, for example, amino acids 251 to 370 of 2B4 (GenBank NP_001160135.1; SEQ ID NO:25), or a portion thereof, such that intracellular signaling of the immune checkpoint pathway mediated by 2B4 is reduced or inhibited.

(155) CD160.

(156) CD160 is a glycosylphosphatidylinositol-anchored molecule containing a single IgV-like domain that binds to HVEM and functions as a co-inhibitory receptor on T cells. A CD160 polypeptide can have an amino acid sequence corresponding to GenBank NP_008984.1 (GI:5901910), sequence provided below, or fragments thereof. See GenBank NP_008984.1 for reference to domains within CD160, for example, signal peptide, amino acids 1 to 26; extracellular domain, amino acids 27 to 159. It is understood that a “CD160 nucleic acid molecule” refers to a polynucleotide encoding a CD160 polypeptide.

(157) TABLE-US-00024 (NP_008984.1; SEQ ID NO: 26) 1 MLLEPGRGCC ALAILLAIVD IQSGGCINIT SSASQEGTRL NLICTVWHKK EEAEGFVVFL 61 CKDRSGDCSP ETSLKQLRLK RDPGIDGVGE ISSQLMFTIS QVTPLHSGTY QCCARSQKSG 121 IRLQGHFFSI LFTETGNYTV TGLKQRQHLE FSHNEGTLSS GFLQEKVWVM LVTSLVALQA 181 L

(158) In one embodiment, the invention provides a CD160 DIN form. In one embodiment, the CD160 DN form comprises the extracellular ligand binding domain of CD160. In one embodiment, the CD160 DN form comprises the extracellular ligand binding domain of CD160 and a transmembrane domain (e.g., mature form). In another embodiment, the CD160 DN form comprises the extracellular ligand binding domain of CD160, a transmembrane domain and a signal peptide (e.g., precursor form). The invention also provides encoding polypeptides and nucleic acids of the CD160 DN forms of the invention. In a particular embodiment, the CD160 extracellular ligand binding domain is fused to one or more heterologous polypeptide sequences, that is, the CD160 DN form is chimeric. For example, the CD160 extracellular ligand binding domain can be fused at its N-terminus to a signal peptide that is optionally a heterologous signal peptide, including various signal peptides described herein. In addition, a CD160 DN form can comprise a transmembrane domain that is a heterologous transmembrane domain, including any of various transmembrane domains described herein.

(159) In an embodiment of the invention, the CD160 DN form can comprise the extracellular domain, or a ligand binding portion thereof, of CD160, for example, amino acids 27 to 159 corresponding to the extracellular domain of CD160 (GenBank NP_008984.1; SEQ ID NO:26). A cell expressing such a CD160 DN form should lack the ability or have reduced ability to signal in an immune checkpoint pathway. In one embodiment, the CD160 DN form comprises the extracellular domain of CD160, or a ligand binding portion thereof, and a transmembrane domain derived from a heterologous polypeptide, including but not limited to one of the transmembrane domains described herein. In one non-limiting embodiment, the CD160 DN form comprises the transmembrane domain of CD8. In a cell expressing the CD160 DN form, intracellular signaling of the immune checkpoint pathway mediated by CD160 should be reduced or inhibited.

(160) TGF-β Receptor Type 2.

(161) TGF-β receptor type 2 binds to TGF-β and a type I receptor dimer forming a heterotetrameric complex with the ligand. A TGF-β receptor type 2 polypeptide can have an amino acid sequence corresponding to GenBank No. NP_001020018.1 (GI:67782326), sequence provided below, or fragments thereof. See GenBank NP_001020018.1 for reference to domains within TGF-β receptor type 2, for example, signal peptide, amino acids 1 to 22; extracellular domain, amino acids 23 to 191; transmembrane domain, amino acids 192 to 212; intracellular domain, amino acids 213 to 592 (see also annotation in UniProtKB-P37173). It is understood that a “TGF-β receptor type 2 nucleic acid molecule” refers to a polynucleotide encoding a TGF-β receptor type 2 polypeptide.

(162) TABLE-US-00025 (NP_001020018.1, SEQ ID NO: 27) 1 MGRGLLRGLW PLHIVLWTRI ASTIPPHVQK SDVEMEAQKD EIICPSCNRT AHPLRHINND 61 MIVTDNNGAV KFPQLCKFCD VRFSTCDNQK SCMSNCSITS ICEKPQEVCV AVWRKNDENI 121 TLETVCHDPK LPYHDFILED AASPKCIMKE KKKPGETFFM CSCSSDECND NIIFSEEYNT 181 SNPDLLLVIF QVTGISLLPP LGVAISVIII FYCYRVNRQQ KLSSTWETGK TRKLMEFSEH 241 CAIILEDDRS DISSTCANNI NHNTELLPIE LDTLVGKGRF AEVYKAKLKQ NTSEQFETVA 301 VKIFPYEEYA SWKTEKDIFS DINLKHENIL QFLTAEERKT ELGKQYWLIT AFHAKGNLQE 361 YLTRHVISWE DLRKLGSSLA RGIAHLHSDH TPCGRPKMPI VHRDLKSSNI LVKNDLTCCL 421 CDFGLSLRLD PTLSVDDLAN SGQVGTARYM APEVLESRMN LENVESFKQT DVYSMALVLW 481 EMTSRCNAVG EVKDYEPPFG SKVREHPCVE SMKDNVLRDR GRPEIPSFWL NHQGIQMVCE 541 TLTECWDHDP EARLTAQCVA ERFSELEHLD RLSGRSCSEE KIPEDGSLNT TK

(163) In one embodiment, the invention provides a TGFβ receptor DN form. In one embodiment, the TGFβ receptor DN form comprises the extracellular ligand binding domain of TGFβ receptor. In one embodiment, the TGFβ receptor DN form comprises the extracellular ligand binding domain of TGFβ receptor and a transmembrane domain (e.g., mature form). In another embodiment, the TGFβ receptor DN form comprises the extracellular ligand binding domain of TGFβ receptor, a transmembrane domain and a signal peptide (e.g., precursor form). The invention also provides encoding polypeptides and nucleic acids of the TGF-β receptor DN forms of the invention. In a particular embodiment, the TGFβ receptor extracellular ligand binding domain is fused to one or more heterologous polypeptide sequences, that is, the TGFβ receptor DN form is chimeric. For example, the TGFβ receptor extracellular ligand binding domain can be fused at its N-terminus to a signal peptide that is optionally a heterologous signal peptide, including various signal peptides described herein. In addition, a TGFβ receptor DN form can comprise a transmembrane domain that is a heterologous transmembrane domain, including any of various transmembrane domains described herein.

(164) TGFβ receptor DN forms have been described previously (see, for example, Bottinger et al., EMBO J. 16:2621-2633 (1997), describing a DN form comprising TGFβ receptor extracellular and transmembrane domains; Foster et al., J. Immunother. 31:500-505 (2008); Bollard et al., Blood 99:3179-3187 (2002); Wieser et al., Mol. Cell. Biol. 13:7239-7247 (1993)). In an embodiment of the invention, the TGFβ receptor DN form can comprise the extracellular domain, or a ligand binding portion thereof, of TGFβ receptor, for example, amino acids 23 to 191 corresponding to the extracellular domain of TGFβ receptor (GenBank NP_001020018.1, SEQ ID NO:27). A cell expressing such a TGFβ receptor DN form lacks the ability or has reduced ability to signal in the cell. In one embodiment, a TGFβ receptor DN form is a deletion mutant having a deletion of the intracellular domain, for example, amino acids 213 to 592 of TGFβ receptor (GenBank NP_001020018.1, SEQ ID NO:27), or a portion thereof, such that intracellular signaling of mediated by TGFβ receptor is reduced or inhibited (see also Bottinger et al., EMBO J. 16:2621-2633 (1997); Foster et al., J. Immunother. 31:500-505 (2008); Bollard et al., Blood 99:3179-3187 (2002); Wieser et al., Mol. Cell. Biol. 13:7239-7247 (1993)).

(165) It is understood that, optionally, a second DN form of an inhibitor of a cell-mediated immune response, such as an immune checkpoint inhibitor, can be expressed in a cell of the invention. In this case, it can be desirable to inhibit more than one cell-mediated immune response in the same cell. Thus, a cell can express two or more DN forms, each directed to a different inhibitor of a cell-mediated immune response, including those described above. For example, a DN form of PD-1 can be co-expressed in a cell with a DN form of TGF-β receptor, a DN form of PD-1 can be co-expressed with a DN form of CTLA-4, a CTLA-4 DN form can be co-expressed with a DN form of TGF-β, and so forth, as desired, including combinations of any of the DN forms described above

(166) 6.4. Methods of Treatment

(167) The invention also relates to methods of treating disorders, such as an immune-mediated disorder, using the immunoinhibitory cells of the invention. The methods are used to treat a patient having an immune-mediated disorder. The methods of the invention relate to suppressing a pathologic immune response using the immunoinhibitory cells of the invention. Such pathologic immune responses include, but are not limited to, organ transplant rejection, autoimmune disorders, allergic disorders, fetomaternal intolerance, Alzheimer's disease, arthritis, and the like. It is understood that a pathologic immune response need not be the primary cause of a disorder, disease or condition. An immune-mediated disorder refers to a disorder, disease or condition associated with a pathologic immune response. Exemplary immune-mediated disorders include, but are not limited to, organ transplant rejection, autoimmune disorders, allergic disorders, fetomaternal intolerance, Alzheimer's disease, and the like, as discussed below in more detail.

(168) In one embodiment, the invention provides a method of treating an immune-mediated disorder in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of an immunoinhibitory cell or population of cells of the invention, or a pharmaceutical composition comprising such cell or cells. In a particular embodiment, the immune-mediated disorder is selected from the group consisting of organ transplant rejection, an autoimmune disorder, multiple sclerosis, type 1 diabetes, rheumatoid arthritis, primary biliary cirrhosis, myasthenia gravis, vitiligo, lupus, an allergic disorder, fetomaternal intolerance and Alzheimer's disease. In a particular embodiment, the immunoinhibitory cells are specific to (sensitized to, or recognize) an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder. In another particular embodiment, immunoinhibitory cells express a chimeric antigen receptor (CAR), wherein the CAR binds to an antigen that is the target of a pathologic immune response associated with an immune-mediated disorder.

(169) Organ Transplant Rejection.

(170) In response to a foreign organ transplant, the host immune system normally launches an immune attack against the transplanted organ, which may result in ultimate rejection of the organ. T-cell recognition of alloantigen is the central and primary event in organ transplant rejection, which ultimately leads to graft rejection (Briscoe et al., Nat. Med. 8:220-222 (2002)). To prevent solid organ rejection (liver, lung, kidney, pancreas, small bowel, etc), lifelong immunosuppressive agents are used as standard-of-care to suppress host effector immune responses against the transplanted organ. Antigen-specific responses that are causative of the organ rejection have been identified (see, for example, Table 1).

(171) Transduction of immunoinhibitory cells, such as regulatory T cells, with a dominant negative form (DN form) of an inhibitor of a cell-mediated immune response, for example, PD-1, can be used to promote immunosuppression within the transplanted organ and decrease organ transplant rejection. Furthermore, transplanted organ-specific antigen-responsive immunoinhibitory cells, such as regulatory T cells, can either be isolated as antigen-responsive cells, transduced with a DN form of an inhibitor of a cell-mediated immune response, and cultured ex vivo, or immunoinhibitory cells can be cotransduced with a DN form of an inhibitor of a cell-mediated immune response and a CAR that targets an antigen of the organ transplant to make the immunoinhibitory cells, such as regulatory T cells, antigen-specific. The transduced immunoinhibitory cells, such as regulatory T cells, can provide transplanted organ-specific immunosuppression, thereby enhancing the innate ability for immune tolerance in place of the conventional methods of immunosuppression.

(172) In one embodiment, the invention provides a method of decreasing the risk of organ transplant rejection in an organ transplant recipient in need thereof comprising administering to the recipient a therapeutically effective amount of an immunoinhibitory cell or cell population of the invention. In a particular embodiment, the immunoinhibitory cells express a CAR that binds to an antigen of the organ transplant associated with organ transplant rejection. In another particular embodiment, the immunoinhibitory cells used in the method are the product of a process comprising isolating regulatory T cells from the recipient, and expanding the isolated regulatory T cells in cell culture. Exemplary organ transplant target antigens are described in Table 1. In a particular embodiment, the immunoinhibitory cells are isolated from the transplanted organ or from the area surrounding the transplanted organ. For example, during liver transplantation, regulatory T cells, for example, from the transplanted liver, can be harvested, transduced with a dominant negative form of an inhibitor of an cell-mediated immune response, and administered to the patient, the organ recipient, to reduce or prevent rejection of the transplanted liver.

(173) In a particular embodiment, the transplanted organ is lung. In a particular embodiment where the transplanted organ is lung, the antigen which the cell recognizes and is sensitized to, or to which the CAR binds, is selected from the group consisting of MHC class I, MHC class II, collagen type V, K alpha1 tubulin, and MHC class I related chain A (MICA). In a particular embodiment, the transplanted organ is kidney. In a particular embodiment where the transplanted organ is kidney, the antigen which the cell recognizes and is sensitized to, or to which the CAR binds, is selected from the group consisting of MHC class I, MHC class II, fibronectin, collagen type IV, collagen type VI, vimentin, angiotensin II type 1 receptor (AGTR1), perlecan, and agrin.

(174) In a particular embodiment, the transplanted organ is liver. In a particular embodiment where the transplanted organ is liver, the antigen which the cell recognizes and is sensitized to, or to which the CAR binds, is selected from the group consisting of MHC class I, MHC class II, collagen type I, collagen type II, collagen type III, and collagen type V. In a particular embodiment, the transplanted organ is heart. In a particular embodiment where the transplanted organ is heart, the antigen which the cell recognizes and is sensitized to, or to which the CAR binds, is selected from the group consisting of MHC class I, MHC class II, cardiac myosin, vimentin, collagen type V, K alpha1 tubulin, and MHC class I related chain A (MICA). In a particular embodiment, the transplanted organ is pancreas. In a particular embodiment where the transplanted organ is pancreas, the antigen which the cell recognizes and is sensitized to, or to which the CAR binds, is selected from the group consisting of MHC class I, MHC class II, an islet cell autoantibody (ICA) antigen, insulin, and glutamic acid decarboxylase (GAD).

(175) Autoimmune Disorders.

(176) Transduction of DN forms of a cell-mediated immune response, such as PD-1, in an immunoinhibitory cell, such as a regulatory T cell, can be used to treat autoimmune disorders. In a specific embodiment, a DN form of an inhibitor of a cell-mediated immune response, such as PD-1, can be transduced into immunoinhibitory cells that are follicular regulatory T cells to promote their suppressive ability. Such cells can be used to suppress autoantibody production while leaving other arms of the immune system intact in patients with autoimmune disorders.

(177) In one embodiment, the invention provides a method of treating an autoimmune disorder in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of the immunoinhibitory cells of the invention. In a particular embodiment, the immunoinhibitory cells express a CAR that binds to an autoimmune antigen of the autoimmune disorder. In another particular embodiment, the immunoinhibitory cells are the product of a process comprising isolating regulatory T cells from the patient, and expanding the isolated regulatory T cells in cell culture. In a particular embodiment, the autoimmune disorder is selected from the group consisting of multiple sclerosis, type 1 diabetes, rheumatoid arthritis, primary biliary cirrhosis, myasthenia gravis, vitiligo, and lupus, for example, systemic lupus erythematosus.

(178) In one embodiment, the invention provides a method of promoting self-tolerance or reestablishing immunological tolerance to a self-antigen in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of the immunoinhibitory cells of the invention, wherein the cell is a pathologic self-antigen specific regulatory T cell, or the cell population comprises pathologic self-antigen specific regulatory T cells. Such a method can be used to alleviate the pathological effects of an autoimmune disorder.

(179) Multiple Sclerosis.

(180) In one embodiment, the invention provides a method of treating an immune-mediated disorder that is multiple sclerosis in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of an immunoinhibitory cell or population of cells of the invention, or a pharmaceutical composition comprising such cell or cells. In a particular embodiment, the immunoinhibitory cells are the product of a process comprising isolating regulatory T cells from the patient, and expanding the isolated regulatory T cells in cell culture. In another particular embodiment, the immunoinhibitory cells express a CAR that binds to an autoimmune antigen of the autoimmune disorder. In yet another particular embodiment, the antigen which the immunoinhibitory cell recognizes and is sensitized to, or to which the CAR binds to, is selected from the group consisting of myelin, myelin basic protein, myelin oligodendrocyte glycoprotein, proteolipid protein, astrocyte proteins, glial fibrillary protein (GFAP), and S100beta.

(181) Type 1 Diabetes.

(182) In one embodiment, the invention provides a method of treating an immune-mediated disorder that is type 1 diabetes in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of an immunoinhibitory cell or population of cells of the invention, or a pharmaceutical composition comprising such cell or cells. In a particular embodiment, the immunoinhibitory cells are the product of a process comprising isolating regulatory T cells from the patient, and expanding the isolated regulatory T cells in cell culture. In another particular embodiment, the immunoinhibitory cells express a CAR that binds to an autoimmune antigen of the autoimmune disorder. In yet another particular embodiment, the antigen which the immunoinhibitory cell recognizes and is sensitized to, or to which the CAR binds to, is selected from the group consisting of a beta cell antigen, insulin, insulin B chain, proinsulin, preproinsulin, glutamic acid decarboxylase-65 (GAD65), islet-associated antigen 2, islet-specific glucose-6-phosphatase catalytic subunit-related protein (IGRP), zinc transporter 8 (ZnT8), islet antigen 2 (IA-2), heat shock protein 60 (HSP60), and chromogranin A.

(183) Rheumatoid Arthritis.

(184) In one embodiment, the invention provides a method of treating an immune-mediated disorder that is rheumatoid arthritis in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of an immunoinhibitory cell or population of cells of the invention, or a pharmaceutical composition comprising such cell or cells. In a particular embodiment, the immunoinhibitory cells are the product of a process comprising isolating regulatory T cells from the patient, and expanding the isolated regulatory T cells in cell culture. In another particular embodiment, the immunoinhibitory cells express a CAR that binds to an autoimmune antigen of the autoimmune disorder. In yet another particular embodiment, the antigen which the immunoinhibitory cell recognizes and is sensitized to, or to which the CAR binds to, is selected from the group consisting of a dnaJ (heat shock protein), citrullinated-vimentin, and human cartilage glycoprotein-39.

(185) Primary Biliary Cirrhosis.

(186) In one embodiment, the invention provides a method of treating an immune-mediated disorder that is primary biliary cirrhosis in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of an immunoinhibitory cell or population of cells of the invention, or a pharmaceutical composition comprising such cell or cells. In a particular embodiment, the immunoinhibitory cells are the product of a process comprising isolating regulatory T cells from the patient, and expanding the isolated regulatory T cells in cell culture. In another particular embodiment, the immunoinhibitory cells express a CAR that binds to an autoimmune antigen of the autoimmune disorder. In yet another particular embodiment, the antigen which the immunoinhibitory cell recognizes and is sensitized to, or to which the CAR binds to, is selected from the group consisting of a mitochondrial component, pyruvate dehydrogenase (mitochondrial); E2 component of pyruvate dehydrogenase; E2 component of branched chain 2-oxo acid dehydrogenase; E2 component of 2-oxo-glutarate dehydrogenase complex; E3 binding protein of dihydrolipoamide dehydrogenase; a nuclear component; nuclear protein sp100, nuclear pore complex protein gp120, and centromere.

(187) Myasthenia Gravis.

(188) In one embodiment, the invention provides a method of treating an immune-mediated disorder that is myasthenia gravis in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of an immunoinhibitory cell or population of cells of the invention, or a pharmaceutical composition comprising such cell or cells. In a particular embodiment, the immunoinhibitory cells are the product of a process comprising isolating regulatory T cells from the patient, and expanding the isolated regulatory T cells in cell culture. In another particular embodiment, the immunoinhibitory cells express a CAR that binds to an autoimmune antigen of the autoimmune disorder. In yet another particular embodiment, the antigen which the immunoinhibitory cell recognizes and is sensitized to, or to which the CAR binds to, is selected from the group consisting of acetylcholine receptor (AChR), aquaporin-4 (AQP-4), CTLA-4, ICAM, LFA-3, CD40/CD154, ICOS/ICOSL, CD52, nuclear factor of activated T cells (NFAT), phospholipase C (PLC), CD25, Janus kinase, B cell activating factor (BAFF), a proliferating inducing ligand (APRIL), IL6R, IL17, IL12/IL23, an integrin, and a sphingosin receptor. Regulatory T cells naturally accumulate in the thymus. In a particular embodiment, the immunoinhibitory cells, such as regulatory T cells, accumulate in the thymus and can facilitate treatment of myasthenia gravis.

(189) Vitiligo.

(190) In one embodiment, the invention provides a method of treating an immune-mediated disorder that is vitiligo in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of an immunoinhibitory cell or population of cells of the invention, or a pharmaceutical composition comprising such cell or cells. In a particular embodiment, the immunoinhibitory cells are the product of a process comprising isolating regulatory T cells from the patient, and expanding the isolated regulatory T cells in cell culture. In another particular embodiment, the immunoinhibitory cells express a CAR that binds to an autoimmune antigen of the autoimmune disorder. In yet another particular embodiment, the antigen which the immunoinhibitory cell recognizes and is sensitized to, or to which the CAR binds to, is a melanocyte antigen.

(191) Systemic Lupus Erythematosus.

(192) In one embodiment, the invention provides a method of treating an immune-mediated disorder that is lupus, in particular, systemic lupus erythematosus, in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of an immunoinhibitory cell or population of cells of the invention, or a pharmaceutical composition comprising such cells. In a particular embodiment, the immunoinhibitory cells are the product of a process comprising isolating regulatory T cells from the patient, and expanding the isolated regulatory T cells in cell culture. In another particular embodiment, the immunoinhibitory cells express a CAR that binds to an autoimmune antigen of the autoimmune disorder. In yet another particular embodiment, the antigen which the immunoinhibitory cell recognizes and is sensitized to, or to which the CAR binds to, is selected from the group consisting of a toll-like receptor, TLR2, TLR3, TLR4, TLR5, TLR7, TLR8, TLR9, MyD88, and a IL-1R-associated kinase (IRAK).

(193) Allergic Disorders.

(194) In one embodiment, the invention provides a method of treating an allergic disorder in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of an immunoinhibitory cell or population of such cells. In a particular embodiment, the immunoinhibitory cells are the product of a process comprising isolating regulatory T cells from the patient, and expanding the isolated regulatory T cells in cell culture. In another particular embodiment, the immunoinhibitory cells express a CAR that binds to an allergen associated with the allergic disorder. In yet another particular embodiment, the antigen to which the immunoinhibitory cell recognizes and is sensitized to, or to which the CAR binds to, is an allergen associated with the allergic disorder.

(195) In a specific embodiment, in patients undergoing specific immunotherapy (SIT), along with the subcutaneous injection of the small but increasing doses of allergen peptide(s), immunoinhibitory cells that recognize and are sensitized to an antigen that is the allergen, or which express a CAR that binds to the allergen, can be coinjected with the allergen peptide(s). In a specific embodiment, this can result in the effect in the patient of decreasing the duration of specific immunotherapy, increasing the efficacy of specific immunotherapy, and/or prolonging the effect of specific immunotherapy, for example, using an allergen as the specific antigen, providing clinical improvement that can be prolonged for years. For example, the patient can be undergoing SIT for wasp-venom or a monoagent allergy (e.g., house dust mite). In a particular embodiment, administering the immunoinhibitory cells of the invention has an effect in the patient selected from the group consisting of decreasing the duration of SIT, increasing the efficacy of SIT, and/or prolonging the effect of SIT. Thus, the methods of the invention utilizing the immunoinhibitory cells of the invention can be used to improve the effectiveness of specific immunotherapy (SIT) with an allergen.

(196) Fetomaternal Intolerance.

(197) Regulatory T cells specific to (sensitized to) paternal antigen can be harvested from placenta in a lost pregnancy. These regulatory T cells specific to paternal antigen are transduced with a DN form of an inhibitor of a cell-mediated immune response, such as PD-1, cultured, and reinfused at a subsequent pregnancy, resulting in an increase in fetal implantation and a decrease in fetal loss.

(198) In one embodiment, the invention provides a method of decreasing fetomaternal intolerance in a pregnant female in need thereof, comprising administering to the pregnant female a therapeutically effective amount of an immunoinhibitory cell or cell population, which cell or cell population is the product of a process comprising isolating regulatory T cells from a placenta from a prior pregnancy of the pregnant female and transducing the regulatory T cells so that they recombinantly express a dominant negative form of an inhibitor of a regulatory T cell-mediated immune response. In a particular embodiment, the regulatory T cell is isolated from a placenta of the pregnant female being treated for fetomaternal intolerance. In a further embodiment, the isolated regulatory T cell is paternal-antigen specific. The method can be used to increase the likelihood of fetal implantation and to decrease the likelihood of fetal loss.

(199) Alzheimer's Disease.

(200) The observation that PD-1 negative regulatory T cells are increased in mild cognitive impairment patients reinforces the inflammatory origin of Alzheimer's disease and supports a beneficial role of PD-1 negative regulatory T cells in mild cognitive impairment that is lost in patients with full-blown Alzheimer's disease.

(201) In a specific embodiment, regulatory T cells are harvested from patients with mild cognitive impairment, and the cells transduced with a DN form of an inhibitor of a cell mediated immune response, such as PD-1. The cells are reinfused into the patient to prevent or slow the progression to Alzheimer's disease.

(202) The criteria for diagnosing mild cognitive impairment have been described (Saresella et al., J. Alzheimer's Disease 21:927-938 (2010); Petersen, J. Int. Med. 256:183-194 (2004); Winblad et al., J. Int. Med. 256:240-246 (2004)). Exemplary criteria include reported cognitive decline, impaired cognitive function, essentially normal functional activities, and exclusion of dementia.

(203) In one embodiment, the invention provides a method of decreasing the risk of progression to Alzheimer's disease in a patient with mild cognitive impairment, comprising administering to the patient a therapeutically effective amount of the immunoinhibitory cells or cell or cell population of the invention, wherein the immunoinhibitory cells are the product of a process comprising isolating regulatory T cells from the patient and expanding the isolated regulatory T cells in cell culture. In a particular embodiment, the regulatory T cells are isolated from a patient having mild cognitive impairment.

(204) Arthritis.

(205) Currently, in patients with arthritis and severe pain, steroid injections are administered locally, which alleviates the inflammatory response and relieves pain. Unlike steroids, which kill inflammatory cells, regulatory T cells counteract inflammation by suppression and PD-1 DNR increases suppression. In one embodiment, the invention provides a method of treating arthritis in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of the immunoinhibitory cells of the invention. In a specific embodiment, the cells are administered regionally into the arthritic joints, for example, intraarticularly or directly at a tendon insertion site of an arthritic joint. In a specific embodiment, the arthritis being treated is osteoarthritis. In another specific embodiment, the arthritis being treated is psoriatic arthritis, which can be but is not limited to asymmetric inflammatory arthritis, symmetric arthritis and psoriatic spondylitis. In one embodiment, non-antigen specific regulatory T cells, or regulatory T cells not selected for a particular antigen specificity, are administered.

(206) Dosages and Administration.

(207) In the methods of the invention, the immunoinhibitory cells of the invention are administered to a subject or patient in need of treatment. The subject or patient can be a mammal, in particular a human. Preferably, the subject or patient is a human. The human can be a child or an adult.

(208) For treatment, the amount administered is an amount effective for producing the desired effect. An effective amount or therapeutically effective amount is an amount sufficient to provide a beneficial or desired clinical result upon treatment. An effective amount can be provided in a single administration or a series of administrations (one or more doses). An effective amount can be provided in a bolus or by continuous perfusion. In terms of treatment, an effective amount is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of the disease, or otherwise reduce the pathological consequences of the disease. The effective amount can be determined by the physician for a particular subject. Several factors are typically taken into account when determining an appropriate dosage to achieve an effective amount. These factors include age, sex and weight of the subject, the condition being treated, the severity of the condition and the form and effective concentration of the cells of the invention being administered.

(209) The cells of the invention are generally administered as a dose based on cells per kilogram (cells/kg) of body weight of the subject to which the cells are administered. Generally the cell doses are in the range of about 10.sup.4 to about 10.sup.10 cells/kg of body weight, for example, about 10.sup.5 to about 10.sup.9, about 10.sup.5 to about 10.sup.8, about 10.sup.5 to about 10.sup.7, or about 10.sup.5 to 10.sup.6 cells/kg, depending on the mode and location of administration. In general, in the case of systemic administration, a higher dose is used than in regional administration, where the immunoinhibitory cells of the invention are administered in the region of pathologic immune response. Exemplary dose ranges include, but are not limited to, 1×10.sup.4 to 1×10.sup.8, 2×10.sup.4 to 1×10.sup.8, 3×10.sup.4 to 1×10.sup.8, 4×10.sup.4 to 1×10.sup.8, 5×10.sup.4 to 1×10.sup.8, 6×10.sup.4, to 1×10.sup.8, 7×10.sup.4 to 1×10.sup.8, 8×10.sup.4 to 1×10.sup.8, 9×10.sup.4 to 1×10.sup.8, 1×10.sup.5 to 1×10.sup.8, for example, 1×10.sup.5 to 9×10.sup.7, 1×10.sup.5 to 8×10.sup.7, 1×10.sup.5 to 7×10.sup.7, 1×10.sup.5 to 6×10.sup.7, 1×10.sup.5 to 5×10.sup.7, 1×10.sup.5 to 4×10.sup.7, 1×10.sup.5 to 3×10.sup.7, 1×10.sup.5 to 2×10.sup.7, 1×10.sup.5 to 1×10.sup.7, 1×10.sup.5 to 9×10.sup.6, 1×10.sup.5 to 8×10.sup.6, 1×10.sup.5 to 7×10.sup.6, 1×10.sup.5 to 6×10.sup.6, 1×10.sup.5 to 5×10.sup.6, 1×10.sup.5 to 4×10.sup.6, 1×10.sup.5 to 3×10.sup.6, 1×10.sup.5 to 2×10.sup.6, 1×10.sup.5 to 1×10.sup.6, 2×10.sup.5 to 9×10.sup.7, 2×10.sup.5 to 8×10.sup.7, 2×10.sup.5 to 7×10.sup.7, 2×10.sup.5 to 6×10.sup.7, 2×10.sup.5 to 5×10.sup.7, 2×10.sup.5 to 4×10.sup.7, 2×10.sup.5 to 3×10.sup.7, 2×10.sup.5 to 2×10.sup.7, 2×10.sup.5 to 1×10.sup.7, 2×10.sup.5 to 9×10.sup.6, 2×10.sup.5 to 8×10.sup.6, 2×10.sup.5 to 7×10.sup.6, 2×10.sup.5 to 6×10.sup.6, 2×10.sup.5 to 5×10.sup.6, 2×10.sup.5 to 4×10.sup.6, 3×10.sup.5 to 3×10.sup.6 cells/kg, and the like. Such dose ranges can be particularly useful for regional administration. In a particular embodiment, cells are provided in a dose of 1×10.sup.5 to 1×10.sup.8, for example 1×10.sup.5 to 1×10.sup.7, 1×10.sup.5 to 1×10.sup.6, 1×10.sup.6 to 1×10.sup.8, 1×10.sup.6 to 1×10.sup.7, 1×10.sup.7 to 1×10.sup.8, 1×10.sup.5 to 5×10.sup.6, 1×10.sup.5 to 3×10.sup.6 or 3×10.sup.5 to 3×10.sup.6 cells/kg for regional administration. Exemplary dose ranges also can include, but are not limited to, 5×10.sup.5 to 1×10.sup.8, for example, 6×10.sup.5 to 1×10.sup.8, 7×10.sup.5 to 1×10.sup.8 8×10.sup.5 to 1×10.sup.8 9×10.sup.5 to 1×10.sup.8 1×10.sup.6 to 1×10.sup.8 1×10.sup.6 to 9×10.sup.7 1×10.sup.6 to 8×10.sup.7 1×10.sup.6 to 7×10.sup.7, 1×10.sup.6 to 6×10.sup.7, 1×10.sup.6 to 5×10.sup.7, 1×10.sup.6 to 4×10.sup.7, 1×10.sup.6 to 3×10.sup.7 cells/kg, and the like. Such does can be particularly useful for systemic administration. In a particular embodiment, cells are provided in a dose of 1×10.sup.6 to 3×10.sup.7 cells/kg for systemic administration. Exemplary cell doses include, but are not limited to, a dose of 1×10.sup.4, 2×10.sup.4, 3×10.sup.4, 4×10.sup.4, 5×10.sup.4, 6×10.sup.4, 7×10.sup.4, 8×10.sup.4, 9×10.sup.4, 1×10.sup.5, 2×10.sup.5, 3×10.sup.5, 4×10.sup.5, 5×10.sup.5, 6×10.sup.5, 7×10.sup.5, 8×10.sup.5, 9×10, 1×10.sup.6, 2×10.sup.6, 3×10.sup.6, 4×10.sup.6, 5×10.sup.6, 6×10.sup.6, 7×10.sup.6, 8×10.sup.6, 9×10.sup.7, 1×10.sup.7, 2×10.sup.7, 3×10.sup.7, 4×10.sup.7, 5×10.sup.7, 6×10.sup.7, 7×10.sup.7, 8×10.sup.7, 9×10.sup.7, 1×10.sup.8, 2×10.sup.8, 3×10.sup.8, 4×10.sup.8, 5×10.sup.8, 6×10.sup.8, 7×10.sup.8, 8×10.sup.8, 9×10.sup.8, 1×10.sup.9 and so forth in the range of about 10.sup.4 to about 10.sup.10 cells/kg. In addition, the dose can also be adjusted to account for whether a single dose is being administered or whether multiple doses are being administered. The precise determination of what would be considered an effective dose can be based on factors individual to each subject, including their size, age, sex, weight, and condition of the particular subject, as described above. Dosages can be readily determined by those skilled in the art based on the disclosure herein and knowledge in the art.

(210) In a specific embodiment, the dosage for human administration is in the range of 1×10.sup.5 to 1×10.sup.8 cells/kg body weight of the human.

(211) The cells of the invention can be administered by any methods known in the art, including, but not limited to, pleural administration, intravenous administration, subcutaneous administration, intranodal administration, intrathecal administration, intrapleural administration, intraperitoneal administration, intracranial administration, intratracheal administration, intraarticular administration, intrauterine administration, intraocular administration, intranasal administration, intraspinal administration, epidural administration, direct administration at a tendon insertion site, and direct administration to the thymus. In one embodiment, the cells of the invention can be delivered regionally to desired site using well known methods, including but not limited to, hepatic or aortic pump; limb, lung or liver perfusion; in the portal vein; through a venous shunt; in a cavity or in a vein that is nearby a desired site, and the like, such that the cells of the invention are delivered to a region such as the site of an organ transplant or the site of a pathologic immune response in an immune-mediated disorder. For example, in the case of a condition such as arthritis, the cells of the invention can be administered in the joint using intraarticular administration of direct administration at a tendon insertion site. In another embodiment, the cells of the invention can be administered systemically. In a preferred embodiment, the cells are administered regionally at a desired site. One skilled in the art can select a suitable mode of administration based on the type of immune-mediated disorder to be treated. The cells can be introduced by injection or catheter. In one embodiment, the cells are administered by intravenous infusion. Optionally, expansion and/or differentiation agents can be administered to the subject prior to, during or after administration of cells to increase production of the cells of the invention in vivo.

(212) Proliferation of the cells of the invention is generally done ex vivo, prior to administration to a subject, and can be desirable in vivo after administration to a subject (see Kaiser et al., Cancer Gene Therapy 22:72-78 (2015)). Cell proliferation should be accompanied by cell survival to permit cell expansion and persistence. Cell isolation and/or expansion can be carried out using any method known in the art, e.g., as described in Lee et al., Cancer Res. 71:2871-2881 (2011).

(213) The methods of the invention can further comprise adjuvant therapy in combination with, either prior to, during, or after treatment with the cells of the invention. Thus, the cell therapy methods of the invention can be used with other standard care and/or therapies for treating a particular disorder that are compatible with administration of the cells of the invention.

(214) Optionally, the methods of administering cells of the invention can additionally include combination therapy that comprises immunomodulation of the host to facilitate the effectiveness of the administered cells of the invention. In an embodiment of the invention, the methods of the invention can further comprise administering at least one immunomodulatory agent. Non-limiting examples of immunomodulatory agents include immunoinhibitory agents.

(215) In one embodiment, the immunoinhibitory cells of the invention expressing a DN form can be co-administered with immunoinhibitory cells co-expressing a CAR and a switch receptor. In such immunoinhibitory cells co-expressing a CAR and a switch receptor that are to be co-administered with immunoinhibitory cells expressing a DN form that does not contain a co-stimulatory domain (i.e., is not a switch receptor), the CAR binds to an antigen of the same disease or disorder as being treated. In another embodiment, the switch receptor can be transduced into the same cell in which a CAR and DN form are transduced, so that the cell recombinantly expresses all three constructs. Alternatively and preferably, the switch receptor is transduced into a cell in which the CAR, but not DN form is transduced, so as to produce a cell expressing both the switch receptor and CAR, which can be used in combination therapy with cells that express the DN form, or both the CAR and DN form, but not the switch receptor. In this case, two types of cells, either cells expressing a DN form and cells expressing a CAR and a switch receptor, or cells expressing a CAR and DN form and cells expressing a CAR and a switch receptor, are administered to the subject. Generally, the two types of cells are administered concurrently, but can also be administered sequentially, for example, within 1 or 2 hours, or within 1 or 2 days, or on the same day, as each other, as desired. In a particular embodiment, the co-stimulatory signaling domain of the CAR is different than the co-stimulatory signaling domain of the switch receptor being expressed in the same cell. This should result in two co-stimulatory signaling domains in the same cell and enhanced efficacy of the cells for immune cell therapy. In the case where it is believed that the administered immunoinhibitory cells will proliferate sufficiently in the subject being treated such that additional doses of cells need not be administered, it may be suitable to administer the immunoinhibitory cells of the invention at the initiation of immune cell therapy. Optionally, the immunoinhibitory cells of the invention, including optionally immunoinhibitory cells that express a switch receptor, can be administered more than once, as needed.

(216) Administering an immunomodulatory agent, or cells expressing a CAR and a switch receptor, in a combination therapy with an immunoinhibitory cell of the invention expressing a DN form can occur concurrently with administration of the immunoinhibitory cells of the invention, for example, when immune cell therapy is initiated, or can occur sequentially at any time during the immune cell therapy, as desired. A person skilled in the art can readily determine appropriate regimens for administering cells of the invention and an immunomodulatory agent, or cells expressing a CAR and a switch receptor, in a combination therapy, including the timing and dosing of an immunomodulatory agent to be used in a combination therapy, based on the needs of the subject being treated.

(217) 6.5. Pharmaceutical Compositions

(218) The invention additionally provides pharmaceutical compositions comprising the cells of the invention. The pharmaceutical composition comprises an effective amount of a cell of the invention and a pharmaceutically acceptable carrier. The cells of the invention and compositions comprising the cells can be conveniently provided in sterile liquid preparations, for example, typically isotonic aqueous solutions with cell suspensions, or optionally as emulsions, dispersions, or the like, which are typically buffered to a selected pH. The compositions can comprise carriers, for example, water, saline, phosphate buffered saline, and the like, suitable for the integrity and viability of the cells, and for administration of a cell composition.

(219) Sterile injectable solutions can be prepared by incorporating cells of the invention in a suitable amount of the appropriate solvent with various amounts of the other ingredients, as desired. Such compositions can include a pharmaceutically acceptable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like, that are suitable for use with a cell composition and for administration to a subject such as a human. Suitable buffers for providing a cell composition are well known in the art. Any vehicle, diluent, or additive used is compatible with preserving the integrity and viability of the cells of the invention.

(220) The compositions will generally be isotonic, that is, they have the same osmotic pressure as blood and lacrimal fluid. The desired isotonicity of the cell compositions of the invention can be accomplished using sodium chloride, or other pharmaceutically acceptable agents such as dextrose, boric acid, sodium tartrate, or other inorganic or organic solutes. Sodium chloride is preferred particularly for buffers containing sodium ions. One particularly useful buffer is saline, for example, normal saline. Those skilled in the art will recognize that the components of the compositions should be selected to be chemically inert and will not affect the viability or efficacy of the cells of the invention and will be compatible for administration to a subject, such as a human. The skilled artisan can readily determine the amount of cells and optional additives, vehicles, and/or carrier in compositions to be administered in methods of the invention.

(221) The cells of the invention can be administered in any physiologically acceptable vehicle. Suitable doses for administration are described herein. A cell population comprising cells of the invention can comprise a purified population of cells. Those skilled in the art can readily determine the percentage of cells in a cell population using various well-known methods, as described herein. The ranges of purity in cell populations comprising genetically modified cells of the invention can be from about 50% to about 55%, from about 55% to about 60%, from about 65% to about 70%, from about 70% to about 75%, from about 75% to about 80%, from about 80% to about 85%; from about 85% to about 90%, from about 90% to about 95%, or from about 95 to about 100%. Dosages can be readily adjusted by those skilled in the art; for example, a decrease in purity may require an increase in dosage.

(222) The invention also provides kits for preparation of cells of the invention. In one embodiment, the kit comprises one or more vectors for generating a genetically engineered immunoinhibitory cell, such as a regulatory T cell, that expresses a DN form or co-expresses a CAR and DN form of an inhibitor of a cell-mediated immune response. The kits can be used to generate genetically engineered immunoinhibitory cells from autologous cells derived from a subject or from non-autologous cells to be administered to a compatible subject. In another embodiment, the kits can comprise cells of the invention, for example, autologous or non-autologous cells, for administration to a subject. In specific embodiments, the kits comprise the immunoinhibitory cells of the invention in one or more containers.

(223) It is understood that modifications which do not substantially affect the activity of the various embodiments of this invention are also provided within the definition of the invention provided herein. Accordingly, the following example is intended to illustrate but not limit the present invention.

7. EXAMPLE

(224) This example describes the construction and use of T cells expressing CARs and a dominant negative PD-1 mutant. Although this example relates to the use of CD4.sup.+ T cells and CD8.sup.+ T cells that are not regulatory T cells to enhance the immune response, instead of regulatory T cells to provide immunosuppression, it describes methodology that can be applied in the instant invention. Furthermore, the results described below, although with CD4.sup.+ T cells and CD8.sup.+ T cells, show that a dominant negative form of PD-1 can function as a dominant negative and can sustain the activity of a T cell expressing the dominant negative form of PD-1.

(225) 7.1. Methods and Procedures

(226) The experimental procedures were approved by the Institutional Animal Care and Use Committee of Memorial Sloan Kettering Cancer Center (MSKCC). Each experiment was performed multiple times, using different donor T cells. To avoid confounding variables—such as differences due to transduction efficiencies, donor-related variability, and E:T ratios—data are presented using a representative experiment, with sample replicates of more than 3.

(227) Cell Lines.

(228) MSTO-211H human pleural mesothelioma cells (ATCC, Manassas, Va.) were retrovirally transduced to express GFP and firefly luciferase fusion protein (MSTO GFP-ffLuc.sup.+). These cells were then transduced with the human MSLN variant 1 subcloned into an SFG retroviral vector to generate MSTO MSLN.sup.+ GFP-ffLuc.sup.+ Similarly, A549 cells and 3T3 murine fibroblasts were transduced with human MSLN variant 1 alone to generate A549 MSLN+ and 3T3 MSLN+ cell lines. 3T3 cells were also cotransduced with PD-L1 to generate 3T3 MSLN+ PDL1+ cells.

(229) γ-Retroviral Vector Construction and Viral Production.

(230) To generate MSLN-specific CARs, a cDNA encoding for a fully human scFv m912 specific for MSLN (provided by D. Dimitrov, National Cancer Institute at Frederick) (Feng et al., Mol. Cancer Ther. 8(5):1113-1118 (2009)), linked to the human CD8 leader domain and the CD8/CD3ζ, CD28/CD3ζ, or CD8/4-1BB/CD3ζ domain was engineered, as previously described (Zhong et al., Mol. Ther. 18(2):413-420 (2010)). The control PSMA-specific CAR was generated similarly, using a previously characterized PSMA-targeting scFv (Gade et al., Cancer Res. 65(19):9080-9088 (2005)). For construction of the PD-1 DNR, commercial gene synthesis was used to encode the extracellular portion of the PD-1 receptor (amino acids 1-151) fused to the CD8 transmembrane and hinge domains. The CAR sequence was inserted into the SFG γ-retroviral vector (provided by I. Riviere, MSKCC) and linked to a P2A sequence to induce coexpression of the LNGFR reporter (truncated low-affinity nerve growth factor receptor) or, in the case of the PD-1 DNR, the mCherry fluorescent protein reporter (Markley et al., Blood 115(17):3508-3519 (2010); Papapetrou et al., Proc. Natl. Acad. Sci. USA 106(31):12759-12764 (2009)). The CAR and PD-1 DNR encoding plasmids were then transfected into 293T H29 packaging cell lines to produce the retrovirus, as previously described (Hollyman et al., J. Immunother. 32(2):169-180 (2009)).

(231) T-Cell Isolation, Gene Transfer, and CD4/CD8 Isolation.

(232) Peripheral blood leukocytes were isolated from the blood of healthy volunteer donors under an institutional review board—approved protocol. Peripheral blood mononuclear cells (PBMCs) were isolated by low-density centrifugation on Lymphoprep (Stem Cell Technology, Vancouver, Canada) and activated with phytohemagglutinin (2 μg/mL, Remel, Lenexa, Kans.). Two days after isolation, PBMCs were transduced with 293T RD114-produced retroviral particles encoding for CARs and PD-1 DNR and spinoculated for 1 h at 3000 rpm on plates coated with retronectin (15 μg/mL; r-Fibronectin, Takara, Tokyo, Japan). After 1 day, transduced PBMCs were maintained in IL-2 (20 UI/mL; Novartis, Basel, Switzerland). Transduction efficiencies were determined by flow cytometric analysis. Pure populations of CD4+ and CD8+ CAR+ T cells, or mCherry-positive PD-1 DNR-expressing and mCherry-positive EV-expressing CAR+ T cells, were obtained by flow cytometric-based sorting (BD Aria Sorter; BD Biosciences, San Jose, Calif.).

(233) Flow Cytometry.

(234) Human MSLN expression was detected using a phycoerythrin- or allophycocyanin-conjugated anti-human MSLN rat IgG2a (R&D Systems, Minneapolis, Minn.). Expression of costimulation or inhibitory proteins on tumor cells was analyzed using the following antibodies: 4-1BBL (PE, clone 5F4; BioLegend, San Diego, Calif.), MHC HLA-DR (PE, clone L203; R&D Systems), PD-L1 (APC, clone MIH1; eBioscience, San Diego, Calif.), PD-L2 (APC, clone MIH18; eBioscience), and galectin-9 (APC, clone 9M13; BioLegend). T-cell phenotype and transduction efficiency were determined with monoclonal antibodies for CD3, CD4, CD8, and CD69m LNGFR. Expression of T-cell inhibitory receptors was analyzed using PD1 (APC, eBioJIU5; eBioscience), TIM-3 (PE, clone 344823; R&D Systems), and Lag-3 (PE, clone C9B7W; BioLegend). Cell staining was analyzed using a BD LSRII flow cytometer (BD, Franklin Lakes, N.J.) and FlowJo analysis software (FlowJo, Ashland, Oreg.).

(235) T-Cell Functional Assays.

(236) The cytotoxicity of T cells transduced with a CAR or vector control was determined by standard .sup.51Cr-release assays, as previously described (McCoy et al., National Cancer Institute Monograph 37:59-67 (1973)). To perform the luciferase-activity assay, CAR+ T cells and MSTO-211H cells expressing MSLN and firefly luciferase were incubated for 18 h at different E:T ratios. Tumor-cell quantity was determined by BLI using IVIS 100/lumina II, after the addition of 100 μL of D-luciferin (15 mg/mL) per well, and was compared to the signal emitted by the tumor cells alone. CD107a and intracellular staining were performed after incubation of effector cells and irradiated MSTO-211H MSLN tumor cells for 18 h in 24-well plates at a ratio of 5:1. For the CD107a assay, 5 μL of CD107a-PeCy7 antibody (BD Biosciences, San Jose, Calif.) and Golgi STOP (4 μL/6 mL; BD Biosciences) were added at the time of stimulation. For intracellular staining, Golgi Plug (1 μL/1 mL; BD Biosciences) was added at the time of stimulation. After incubation, effector cells were stained for CD4, CD8, LNGFR, and CD3 marker, then fixed and permeabilized in accordance with the manufacturer's instructions (Cytofix/Cytoperm Kit; BD Biosciences). Staining for intracellular cytokines was performed using granzyme B-APC, perforin-PE, and IFN-γ-FITC antibodies (BD Biosciences).

(237) Cytokine-release assays were performed by coculturing 3×10.sup.4 to 5×10.sup.3 T cells with target cells in a 1:1 to 5:1 ratio, in 200 μL of medium, in 96-well round-bottomed plates as triplicates. After 6 to 24 h of coculture, supernatants were collected. Cytokine levels were determined using a multiplex bead Human Cytokine Detection kit, in accordance with the manufacturer's instructions (Millipore, Darmstadt, Germany).

(238) To analyze the proliferation capacity of T cells, 1×10.sup.6 CAR+ T cells were stimulated over irradiated MSTO-211H or 3T3 cells with or without MSLN expression (and, in the case of 3T3, with or without PD-L1). Proliferation assays were performed in the absence of exogenous IL-2. Cells were counted every 7 days and then overlaid on irradiated target cells for repeated stimulations. The CAR+ T cell number versus time was plotted for each T-cell group.

(239) Orthotopic Pleural Mesothelioma Animal Model and Ex Vivo Experiments.

(240) To develop the orthotopic mouse model of pleural mesothelioma, female NOD/SCIDγ mice (The Jackson Laboratory, Bar Harbor, Me.) aged 4 to 6 weeks were used. All procedures were performed under approved Institutional Animal Care and Use Committee protocols. Mice were anesthetized using inhaled isoflurane and oxygen, with bupivacaine administered for analgesia. Direct intrapleural injection of 1×10.sup.5 to 1×10.sup.6 tumor cells in 200 μL of serum-free medium via a right thoracic incision was performed to establish orthotopic MPM tumors, as previously described (Adusumilli et al., Science Translational Medicine 6(261):261ra151 (2014); Servais et al., Clin. Cancer Res. 18(9):2478-2489 (2012); Servais et al., in Current Protocols in Pharmacology, Enna, ed., Chapter 14 (Unit14 21), John Wiley & Sons (2011)). In total, 3×10.sup.4 to 1×10.sup.5 transduced T cells (in 200 μL of serum-free medium) were adoptively transferred into tumor-bearing mice, either into the thoracic cavity by direct intrapleural injection or systemically by tail vein injection. Tumor growth was monitored and quantified in vivo by BLI performed 20 minutes after a single intraperitoneal dose of D-luciferin (150 mg/kg; Perkin Elmer, Waltham, M A). BLI data were analyzed using Living Image software (version 2.60; Perkin Elmer); BLI signal was reported as total flux (photons per second), which represents the average of ventral and dorsal flux. To analyze the functional capacity of CAR T cells ex vivo, tumor tissues and mouse spleen were processed as follows: Tissues were weighed and harvested into ice-cold RPMI 1640. The tissues were manually morselized with a scalpel and then mechanically disaggregated through 40- to 100-μm filters. Next, samples were analyzed by FACS (fluorescence activated cell sorting) for phenotyping, or CAR+CD4+ or CD8+ T cells were sorted using a FACS Aria sorter then rested for 24 h in RPMI with IL-2 (60 UI/mL), and .sup.51Cr-release and cytokine-release assays were performed as described above.

(241) Histologic Analysis and Immunostaining.

(242) Histopathologic evaluation of tumors was performed after hematoxylin and eosin (H&E) staining of paraffin-embedded, 4% paraformaldehyde-fixed tissue samples. Immunohistochemical analysis for human MSLN was performed with mouse anti-human MSLN immunoglobulin G, as previously described (Kachala et al., Clin. Cancer Res. 20(4):1020-1028 (2014); Rizk et al., Cancer Epidemiol. Biomarkers Prev. 21(3):482-486 (2012); Tozbikian et al., PLoS One 9(12):e114900 (2014)).

(243) Quantitative Real-Time PCR.

(244) The mRNA from CD4+ LNGFR+ or CD8+ LNGFR+ sorted T cells were extracted and reverse transcribed into cDNA using μMACS One-Step cDNA kit (MACS molecular, Miltenyi Biotech Inc, Auburn, USA). Quantitative Real Time PCR (RT-PCR) was performed with the Taqman® method using Applied Biosystems® 7500 systems (Foster, Calif., USA), Taqman® Universal PCR Mastermix and Taqman® probes labeled with 6-carboxyfluorescein (FAM-MBG) and designed by Life Technologies (Carlsbad, Calif.): Tbet (Hs00203436_m1); Eomes (Hs00172872 ml); Granzyme B (Hs01554355 ml); IFN-γ (Hs00989291_m1); IL-2 (Hs00174114 ml); PD-1 (Hs01550088_m1). The comparative threshold cycle (CT) of the gene of interest was used and normalized to the β2m housekeeping gene using the following formula: ΔCt (sample)=Ct (gene of interest)-Ct ((β2m). Then, the 2.sup.−ΔΔct method was used to analyze the relative fold change expression compared to control condition and calculated as follow: 2.sup.−ΔΔct=2{circumflex over ( )}-(ΔCt(sample)-ΔCt(control)).

(245) Statistical Methods.

(246) Data were analyzed using Prism (version 6.0; GraphPad Software, La Jolla, Calif.) software and are presented as mean±SEM, as stated in the figure legends. Results were analyzed using the unpaired Student's t test (two-tailed), with the Bonferroni correction used for multiple comparisons, when applicable. Survival curves were analyzed using the log-rank test. Statistical significance was defined as P<0.05. All statistical analyses were performed with Prism software.

(247) 7.2. CARs with CD28 or 4-1BB Costimulation Exhibit Equivalent Effector Cytokine Secretion and Proliferation In Vitro Upon Initial Antigen Stimulation

(248) Three CARs were constructed that incorporated a human MSLN-specific scFv (Feng et al., Mol. Cancer Ther. 8(5):1113-1118 (2009)) and either CD3ζ, CD28/CD3ζ or 4-1BB/CD3ζ signaling domains (Mz, M28z, MBBz) (FIGS. 1A and 1B). The P28z CAR, which is specific for prostate-specific membrane antigen (PSMA), served as a negative effector to control for alloreactivity and xenoreactivity. Both CD4+ and CD8+ human peripheral blood T lymphocytes were effectively transduced using the SFG-retroviral vector (50%-70% transduction) (FIG. 2). MSLN-transduced MSTO-211H cells (MSLN+) and PSMA-transduced EL-4 mouse lymphoma cells (MSLN−) served as MSLN-positive and -negative targets in the in vitro experiments. Mz-, M28z-, and MBBz-transduced T cells demonstrated similar MSLN-specific lysis in vitro (FIG. 1C). P28z CAR T cells did not lyse MSTO MSLN+ cells, and MSLN-targeted CARs did not lyse EL4 PSMA+ cells, demonstrating that lysis is antigen specific. Validating the functionality of costimulatory signaling (Brentjens et al., Clin. Cancer Res. 13(18 Pt 1):5426-5435 (2007)), M28z and MBBz CART cells secreted 2- to 15-fold higher levels of Th1 cytokines (FIG. 1D) and achieved 14-fold greater T-cell accumulation upon repeated exposure to MSLN+ cells when compared to Mz in the absence of exogenous IL-2 (FIG. 1E). Having established antigen specificity and validated the functionality of costimulatory signaling domains, evaluation of the therapeutic potential of MSLN-targeted CAR T cells in mice bearing established pleural tumors was performed.

(249) These results demonstrate that CARs with CD28 or 4-1BB costimulation exhibit equivalent effector cytokine secretion and proliferation in vitro upon initial antigen stimulation.

(250) 7.3. Mesothelin CAR T Cells Become Exhausted Following In Vivo Antigen Exposure

(251) To assess whether there is ongoing immuno inhibition of CAR T cells and to compare the relative abilities of M28z and MBBz CAR T cells to overcome tumor-mediated immuno inhibition, 1×10.sup.6 CAR T cells were injected into the pleural cavities of MSTO MSLN+ tumor—bearing mice, allowed sufficient time for repeated antigen encounter and T-cell activation (confirmed by forward- and side-scatter and upregulation of the activation marker CD69), and then performed ex vivo stimulation of harvested CD4 or CD8 CAR tumor-infiltrating or splenic T cells with MSLN+ targets (schematic shown in FIG. 3A). Uninjected in vitro resting T cells (“preinfusion cells”) were used to establish the baseline level of function (before antigen exposure). Compared with resting M28z CD8+ CAR T cells, T cells exposed to MSLN antigen in vivo had lower levels of cytolytic function (FIG. 3A) (preinfusion cell lysis, 20.5%; tumor-infiltrating T-cell lysis, 13.1%; splenic T-cell lysis, 8.7%). In contrast, MBBz CART cells retained cytolytic function (preinfusion cell lysis, 18.3%; tumor-infiltrating T-cell lysis, 37.2%; splenic T-cell lysis, 22.2%). Sorted CD4+ CAR T cells demonstrated a similar pattern of results.

(252) Cytokine levels were also measured upon ex vivo stimulation of tumor-infiltrating and splenic CAR T cells, and a decrease in Th1 cytokine secretion was observed for CD4+M28z CAR T cells exposed in vivo to MSLN+ antigen. CD4+ MBBz CAR T cells also demonstrated a decrease in Th1 cytokine secretion, although these cells were better able to retain cytokine secretion when compared with M28z CAR T cells (FIG. 3B). CD8+ T cell supernatants contained significantly lower levels of cytokines, compared with CD4+ T cell supernatants (a finding previously observed Adusumilli et al., Science Translational Medicine 6(261):261ra151 (2014)). CD8+ T cells also had a decreased ability to secrete cytokines upon in vivo antigen exposure; CD8+ MBBz CAR T cells preferentially retained their ability to secrete IFN-γ. The mRNA levels of T cells harvested from tumor and spleen on day 3 after administration were assessed, and it was found that the in vivo expression levels of GzB, IL-2, and IFN-γ were mostly greater for CD4+ and CD8+ MBBz CAR T cells than for M28z CAR T cells, with the exception of IL-2 expression in the CD8+ subset (FIG. 3C).

(253) These results demonstrate that mesothelin CAR T cells become exhausted following in vivo antigen exposure.

(254) 7.4. MBBz CAR T Cells Show Delayed Exhaustion In Vivo

(255) Having demonstrated inhibition of both the cytolytic function and effector cytokine secretion in costimulated CAR T cells exposed to antigen in vivo, it was reasoned that repeated antigen stimulation may, similar to models of chronic infection, play a role in T-cell inhibition and that differing abilities to retain function upon repeated antigen encounter might explain enhanced efficacy of MBBz CAR T cells. Therefore, Mz, M28z, and MBBz CAR T cells were tested for their ability to withstand repeated antigen encounter in an in vitro model system, wherein cells were assessed for proliferation, cytolytic function, and cytokine secretion upon MSLN+ antigen stimulation every 7 days. M28z and MBBz CAR T cells had similar abilities to expand upon serial MSLN+ stimulation, expanding to levels 14-fold greater than those of Mz CAR T cells; they lost the ability to expand following the third stimulation (FIG. 4A). Both MBBz and M28z CAR T cells lost cytolytic function upon repeated antigen stimulation, although MBBz CAR T cells were better able to retain lytic function. Whereas lysis was equal among the three T-cell groups at the first stimulation, by the third stimulation, M28z lytic function was inhibited to a more pronounced level, such that MBBz CAR T cells had enhanced tumor lysis at multiple E:T ratios (FIG. 4B, right). Lytic function (as assessed by a degranulation assay measuring CD107a expression) at the third stimulation correlated with the results of chromium-release assays (FIG. 4C).

(256) Next, Th1 cytokine secretion was measured. Similar levels between M28z and MBBz CAR T cells were noted at the first stimulation, as well as a successive decrease with each stimulation. As with cytotoxicity, MBBz CAR T cells preferentially retained cytokine secretion; cytokine concentrations decreased >30-fold for M28z and only around 2-fold for MBBz CAR T cells, when levels at the first and second stimulations were compared (FIG. 4D). The differences in cytokine production were confirmed by measuring intracellular levels of cytokines at the second stimulation. Reverse-transcriptase PCR analysis of CAR T cells at the time of antigen stimulation revealed that MBBz CAR T cells expressed markers that correlate with lower levels of exhaustion and inhibition, compared with M28z CAR T cells; MBBz CAR T cells expressed higher levels of Tbet and Eomesodermin and lower levels of PD1 and FoxP3 (FIG. 5). The in vivo function of persisting CAR T cells that had already been exposed to tumor antigen was tested. Although quantitative persistence is equal between M28z and MBBz CAR T cells, it was thought that MBBz CAR T cells would demonstrate enhanced function upon tumor rechallenge. Mice with established MSLN+ pleural tumors were administered intrapleural M28z or MBBz CAR T cells (at a dose of 1×10.sup.5, E:T ratio 1:3000) to eradicate pleural tumor (FIG. 4E). Twenty days after the initial T-cell injection, tumor rechallenge was performed by injecting MSLN+ tumor cells (lx 10.sup.6) into the pleural cavity of survivors; tumor burden was monitored using BLI. Persisting MBBz CAR T cells were better able to control tumor burden (4 of 4 MBBz-treated mice had a BLI signal at baseline levels vs. 2 of 4 M28z-treated mice) (FIG. 4E).

(257) These results demonstrate that MBBz CAR T cells show delayed exhaustion in vivo.

(258) 7.5. Tumor Cell PD-L1 Inhibits Mesothelin CAR T-Cell Effector Functions

(259) Having established that CAR T cells are inhibited by the in vivo tumor environment and that MBBz CAR T cells are better able to overcome this inhibition, at least in part because of their ability to retain function upon repeated antigen encounter (see above), it was next sought to assess the role that inhibitory receptor and ligand pathways play in the model. Tumor-infiltrating T cells, in M28z-treated mice with tumor progression, were stained for the expression of well-known pathways of inhibition. High levels of expression of PD-1, Tim-3, and LAG-3 were found (FIG. 6A). Tumor-infiltrating MBBz CAR T cells harvested 6 days after administration demonstrated upregulation of inhibitory receptors as well, although they expressed significantly lower levels of PD-1 receptor at both the protein and the mRNA level (FIG. 6B-D). CD4+ T cells expressed higher levels of PD-1, compared with CD8+ T cells. It was also observed that a significant fraction of both M28z and MBBz CAR T cells coexpressed PD-1 and LAG-3 or PD-1 and Tim-3, suggesting that multiple inhibitory pathways could be functioning simultaneously (FIG. 7). Next, tumor-expressed ligands were assessed: PD-L1 and PD-L2 (ligands for PD-1), galectin-9 (ligand for Tim-3), and MHC class II (ligand for LAG-3). Only PD-1 ligands were expressed on pleural tumor cells harvested after intrapleural administration of M28z CAR T cells (FIG. 6E). As reported elsewhere (McGray et al., Mol. Ther. 22(1):206-218 (2014); Spranger et al., Science Translational Medicine 5(200):200ra116 (2013)), coculture of tumor cells with IFN-γ and TNF-α (at concentrations similar to those secreted by T cells in FIGS. 1 and 4) resulted in a similar level of upregulation of PD-L1 and PD-L2 expression on tumor cells (FIG. 6F), reflecting an adaptation of tumor cells to resist immune attack (“adaptive immunoresistance”). The unique presence of expression of both PD-1 receptor and ligand in vivo suggests that this pathway may play a significant inhibitory role.

(260) As some studies have suggested that costimulation may be sufficient to overcome inhibition by PD-1 (Carter et al., Eur. J. Immunol. 32(3):634-643 (2002); Freeman et al., J. Exp. Med. 192(7):1027-1034 (2000); Koehler et al., Cancer Res. 67(5):2265-2273 (2007)), it was next assessed whether overexpressed PD-L1 can inhibit CAR T-cell function in an in vitro model of PD-L1-mediated immuno inhibition (using 3T3 mouse fibroblasts transduced with either MSLN alone (MSLN+) or both MSLN and PD-L1 (MSLN+PD-L1+)) (FIG. 8A). In both M28z and MBBz CAR T cells, PD-L1 overexpression resulted in decreased accumulation upon successive stimulation (FIG. 8B) and Th1 effector cytokine secretion (FIG. 8D). Although tumor-cell lysis was not inhibited upon initial stimulation, chromium release assay performed with 3T3s as targets following two stimulations against MSTO MSLN+ tumor cells demonstrates decreased lytic function in both M28z and MBBz CAR T cells, a higher extent of decrease in M28z CAR T cells (FIG. 8C). This result may be due to the differential upregulation of PD-1 on M28z and MBBz CAR T cells following exposure to MSTO MSLN+ tumor cells.

(261) These results demonstrate that tumor cell PD-L1 inhibits mesothelin CAR T-cell effector functions.

(262) 7.6. Cell Intrinsic PD-1 Resistance Rescues M28z CAR T-Cell Function In Vivo

(263) The above results indicate that the PD-1 pathway is a functioning mechanism of tumor-mediated immuno inhibition and that PD-1 upregulation following repeated antigen stimulation decreases CAR T-cell efficacy. Therefore, checkpoint blockade was combined with CD28 costimulatory signaling. Since the goal was to provide CAR T-cell-specific checkpoint blockade that was not reliant on repeated dosing of systemically administered antibodies, the studies were focused on genetically engineered methods of overcoming immuno inhibition. A PD-1 dominant negative receptor (DNR) was constructed that contained the extracellular ligand binding domain of the receptor fused to a CD8 transmembrane domain. Since the PD-1 DNR lacks any signaling domain, it was thought that sufficiently overexpressed receptor would enhance T-cell efficacy by saturating PD-1 ligands and thereby blocking signaling through the endogenous PD-1 receptor. M28z CAR T cells were cotransduced with either the PD-1 DNR linked by a P2A element to an mCherry reporter (PD-1 DNR) or an empty vector containing only the reporter (EV) (FIG. 9A). M28z CAR T cells cotransduced with the PD-1 DNR had slight but statistically significant advantages in proliferative ability (FIG. 9B), enhanced cytotoxicity (FIG. 9C) at multiple E:T ratios, as well as augmented levels of IL-2 and IFN-γ secretion (FIG. 9D).

(264) Next, it was assessed whether intrapleural administration of M28z CAR T cells cotransduced with a genetically engineered PD-1 resistance would provide an in vivo advantage. Mice with established pleural MSLN+-expressing tumors were administered a single intrapleural dose of 5×10.sup.4 CAR+M28z EV or M28z PD-1 DNR T cells, and treatment response was monitored by tumor burden measurements (using serial BLI) and median survival. Mice treated with M28z PD-1 DNR T cells had significantly enhanced tumor burden control and prolonged median survival (FIG. 9E); however, only some mice (7/16, 44%) had long-term tumor-free survival, suggesting that there are redundant mechanisms of immuno inhibition that must be overcome. A cohort of the mice (M28z PD-1 DNR) in this experiment survived beyond 450 days in spite of repeated tumor rechallenge, demonstrating the “functional persistence” of CAR T cells transduced with PD-1 DNR. These results demonstrate that, with an injection of 50,000 CAR T cells, not only was a large tumor burden eradicated but tumor relapse was prevented in spite of multiple tumor rechallenge over more than 15 months.

(265) To investigate an alternative genetic strategy for overcoming PD-1-mediated immuno inhibition, M28z CAR T cells were cotransduced with vectors expressing PD-1-targeting shRNAs (FIG. 10A), which generated >60% PD-1 receptor knockdown at the protein level (FIG. 10B). In M28z CAR T cells, cotransduction with PD-1 shRNAs enhanced proliferative function upon MSLN+ antigen stimulation (FIG. 10C), augmented cytotoxicity (FIG. 10D), and enhanced cytokine secretion upon stimulation with either mesothelioma cells or MSLN+ PDL1+3T3 mouse fibroblasts (FIG. 10E), compared with cotransduction with an shRNA targeting a non-mammalian gene (M28z KanR). M28z PD-1 shRNA-transduced T cells did not achieve greater in vivo tumor rejection efficacy than M28z KanR T cells, but it is noteworthy that the level of knockdown was significantly lower in vivo than in vitro. Thus, the PD1 DNR proved to be the more effective strategy in vivo than the RNA interference approach. These results demonstrate that cell intrinsic PD-1 resistance rescues M28z CAR T-cell function in vivo.

(266) 7.7 PD-1 DNR Binds Efficiently to Both PD-L1 and PD-L2

(267) To test the binding of PD-1 DNR to the ligands PD-L1 and PD-L2, T cells labeled with mCherry and transduced with PD-1 DNR were exposed to plates coated with PD-L1 fused to an Fc (“PD-L1 Fc”), PD-L2 fused to an Fc (“PD-L2 Fc”), or control isotype Fc (“iso Fc”). Human T cells were transduced with an mCherry construct to label the T cells with mCherry essentially as described in section 7.6. The PD-L1 Fc fusion, PD-L2 Fc fusion and control Fc were purchased commercially.

(268) Plates coated with PD-L1 Fc fusion protein, PD-L2 Fc protein, or control isotype Fc were exposed to mCherry labeled T cells alone, mCherry labeled T cells in the presence of a PD-1 antibody, mCherry labeled T cells transduced with PD-1 DNR, and mCherry labeled T cells transduced with PD-1 DNR in the presence of PD-1 antibody.

(269) As shown in FIG. 11, compared to control T cells with mCherry and without PD-1 DNR transduction, T cells transduced with PD-1 DNR bound to both PD-L1 and PD-L2 efficiently. These results demonstrate that the PD-1 DNR binds to both PD-L1 and PD-L2. Since some tumor cells express either PD-L1 or PD-L2, and since some immune cells (T cells and non-T cells such as macrophages, etc.) express either PD-L1 or PD-L2, it is significant that the PD-1 DNR binds to both PD-L1 and PD-L2. Thus, the T cells transduced with PD-1 DNR can neutralize both PD-L1 and PD-L2.

(270) 7.8 Addition of Intracellular 4-1BB Signaling to PD-1 DNR Improves CAR T Cell Efficiency

(271) A PD-1 DNR, which inhibits PD-L1- or PD-L2-mediated inhibition of T cell activation, can be converted into a positive co-stimulatory signal. Human T cells were transduced with a mesothelin-specific (MSLN-specific) CAR having CD28 and CD3zeta domains (M28z) (see also description of m28z above in section 7.2). To counteract PD-1/PD-L1 inhibition, cell-intrinsic genetic-engineering strategies were evaluated by cotranducing M28z CAR T cells with a PD-1 dominant negative receptor (PD-1 DNR) fused to a transmembrane domain fused to a 4-1BB intracellular signaling domain, also referred to as a switch receptor.

(272) FIG. 12A shows a schematic diagram illustrating co-expression of a CAR and a PD-1 DNR. The lower portion of FIG. 12A represents a T cell expressing a CAR that binds to an antigen on a target cell, exemplified in FIG. 12A as a tumor cell expressing the tumor cell antigen mesothelin (MSLN). Binding of the T cell expressing a tumor cell antigen-specific CAR to a tumor cell expressing the tumor cell antigen results in activation of the T cell. Co-expression of the PD-1 DNR inhibits the immune checkpoint inhibitor pathway mediated by the binding of PD-L1 or PD-L2 to wild type PD-1. FIG. 12B shows a schematic diagram illustrating co-expression of a CAR and a PD-1 DNR, where the PD-1 DNR has been converted into a costimulatory construct by fusing a costimulatory molecule, exemplified as 4-1 BB, to a transmembrane domain fused to the ligand binding domain of PD-1. Such a construct is an example of a construct referred to herein as a switch receptor (see Liu et al., Cancer Res. 76:1578-1590 (2016)). The 4-1BB domain acts as a second costimulatory signal for T cell activation.

(273) Human T cells were transduced with M28z CAR, both M28z CAR and PD-1 DNR, or both M28z CAR and a PD-1/4-1BB switch receptor construct. Transduced cells were antigen stimulated and analyzed for T cell accumulation in culture. As shown in FIG. 12C, M28z CAR T cell accumulation was increased at day 7, and the accumulation was enhanced when the T cells expressing M28z CAR were cotransduced with PD-1 DNR or a PD-1/4-1BB switch receptor construct.

(274) FIG. 12D shows cytokine secretion of interferon gamma (IFN-γ), interleukin 2 (IL-2), tumor necrosis factor alpha (TNF-α) and granulocyte-macrophage colony-stimulating factor (GM-CSF) in human T cells transduced with M28z CAR, both M28z CAR and PD-1 DNR, or both M28z CAR and a PD-1/4-1BB switch receptor construct. Cytokine secretion assays were performed essentially as described above in section 7.1. As shown in FIG. 12D, secretion of IFN-γ, IL-2, TNF-α and GM-CSF was enhanced in cells expressing M28z CAR and a PD-1/4-1BB switch receptor construct relative to the cytokine secretion observed in cells expressing M28z CAR or cells coexpressing M28z CAR and PD-1 DNR. These results demonstrate that PD-L1 (or PD-L2) inhibition can be converted into a positive costimulatory signal by cotransducing in T cells a PD-1/4-1BB switch receptor construct with M28z CAR, resulting in enhanced cytokine secretion and T-cell accumulation.

(275) 7.9. Overview and Discussion of Experimental Results

(276) As described above, CAR T-cell therapy and PD-1 checkpoint blockade have been demonstrated to be a rational combination in a solid tumor model. In vitro and ex vivo stimulation assays were performed to assess the impact of PD-1/PD-L1 inhibition on mesothelin CAR T-cell function. To directly counteract PD-1-mediated inhibition, retroviral vectors were used to combine CAR-mediated costimulation with a PD-1 DNR. Optimal signaling provided by this combinatorial strategy (costimulation and checkpoint blockade) enhanced T-cell function in the presence of tumor-encoded PD-L1 expression, resulting in long-term tumor-free survival following a single low dose of CAR T cells. These studies are relevant to the clinical practice of adoptive T-cell therapy and are immediately translational for the following reasons: (1) the costimulatory signaling domains tested—CD28 and 4-1BB—are the two costimulatory domains used in ongoing clinical trials (NCT02414269, NCT02159716, NCT01583686), (2) the models of pleural mesothelioma recapitulate human disease and uses large, clinically relevant tumor burdens that elucidate the relevance of T-cell exhaustion (Adusumilli et al., Science Translational Medicine 6(261): 261ra151 (2014); Servais et al., Clin. Cancer Res. 18(9):2478-2489 (2012); Servais et al., in Current Protocols in Pharmacology, Enna, ed., Chapter 14 (Unit14 21), John Wiley & Sons (2011); Servais et al., PLoS One 6(10):e26722 (2011)), and (3) the strategy of potentiating CAR T cells by genetically encoded checkpoint blockade uses human sequences that can be readily applied in the clinic (Adusumilli et al., Science Translational Medicine 6(261):261ra151 (2014); Feng et al., Mol. Cancer Ther. 8(5):1113-1118 (2009)).

(277) The relatively higher expression of PD-1 in M28z CAR T cells led to the focus on CD28-stimulated CAR T cells. On the basis of this analysis, genetic strategies were pursued for counteracting PD-1 inhibitory signaling, such as generating a PD-1 dominant negative receptor (PD-1 DNR) and shRNAs targeting PD-1. When expressed at sufficient levels, the PD-1 DNR competes with the endogenous PD-1 receptor for binding PD-1 ligands (PD-L1 and PD-L2). CD28-costimulated T cells cotransduced with PD-1 DNR demonstrated enhanced in vitro T-cell functions and in vivo T-cell efficacy, suggesting PD-1 signaling as a significant mechanism by which tumor cells evade CAR T cells in the tumor model. Although only in vitro efficacy was demonstrated for PD-1-targeting shRNAs, the absence of in vivo efficacy is likely related to saturation of shRNA machinery by the high volume of PD-1 transcripts induced following multiple in vivo antigen encounters, a conclusion supported by the finding that PD-1 knockdown was significantly lower in vivo than in vitro. The findings described above point to the therapeutic usefulness of adoptively transferred T cells that are genetically engineered to resist tumor-mediated immune inhibition. A DNR that targets TGF-β has been validated in preclinical models and is currently being tested in clinical trials (Foster et al., J. Immunother. 31(5):500-505 (2008); Bollard et al., Blood 99(9):3179-3187 (2002)).

(278) Whereas others have combined T-cell therapy with PD-1-blocking antibodies either in vivo or in vitro, the addition of a genetic strategy for coinhibitory blockade described in the experiments above overcomes several major obstacles limiting antibody therapy, including (1) the reliance on repeated administrations of antibodies and (2) the incidence of immune-related adverse events. T-cell therapy, then, has advantages over antibody therapy because it can establish long-term engraftment of T cells programmed for resistance to inhibition after a single dose and because it provides blockade of inhibitory pathways that is limited to a tumor-targeted T-cell repertoire, which may limit the autoimmunity that results from a more broadly applied antibody checkpoint blockade. Furthermore, it is possible that perhaps PD-L1 blocking antibodies can further prolong the efficacy of M28z and M28z PD-1 DNR CAR T cells.

(279) The studies described above have identified one of the inhibitory mechanisms responsible for CAR T-cell and highlighted differences in the ability of costimulatory strategies to withstand immuno inhibition. Other inhibitory pathways may also function to potentially limit T-cell function. That a proportion of mice treated with PD-1 DNR-cotransduced M28z CAR T cells died of tumor progression suggests the action of other inhibitory mechanisms. Furthermore, the literature on chronic infection suggests the existence of other mechanisms of inhibition, both cell intrinsic and cell extrinsic, which are being assessed in tumor-targeted T-cell therapies (Moon et al., Clin. Cancer Res. 20(16):4262-4273 (2014); Riese et al., Cancer Res. 73(12):3566-3577 (2013)). Additional studies on inhibitory signaling can use an immunocompetent model that includes elements such as myeloid-derived suppressor cells and endogenous T cells, which have been shown to play important roles in tumor immune evasion.

(280) The results described above have established the importance of tumor-mediated inhibition of CAR T-cell effector functions. By performing a comprehensive analysis of T-cell effector functions, it has been established that even costimulated CAR T cells, although they demonstrate enhanced persistence, are subject to inhibition upon repeated antigen encounter, both in vitro and within the tumor microenvironment. The results described demonstrate that CAR T-cell therapy can be used to counteract inhibitory signaling and provides the flexibility to engineer signaling domains that provide optimal costimulation and directly counteract inhibitory signals such as PD-1. Furthermore, in ongoing CAR T-cell therapy clinical trials in patients who show T-cell infiltration but a limited clinical response, combining PD-1/PD-L1 blockade following CAR T-cell therapy can be utilized to improve the efficacy of CAR T-cell therapy. The knowledge acquired from the clinical trials and the strategies presented herein are highly valuable to improve immunotherapy methods using CAR T cells, which is particularly use for therapy of solid tumors. Thus, the results described above exemplify methods that can be applied in a clinical setting to improve the efficacy of CAR T-cell therapy.

(281) As described above, low-level tumor infiltration was modeled, and it was found that CAR T cells can be susceptible to tumor cell-mediated immune-inhibition, resulting in impaired T-cell function and diminished tumor rejection. T cells engineered to resist PD-1 signaling displayed enhanced anti-tumor potency. Following a single low-dose CAR T-cell therapy of advanced tumors, it was observed that, in response to CAR T-cell secreted cytokines, tumor cells upregulate PD-L1 leading to CAR T-cell inhibition and tumor relapse. To directly overcome the PD-L1-mediated immunosuppression, a PD-1 dominant negative receptor (PD-1 DNR) lacking the intracellular inhibitory signaling domain was designed. The cotransduction of PD-1 DNR with a CAR enhanced CAR T-cell function, resulting in a long-term cancer free survival following a single low-dose of CAR T cells. The coexpression of an immune checkpoint pathway receptor DNR with a CAR is immediately translatable to the clinic since a DNR can be added to any CAR without inhibiting CAR function or adding toxicity. Without being bound by a particular theory, it is believed that the DNR simply binds (consumes) negative signal induced by its corresponding ligand (for example, PD-L1 in the case of PD-1) and avoids downstream signaling.

(282) The effectiveness of an immune cell expressing a CAR and a dominant negative form of an immune checkpoint inhibitor can also be enhanced by expression of a switch receptor, in which an intracellular co-stimulatory signaling domain is fused to a transmembrane domain fused to the extracellular ligand binding domain of an immune checkpoint inhibitor, such as PD-1. The results described above show that expression of a PD-1 extracellular domain fused to a transmembrane domain fused to the cytoplasmic domain of 4-1BB increased cytokine production and increased accumulation of CAR T cells. Expression of a switch receptor in an immune cell expressing a CAR can improve the efficacy of the immune cell for immunotherapy. Alternatively, a switch receptor can be expressed in a cell without a CAR, in which case the switch receptor functions as a dominant negative. Immune cells expressing a CAR and a switch receptor can be administered, concurrently or sequentially, with immune cells expressing a dominant negative form of an immune checkpoint inhibitor (that does not contain the co-stimulatory signaling domain, and thus is not a switch receptor), or with cells co-expressing a CAR and a dominant negative form of an immune checkpoint inhibitor (that does not contain the co-stimulatory signaling domain, and thus is not a switch receptor), to enhance the effectiveness of immunotherapy using such immune cells.

8. REFERENCES CITED

(283) All references cited herein are incorporated herein by reference in their entirety and for all purposes to the same extent as if each individual publication or patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety for all purposes.

(284) Many modifications and variations of this invention can be made without departing from its spirit and scope, as will be apparent to those skilled in the art. The specific embodiments described herein are offered by way of example only, and the invention is to be limited only by the terms of the appended claims, along with the full scope of equivalents to which such claims are entitled.