COSMETIC FORMULATION FOR TOPICAL ADMINISTRATION COMPRISING NOVEL PEPTIDES THAT IMPROVE APPEARANCE AND REGENERATION OF SKIN

Abstract

The invention relates to novel nature-derived and synthetic active peptide- or peptide-derived agents designed for the cosmetic treatment of the human skin, as well to cosmetic formulations and compositions containing them. The active agents are effective in restoring, promoting and maintaining a healthy skin. In particular, the invention discloses combinations or sets of said skin effective agents including stem-cell factors that modulate the skin micromilieu and modulate skin stem cell behaviour, thereby effectively healing, regenerating and improving the state of aged or damaged skin.

Claims

1. A cosmetic formulation or composition for topical administration to the skin comprising at least one peptide or peptide derivative which triggers or enhances or improves regeneration or appearance of skin, wherein the at least one peptide or peptide derivative is selected from at least one of the three groups: (A) peptides and peptide derivatives that stimulate the Wnt/β-catenin signaling pathway comprising or having the sequence/formula: TABLE-US-00028 (i) (SEQ ID NO: 1) LNPSECPKTVLGAEYGKTLDASYSTAEAENHVRL (ii) (SEQ ID NO: 2) LNPSECPKTVLGASTSTLDASYSTAEAENHVRL (iii)  (SEQ ID NO: 3) Z1-LNPSECPKTVLGAEYGKTLDASYSTAEAENHVRL (iv) (SEQ ID NO: 4) Z1-LNPSECPKTVLGASTSTLDASYSTAEAENHVRL wherein Z1 is a carrier moiety covalently attached to the N-terminus of said peptide that reduces tissue penetration and/or basal membrane transpermeation of said peptide; (B) peptides and peptide derivatives that are agonists of the tissue-protective heterodimeric or heterooligomeric EPOR/CD131 (erythropoietin receptor/cluster of differentiation 131) receptor, wherein said peptides or peptide derivatives comprise or have the sequence/formula: TABLE-US-00029 (v) (SEQ ID NO: 5) GGGGETTNMWAREWMGLPCQDQ (vi) (SEQ ID NO: 6) Z2-GGGGETTNMWAREWMGLPCQDQ wherein Z2 is an acyl group of a branched or unbranched fatty acid covalently attached to the N-terminus of said peptide; (C) peptides and peptide derivatives that are variants of human TGF-β3 comprising or having the sequence/formula TABLE-US-00030 (vii) (SEQ ID NO: 7) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPC PYLRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTPK VEQLENMVVKSCKCS; (viii) (SEQ ID NO: 8) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPC PYLRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTPK VEQLENMVVKSCKCSLPXTGGG (ix) (SEQ ID NO: 9) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPC PYLRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTPK VEQLENMVVKSCKCSLPXTGGG-Z3 wherein X is K or E, and Z3 is a glycopolymer attached to the C-terminus.

2. The cosmetic formulation or composition according to claim 1 comprising at least one peptide or peptide derivative selected from group (A).

3. The cosmetic formulation or composition according to claim 2, wherein at least one peptide or peptide derivative comprises or has the sequence/formula SEQ ID NO: 1, 2, 3 or 4, and Z1 is a polyethylene glycol having a molecular weight in a range of 8-60 kDa.

4. The cosmetic formulation or composition according to claim 1 comprising at least one peptide or peptide derivative selected from group (B).

5. The cosmetic formulation or composition according to claim 4, wherein the at least one peptide or peptide derivative comprises or has the sequence/formula SEQ ID NO: 5 or 6, and Z2 is a branched or an unbranched fatty acid of 5-42 carbon atoms.

6. The cosmetic formulation or composition according to claim 4 further comprising an adequate amount of a peptide/peptide derivative-based antagonist of the tissue-protective heterodimeric or heterooligomeric EPOR/CD131 (erythropoietin receptor/cluster of differentiation 131) receptor, wherein said peptide or peptide derivative modulates or dampens or inhibits the biological activity of the agonist presented by SEQ ID NOs 5 or 6.

7. The cosmetic formulation or composition according to claim 6, wherein said peptide/peptide derivative-based antagonist comprises or has the sequence/formula TABLE-US-00031 (SEQ ID NO: 17) GGGGETTNMWAHDWMGLPRADQ or (SEQ ID NO: 10) Z2-GGGGETTNMWAHDWMGLPRADQ wherein Z2 is an acyl group of a branched or an unbranched fatty acid of 5-42 carbon atoms, attached to the N-terminus of said peptide.

8. The cosmetic formulation or composition according to claim 4, wherein said peptide/peptide derivative-based agonist presented by SEQ ID Nos 5 or 6 is partially or fully inactivated during application.

9. The cosmetic formulation or composition according to claim 6, wherein said peptide/peptide derivative-based antagonist presented by SEQ ID NOs 10 or 17 is partially or fully inactivated during application.

10. The cosmetic formulation or composition of claim 8, wherein the inactivation of said peptide/peptide derivative-based agonist or antagonist is induced by air oxidation of methionine residues within the sequence of said peptide/peptide derivative agonist or antagonist.

11. The cosmetic formulation or composition according to claim 1 comprising at least one peptide or peptide derivative selected from group (C).

12. The cosmetic formulation or composition according to claim 11, wherein at least one peptide or peptide derivative comprises or has the sequence/formula SEQ ID NOs: 7, 8 or 9, and Z3 is or comprises an oligomer or multimer or polymer comprising at least 15 monomer units containing moieties of trehalose or trehalose derivatives.

13. The cosmetic formulation or composition according to claim 1 comprising at least one peptide or peptide derivative selected from group (A) and at least one peptide or peptide derivative selected from group (B).

14. The cosmetic formulation or composition according to claim 13, wherein (a) at least one peptide or peptide derivative of group (A) comprises or has the sequence/formula SEQ ID NOs: 1, 2, 3 or 4, and Z1 is a polyethylene glycol having a molecular weight in a range of 8-60 kDa, and (b) at least one peptide or peptide derivative of group (B) comprises or has the sequence/formula SEQ ID NOs: 5 or 6, and Z2 is a branched or unbranched fatty acid of 5-42 carbon atoms.

15. The cosmetic formulation or composition according to claim 13 further comprising an adequate amount of a peptide/peptide derivative-based antagonist of the tissue-protective heterodimeric or heterooligomeric EPOR/CD131 (erythropoietin receptor/cluster of differentiation 131) receptor, wherein said peptide/peptide derivative modulates or dampens or inhibits the biological activity of the agonist presented by SEQ ID NOs 5 or 6.

16. The cosmetic formulation or composition according to claim 15, wherein said antagonist is a peptide or peptide derivative comprising or having the sequence/formula: TABLE-US-00032 (SEQ ID NO: 17) GGGGETTNMWAHDWMGLPRADQ or (SEQ ID NO: 10) Z2-GGGGETTNMWAHDWMGLPRADQ, wherein Z2 is an acyl group of an unbranched or branched fatty acid of 5-42 carbon atoms, attached to the N-terminus of said peptide.

17. The cosmetic formulation or composition according to claim 1 comprising at least one peptide or peptide derivative selected from group (A) and at least one peptide or peptide derivative selected from group (B) and at least one peptide or peptide derivative selected from group (C).

18. The cosmetic formulation or composition according to claim 17, wherein (a) the at least one peptide or peptide derivative of group (A) comprises or has the sequence/formula SEQ ID NOs: 1, 2, 3 or 4, and Z1 is a polyethylene glycol having a molecular weight in a range of 8-60 kDa, (b) at least one peptide or peptide derivative of group (B) comprises or has the sequence/formula SEQ ID NOs: 5 or 6, and Z2 is a branched or an unbranched fatty acid of 5-42 carbon atoms, and (c) the at least one peptide or peptide derivative of group (C) comprises or has the sequence/formula SEQ ID NOs: 7, 8 or 9, and Z3 is or comprises an oligomer or multimer or polymer comprising at least 15 monomer units containing moieties of trehalose or trehalose derivatives.

19. The cosmetic formulation or composition according to claim 17 further comprising an adequate amount of a peptide/peptide derivative-based antagonist of the tissue-protective heterodimeric or heterooligomeric EPOR/CD131 (erythropoietin receptor/cluster of differentiation 131) receptor, wherein said peptide or peptide derivative modulates or dampens or inhibits the biological activity of the agonist presented by SEQ ID NOs 5 or 6.

20. The cosmetic formulation or composition according to claim 19, wherein said antagonist is a peptide or peptide derivative comprising or having the sequence/formula: TABLE-US-00033 (SEQ ID NO: 17) GGGGETTNMWAHDWMGLPRADQ or (SEQ ID NO: 10) Z2-GGGGETTNMWAHDWMGLPRADQ, wherein Z2 is an acyl group of an unbranched or branched fatty acid of 5-42 carbon atoms, attached to the N-terminus.

21. The cosmetic formulation or composition according to claim 1 comprising at least one peptide or peptide derivative selected from group (A) and at least one peptide or peptide derivative selected from group (C).

22. The cosmetic formulation or composition according to claim 21, wherein (a) at least one peptide derivative of group (A) comprises or has the sequence/formula SEQ ID NOs: 3 or 4, and Z1 is a polyethylene glycol having a molecule size in a range of 8-60 kDa, and (b) at least one peptide derivative of group (C) comprises or has the sequence/formula SEQ ID Nos: 7, 8 or 9, and Z3 is or comprises an oligomer or multimer or polymer comprising at least 15 monomer units containing moieties of trehalose or trehalose derivatives.

23. The cosmetic formulation or composition according to claim 1 comprising at least one peptide or peptide derivative selected from group (B) and at least one peptide or peptide derivative selected from group (C).

24. The cosmetic formulation or composition according to claim 23, wherein (a) at least one peptide derivative of group (B) comprises or has the sequence/formula SEQ ID NOs: 5 or 6, and Z2 is a branched or an unbranched fatty acid of 5-42 carbon atoms, and (b) at least one peptide derivative of group (C) comprises or has the sequence/formula SEQ ID NOs: 7, 8 or 9, and Z3 is or comprises an oligomer or multimer or polymer comprising at least 15 monomer units containing moieties of trehalose or trehalose derivatives.

25. The cosmetic formulation or composition according to claim 23 further comprising an adequate amount of a peptide/peptide derivative-based antagonist of the tissue-protective heterodimeric or heterooligomeric EPOR/CD131 (erythropoietin receptor/cluster of differentiation 131) receptor, wherein said peptide or peptide derivative modulates or dampens or inhibits the biological activity of the agonist presented by SEQ ID NOs 5 or 6.

26. The cosmetic formulation or composition according to claim 25, wherein said antagonist is a peptide or peptide derivative comprising or having the sequence/formula: TABLE-US-00034 (SEQ ID NO: 17) GGGGETTNMWAHDWMGLPRADQ or (SEQ ID NO: 10) Z2-GGGGETTNMWAHDWMGLPRADQ, wherein Z2 is an acyl group of an unbranched or branched fatty acid of 5-42 carbon atoms, attached to the N-terminus of said peptide.

27. The cosmetic formulation or composition according to claim 1, further comprising at least one peptide or peptide derivative that elicits collagen type 3-derived matrikine activity and comprising or having one of the sequences/formulas selected from the group consisting of: TABLE-US-00035 (SEQ ID NO: 11) LQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG (SEQ ID NO: 12) VKGESGKPGANGLSGERGPPGPQG (SEQ ID NO: 13) Z2-LQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGP PG (SEQ ID NO: 14) Z2-VKGESGKPGANGLSGERGPPGPQG wherein Z2 is an acyl group of an unbranched or branched fatty acid of 5-42 carbon atoms, attached to the N-terminus of said peptides.

28. The cosmetic formulation or composition according to claim 1, further comprising at least one peptide or peptide derivative that elicits CD26/Dpp4 inhibition and comprises or has one of the sequences/formulas selected from the group consisting of: TABLE-US-00036 (SEQ ID NO: 15) EIHQEEPIGGQSGSGG-KPI, and (SEQ ID NO: 16) EIHQEEPIGGK[Z2]SGSGG-KPI wherein G-K denotes an isopeptide bond between the carboxy function of G and the epsilon amino function of K, Z2 denotes an acyl group of an unbranched or branched fatty acid of 5-42 carbon atoms, and K[Z2] denotes an amide bond between the epsilon amino function of K and the carboxy function of the fatty acid Z2.

29. The cosmetic formulation or composition according to claim 1, wherein said peptides or peptide derivatives are encapsulated or attached to a liposome or ceramide structure to improve or enhance tissue delivery.

30. An isolated peptide or peptide derivative that stimulates the Wnt/β-catenin signaling pathway having or comprising a sequence/formula selected from the group consisting of: TABLE-US-00037 (i) (SEQ ID NO: 1) LNPSECPKTVLGAEYGKTLDASYSTAEAENHVRL (ii) (SEQ ID NO: 2) LNPSECPKTVLGASTSTLDASYSTAEAENHVRL (iii)  (SEQ ID NO: 3) Z1-LNPSECPKTVLGAEYGKTLDASYSTAEAENHVRL (iv) (SEQ ID NO: 4) Z1-LNPSECPKTVLGASTSTLDASYSTAEAENHVRL wherein Z1 is a carrier moiety covalently attached to the N-terminus of said peptide that reduces tissue penetration and/or basal membrane transpermeation of said peptide.

31. The isolated peptide or peptide derivative of claim 30, wherein Z1 is a polyethylene glycol having a molecule size in a range of 8-60 kDa.

32. An isolated peptide or peptide derivative that acts as agonists of the tissue-protective heterodimeric or heterooligomeric EPOR/CD131 (erythropoietin receptor/cluster of differentiation 131) receptor, wherein said peptide or peptide derivative has or comprises a sequence/formula selected from the group consisting of: TABLE-US-00038 (i) (SEQ ID NO: 5) GGGGETTNMWAREWMGLPCQDQ (ii) (SEQ ID NO: 6) Z2-GGGGETTNMWAREWMGLPCQDQ wherein Z2 is an acyl group of a branched or an unbranched fatty acid of 5-42 carbon atoms, attached to the N-terminus of said peptide.

33. An isolated peptide or peptide derivative that acts as antagonist of the tissue-protective heterodimeric or heterooligomeric EPOR/CD131 (erythropoietin receptor/cluster of differentiation 131) receptor, wherein said peptide or peptide derivative has or comprises the sequence/formula selected from the group consisting of: TABLE-US-00039 (i) (SEQ ID NO: 17) GGGGETTNMWAHDWMGLPRADQ or (ii) (SEQ ID NO: 10) Z2-GGGGETTNMWAHDWMGLPRADQ, wherein Z2 is an acyl group of an unbranched or branched fatty acid of 5-42 carbon atoms, attached to the N-terminus of said peptide.

34. An isolated peptide or peptide derivative which elicits biological activity of human TGF-β3 having a sequence/formula selected from the group consisting of: TABLE-US-00040 (i) (SEQ ID NO: 7) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPC PYLRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTP KVEQLENMVVKSCKCS (ii) (SEQ ID NO: 8) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPC PYLRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTP KVEQLENMVVKSCKCSLPXTGGG (iii) (SEQ ID NO: 9) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPC PYLRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTP KVEQLENMVVKSCKCSLPXTGGG-Z3 (iv) (SEQ ID NO: 18) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPC PYLRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTP KVEQLENMVVKSCKCSLPXTGGG-[4,6-O-(4- vinylbenzylidene)-α,α-D-trehalose].sub.n, (v) (SEQ ID NO: 19) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPC PYLRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTP KVEQLENMWKSCKCSLPXTGGG-[Q-6-deoxy-trehalose].sub.n, wherein X is K or E, and Z3 is a glycopolymer attached to the C-terminus, and n is an integer between 15 and 50, preferably between 15 and 30.

35. The isolated peptide or peptide derivative of claim 30, optionally encapsulated or attached to a liposome or ceramide structure, for use for the topical cosmetic treatment of skin, including skin repair, rejuvenation of skin, natural skin glow, reduction of wrinkles, anti-aging of skin, and avoidance and improvement of dry, dull and rupture-prone skin.

Description

DETAILED DESCRIPTION OF THE INVENTION

[0066] The term “peptide” means according to this invention any peptide having an amino acid sequence covalently linked together by amide bonds and the term “peptide” includes expressively peptides designated otherwise as polypeptides.

[0067] The term “peptide derivative” means according to this invention any chemical molecule that comprises a peptide moiety comprising at least five amino acids covalently linked together by amide bonds, wherein said peptide is covalently linked to a non-peptide moiety. Such non-peptide moiety expressively includes organic chemical residues such as but not limited to aliphatic, aromatic, homocyclic, heterocyclic, oligomeric or polymeric moieties. In particular said non-peptide moieties include fatty acids, trehalose or trehalose-derivative containing oligomers/polymers, and conventional pharmaceutical carriers such as polyethyleneglycol.

[0068] The term “Wnt/β-catenin signaling pathway” as used herein, means the Wnt pathway that causes an accumulation of β-catenin in the cytoplasm and its eventual translocation into the nucleus to act as a transcriptional coactivator of transcription factors that belong to the TCF/LEF family.

[0069] The term “EPOR/CD131 (erythropoietin receptor/cluster of differentiation 131) receptor as used herein, means the tissue-protective EPO receptor, comprising one or more EPO receptor subunits (EPOR) and one or more cluster of differentiation 131 proteins (CD131). The cluster of differentiation 131 protein is also known as cytokine receptor common subunit β (CSF2RB) or interleukin-3 receptor common β subunit (IL3RB).

[0070] The term “matrikines” as used herein, means peptides that originate from the fragmentation of extracellular matrix (ECM) proteins and regulate cellular activities by interacting with specific receptors. In the context of this invention, said matrikines include peptides which stimulate and modulate tissue regeneration and synthesis of extracellular matrix materials in skin tissue.

[0071] The term “trigger factor complex” as used herein, means a set of peptides, peptide derivatives and/or other chemical entities that enable the human skin to harness its innate regenerative capabilities to a greater extent by modulating the skin micromilieu and modulating stem cell behaviour.

[0072] Amino acid code: for disclosure of peptide sequences, the conventional one letter amino acid code is used herein. For clarity, A denotes alanine, C cysteine, D aspartic acid, E glutamic acid, F phenylalanine, G glycine, H histidine, I isoleucine, K lysine, L leucine, M methionine, N asparagine, P proline, Q glutamine, R arginine, S serine, T threonine, V valine, W tryptophan, Y tyrosine.

[0073] TGF Beta 3 Module

[0074] TGF beta signalling is a master regulator of skin homeostasis and regeneration (Gilbert, Vickaryous, & Viloria-Petit, 2016). All TGF beta isoforms (TGF beta 1, TGF beta 2, TGF beta 3) play crucial roles in wound healing. In simple terms, however, the different isoforms act as natural counterparts. TGF beta 1 and 2 promote the migration and activation of inflammatory cells, granulation tissue formation and fibroblast to myofibroblast transition, thereby promoting scar formation. By contrast, TGF beta 3 attenuates inflammatory processes, damage-associated ECM remodelling and limits the myofibroblast phenotype. Moreover, TGF beta 3's application is not limited to macro-injuries of the skin, but also steers cellular behaviour towards pro-regeneration in micro-injured or environmentally stressed skin. Nonetheless, TGF beta action in vivo is complex and administering recombinant TGF beta 3 provides no lasting therapeutic benefit as it was indicated by the failure of a clinical phase III study of the TGF beta 3 drug Juvista (Gunter & MacHens, 2012, European Surgical Research, 49(1), 16-23).

[0075] However, this invention discloses an engineered human TGF β variant, namely TGF β3 T57K L68H S102E, as suitable agent to support healthy skin for cosmetic applications. This construct can be produced recombinantly, e.g. from stably expressing CHO cells, and has the amino acid sequence:

TABLE-US-00010 (SEQ ID NO: 7) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPY LRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTPKVEQ LENMVVKSCKCS.

[0076] Protein stability is a frequent issue for protein-based products. Many degradation pathways including chemical reactions, unfolding and aggregation contribute to loss of activity and generation of potentially harmful by-products such as immunogenic species like oligomers and higher-order assemblies. Intended use of proteins in biochemically complex mixtures such as cosmetic products poses an even greater challenge to ensure stability. Chemical species commonly used in cosmetic products including lipids thermodynamically favour the unfolded protein state exposing hydrophobic surfaces. Moreover, cosmetic products are rich in seeds for protein aggregation. In fact, recombinant TGF β3 T57K L68H S012E from mammalian expression hosts is not stable in standard cosmetic formulations for commercially compatible times. Recombinant proteins are often stabilized by excipients (Kamerzell, Esfandiary, Joshi, Middaugh, & Volkin, 2011, Advanced Drug Delivery Reviews, 63(13), 1118-1159). However, many of these excipients interfere with the cosmetic formulation at effective protein-stabilizing concentrations or interact negatively with other cosmetic ingredients. Another elegant approach to protein stabilisation is post-purification glycopolymer-conjugation independent or additional to expression-related protein glycosylation (Mancini, Lee, & Maynard, 2012, Journal of the American Chemical Society, 134(20), 8474-8479).

[0077] However, thiol-reactive conjugation is cysteine site-unspecific, thereby leading to labelling polymorphisms and moreover to labelling-induced non-functional TGF beta species and a high risk of lot-to-lot variability. This unspecific labelling can be circumvented by utilizing protein tag-based enzyme-catalysed conjugation (Falck & Müller, 2018, Antibodies, 7(1), 4.). For instance, a Sortase A-based strategy can be employed. In that strategy, the peptide motif LPXTG, with X being K or E for instance, is fused c-terminally to TGF beta 3 or any TGF beta 3 variant and has the following sequence:

[0078] [TGF β3 variant]-LPXTGGG, or specifically for TGF β3 T57K L68H S102E:

TABLE-US-00011 (SEQ ID NO: 8) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCP YLRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTPKV EQLENMVVKSCKCSLPXTGGG

[0079] This fusion protein can be produced recombinantly and purified. Protein stability can be enhanced by a glycopolymer, for instance a polyvinyl made from of 4,6-O-(4-vinylbenzylidene)-α,α-D-trehalose monomers with preferably 18 or more monomers contributing to the polymer. In one synthesis strategy, one glycopolymer terminus is chemically coupled to a GGG peptide, for instance by chemically functionalizing the polymer terminus with an amino group and formation of an amide bond with the carboxy terminus of the C-terminal glycine. This fusion construct GGG-glycopolymer can be enzymatically conjugated via a covalent bonding to a LPXTG motif of the recombinant TGF beta 3 or TGF beta 3 variant by Sortase A in a site-specific (LPXTG-specific) manner.

[0080] This results in the following fusion molecule:

[0081] [TGF beta 3 variant]-LPXTGGG-glycopolymer, or specifically for TGF beta 3 T57K L68H S102E:

TABLE-US-00012 (SEQ ID NO: 9) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCP YLRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTPKV EQLENMVVKSCKCSLPXTGGG-Z3

[0082] wherein X is K or E, and Z3 is a glycopolymer, such as a trehalose oligomer, attached to the C-terminus.

[0083] In the specific case of a polyvinyl glycopolymer made from n monomers of 4,6-O-(4-vinylbenzylidene)-α,α-D-trehalose for TGF beta 3 T57K L68H S102E the sequence is as follows:

TABLE-US-00013 (SEQ ID NO: 18) ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCP YLRSADTKHSTVLGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTPKV EQLENMVVKSCKCSLPXTGGG- [4,6-O-(4- vinylbenzylidene)-α,α-D-trehalose] .sub.n

[0084] Moreover, It is also possible to generate a glycopolymer as a (poly-)peptide by solid-phase peptide synthesis from amino acid monomers conjugated to trehalose moieties (De Bona et al., 2009, Journal of Peptide Science, 15(3), 220-228.). Solid phase peptide synthesis (SPPS) can be controlled in a stepwise manner of amino acid extension. This provides for much more control over the final product length than chemical polymerization as exemplified by the polymerization of 4,6-O-(4-vinylbenzylidene)-α,α-D-trehalose. As a result, product heterogeneity is much smaller in the SPPS-based strategy than in the chemical polymerization-based strategy. To implement such an SPPS-based strategy, a SPPS-compatible (e.g. fmoc/Boc-protected) trehalose-conjugated amino acid must be utilized. One skilled in the art will realize that there are many ways to generate such a reagent. One possibility is to covalently bond amino-functionalized trehalose to side chain carboxyl functions of fmoc-protected amino acid via chemical amidation. More specifically, 6-amino 6-deoxy trehalose (Dutta et al., 2019, ACS Central Science, acscentsci.8b00962) can be used to specifically amidate the gamma carboxyl function of alpha carboxy-protected alpha amino-protected glutamic acid. The resulting 6-deoxy trehalose-functionalized amide, a glutamine-derivative, (Q-6doTh) moiety can be used as building block for SPPS. This may require removal of its alpha carboxy protection group but retention of its alpha amino protection group, which can be achieved by chemical means. As a result a GGG-(Q-6doTh).sub.n polypeptide can be produced, wherein three N-terminal glycine residues are covalently bound to n units of 6-deoxy-trehalose-functionalized glutamines. SPPS enables great control over the number n of these 6-deoxy-trehalose-functionalized glutamines. For stabilization of TGF beta 3 derivatives a number n of 18 or greater is desirable. This trehalose-functionalized peptide can be covalently attached to a TGF beta 3 variant—LPXTG fusion by Sortase A. Such a TGF beta 3 variant—LPXTG fusion protein can be produced recombinantly and purified.

[0085] The aforementioned Sortase-mediated conjugation results in the following fusion molecule: [TGF beta 3 variant]-LPXTGGG-[Q-6doTh] n, or specifically for TGF beta 3 T57K L68H S102E:

[0086] ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTKHSTV LGLYNTHNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLENMVVKSCKCSLPXTGGG-[Q-6doTh].sub.n (SEQ ID NO: 19), wherein n is an integer between 15 and 50.

[0087] TGF beta 3 variants conjugated to the aforementioned structures containing preferably 18 or more Trehalose variant moieties are stable, e.g. unfolding-resistant and aggregation-resistant, for at least 6 months at 30° C. in standard cosmetic formulations including emulsions. In this context, unfolding-resistance is defined as >95% retention of the folded state as measured by circular dichroism (CD) spectroscopy. Aggregation-resistance is defined as low (<1%) relative abundance of oligomeric species with >4-fold the molecular weight of the monomer or more as measured by dynamic light scattering (DLS). To perform CD spectroscopy and DLS measurements on the purified protein, TGF beta 3 variants were extracted from cosmetic formulations by extensive flow chamber dialysis. Dialysis membrane pores were large enough to permit TGF beta 3 variant membrane trans-permeation. TGF beta 3 variant proteins were simultaneously concentrated from the dilute solution by affinity chromatography.

[0088] Preferred concentrations of such stabilized TGF beta 3 variants conjugates in a final cosmetic product range from 80 pM to 500 nM.

[0089] Stem Cell Homeostasis Module

[0090] Stem cells are key mediators of tissue development, homeostasis, renewal and regeneration upon insult. In turn, they are regulated by various external factors including signalling molecules, cells contacts and the extracellular matrix. One pivotal stem cell regulator in various tissues including the skin is Wnt signalling (Clevers, Loh, & Nusse, 2014, Science, 346(6205), 1248012). Wnt signalling acts on various stem cell populations in distinct niches, e.g. IFE stem cells and HF stem cells, with partly distinct roles (Choi et al., 2013, Cell Stem Cell, 13(6), 720-733). Moreover, it is crucial for homeostatic proliferation of stem cells but can be bypassed by other hyperproliferation-inducing agents during inflammation. Nevertheless, Wnt signalling generally promotes expansion of the stem cell and progenitor compartment. For instance, autocrine Wnt signalling stimulates the self-renewal of Axin2-positive basal layer stem cells in the inter-follicular epidermis (Lim et al., 2013, Science, 342(6163), 1226-1230) and the hair follicle bulge (Jaks et al., 2008, Nature Genetics, 40(11), 1291-1299; Lim, Tan, Yu, Lim, & Nusse, 2016, Proceedings of the National Academy of Sciences of the United States of America, 113(11), E1498-505). Moreover, sustained epidermal Wnt signalling can even induce ectopic hair follicles rich in stem cells. Furthermore, epithelial Wnt/β-catenin signalling influences the dermal compartment and promotes reprogramming of the dermis towards a juvenile, neonatal, state (Collins, Kretzschmar, & Watt, 2011, Development, 138(23), 5189-5199; Lichtenberger, Mastrogiannaki, & Watt, 2016, Nature Communications, 7, 1-13). Dermal effects are increased fibroblast proliferation, ECM remodelling, maturation and altered adipogenesis. In particular, epidermal Wnt/6-catenin signalling drives the expansion of the ‘pro-regeneration’ papillary fibroblast lineage (Driskell et al., 2013, Nature, 504(7479), 277-281).

[0091] Nevertheless, Wnt signalling is contextual and can aggravate pathological tissue conditions. For instance, Wnt/β-catenin is a major driver of fibrosis in various tissues including skin (Burgy & Konigshoff, 2018, Matrix Biology, 68-69, 67-80). Constitutive activation of Wnt/6-catenin even suffices to induce fibrosis in various models (Burgy & Konigshoff, 2018, Matrix Biology, 68-69, 67-80). This has precluded simple external stimulation of Wnt signalling for cosmetic purposes in the past. In particular, fibrosis manifests as dermis-associated perturbation of fibroblast to myofibroblast transition, aberrant ECM deposition and unresolved inflammation. Accordingly, a spatial separation of Wnt pathway stimulation entailing stimulation of Wnt signalling in the epidermis and absence of stimulation in the dermis could attenuate the issue of fibrosis induction. This kind of spatial control can be easily achieved in experimental model system which allow cell type-specific gene expression of a Wnt pathway-stimulating protein (Lichtenberger et al., 2016, ibid). However, this type of modulation by alteration of the host genome is not possible for routine application in medical or cosmetic products. By contrast, pharmacological stimulators of Wnt signalling are available as small molecules. However, their efficient diffusion and bioavailability within the skin upon topical administration does not permit efficient spatial control of activity. Accordingly, current small molecule Wnt stimulators may exert their activity in the epidermis but would also accumulate in the dermis at efficient concentrations and exert their activity there. Use of natural receptor agonists or their derivatives presents an unexplored hypothetical option. However, this is complicated by the complexity of Wnt agonists encompassing 19 human Wnt proteins that cross-act on at least 10 Fzd receptors and Lrp5/6 co-receptors (Janda et al., 2017, Nature, 545(7653), 234-237; Katoh, 2008, Current Drug Targets, 9(7), 565-570; Nusse & Clevers, 2017, Cell, 169(6), 985-999). Moreover, Wnt proteins classically require site-specific palmitoylation for activity, even though this can be avoided in novel artificial fusion-construct surrogate agonists (Janda et al., 2017, ibid).

[0092] This invention discloses novel entities that stimulate Wnt/β-catenin signalling and prove useful for cosmetic use. These molecules are characterised by their stability in conventional cosmetic formulations but short-ranged activity in situ, i.e. sufficient availability of the active variant in the epidermis but not the dermis.

[0093] These entities include:

TABLE-US-00014 (SEQ ID NO: 1) LNPSECPKTVLGAEYGKTLDASYSTAEAENHVRL (SEQ ID NO: 2) LNPSECPKTVLGASTSTLDASYSTAEAENHVRL

[0094] Furthermore these peptides can be modified on the N-terminus by fusing a carrier molecule Z1, thereby limiting their tissue penetration and basal membrane transpermeation. This permits the topical application of higher concentrations of the molecules without reaching effective concentrations beyond the basal membrane.

TABLE-US-00015 (SEQ ID NO: 3) (Z1)-LNPSECPKTVLGAEYGKTLDASYSTAEAENHVRL (SEQ ID NO: 4) (Z1))-LNPSECPKTVLGASTSTLDASYSTAEAENHVRL

[0095] A carrier of any size reduces the peptide's tissue penetration and basal membrane transpermeation, thereby providing a benefit. One particularly suitable carrier (Z1) is polyethyleneglycol in the range of 8-60 kDa. It can be covalently coupled to the N-terminus of the peptide using NHS-functionalised PEG. Regardless of the carrier type, Wnt-stimulating entities perform are particularly useful if the epidermis transpermeation half-lifes are higher than 740 hours, thereby allowing the application of higher doses of such entity.

[0096] The epidermis transpermeation half-life of such entities can be studied by measuring the concentration of such entities in the epidermis and dermis over time in order to generate a concentration time curve. Measurement can be performed by sampling skin punch biopsies over time, separating epidermis and dermis by surgical dissection, homogenizing and lysing the tissue specimens, enriching the entity of interest in the sample by antibody-based affinity enrichment means and subjecting the enriched sample to mass spectrometric analysis for absolute quantification.

[0097] Preferred concentrations of such carrier-conjugated Wnt agonists with an epidermis transpermeation half-life higher than 740 hours in a final cosmetic product range from 150 nM to 500 μM.

[0098] Matrikine Module

[0099] Matrikines are biologically-active naturally-occurring molecules in the skin that result from degradation of the extracellular matrix during tissue remodelling. The role of the extracellular matrix has been extensively studied in wound healing and scarring (Lo, Zimmermann, Nauta, Longaker, & Lorenz, 2012, Reviews, 96(3), 237-247; Marshall et al., 2016, Advances in Wound Care, 7(2), 29-45; Xue & Jackson, 2015, Advances in Wound Care, 4(3), 119-136). Matrikines can be generated by matrix metallo-proteases (MMP) and can likewise regulate various biological processes such as inflammation, immune cell chemotaxis, organ development, wound healing, ECM synthesis and angiogenesis (Bonnans, Chou, & Werb, 2014, Nature Reviews Molecular Cell Biology, 15(12), 786-801; Bunney, P. E., Zink, A. N., Holm, A. A., Billington, C. J., & Kotz, 2017, Physiology & Behavior, 176(205), 139-148). Alongside growth factors and cytokines, matrikines have become a third pillar of active biologics for skin conditioning in cosmetic products (Aldag, Teixeira, & Leventhal, 2016, Cosmetic and Investigational Dermatology, 9, 411-419). For instance, commercial matrikines include the peptides GHK, GEKG, KTTKS and acylated versions thereof, which have been shown to stimulate general ECM synthesis or synthesis of particular ECM proteins such as fibronectin or collagen proteins. However, many more matrikines including bigger fragments of various ECM proteins have been described and to some extent also studied in wound healing (Ricard-Blum & Salza, 2014, Experimental Dermatology, 23(7), 457-463). These include fragments from Aggrecan core protein, Proteoglycan link protein, Fibronections, Laminins, Tenascins, Syndecans, Perlecan, Elastin, Tropoelastin and various Collagens including Collagen IV alpha chains, Collagen XIII alpha chains, Collagen XII alpha chains, Collagen XXIII alpha chains, Collagen XIX alpha chains and Collagen XXV alpha chains. Collagen proteins are some of the most abundant ECM proteins and both pivotal regulators and hallmarks of the ECM state in physiological and pathological processes. For instance, both neonatal skin and non-scarring wound healing skin is known to have a high Collagen III to Collagen I abundance ratio, whereas aged skin and skin of scarring wounds is known to have a low Collagen III to Collagen I abundance ratio (Marshall et al., 2016, Advances in Wound Care, 7(2), 29-45). Furthermore, reduced amounts of collagen III have been shown to promote myofibroblast differentiation and fibrosis (Volk, Wang, Mauldin, Liechty, & Adams, 2011, Cells Tissues Organs, 194(1), 25-37). Collagen III can be degraded by matrix metalloproteases 1,2,3,8,10,13,14,16 (Sternlicht & Werb, 2001, Annual Review of Cell and Developmental Biology, 463-516). Matrix metalloprotease cleavage motifs have been identified for various MMPs and mostly roughly constitute a PXXL, PXXI, PXXV or PXXM motif (Eckhard et al., 2016, Matrix Biology, 49(2016), 37-60).

[0100] This invention discloses that the following peptides derived from Collagen type 3 alpha chain 1 (which coincide with MMP-cleavage sites at both termini in the Collagen type 3 alpha chain 1 sequence) have matrikine activity and can be used for skin wound healing and cosmetic applications:

TABLE-US-00016 (SEQ ID NO: 11) LQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG  (SEQ ID NO: 12) VKGESGKPGANGLSGERGPPGPQG

[0101] These peptides can be produced by chemical means such as solid state peptide synthesis or by digesting recombinant collagen type 3 alpha 1 protein with matrix metalloproteases. In case of the latter, these particular peptides of interest can be purified from the hydrolysate by means of liquid chromatography or by electrophoresis such as capillary electrophoresis. Nevertheless, the crude hydrolysate can also be used in cosmetic products.

[0102] Moreover, the aforementioned peptides can be acylated on the N-terminus to enhance tissue delivery:

TABLE-US-00017 (SEQ ID NO: 13) Acyl-LQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGER GPPG (SEQ ID NO: 14) Acyl-VKGESGKPGANGLSGERGPPGPQG

[0103] Acyl can refer to any unbranched fatty acid with 5-42 carbon atoms attached to the peptide via an amide bond between the carboxyl function of the fatty acid and the amino function of the peptide N-terminus, for instance an myristoylation of the peptide N-terminus

[0104] Preferred concentrations of such acylated Collagen type 3 alpha chain 1-derived peptides in a final cosmetic product range from 50 pM to 500 nM.

[0105] EPOR-CD131 Heteroreceptor Agonist Module

[0106] Agonists of the EPOR/CD131 heterodimeric or heterooligomeric receptor are tissue-protective agents (Leist, 2004, Science, 305(5681), 239-242). This receptor occurs as heterodimer or heterooligomer comprising the erythropoietin (EPO) receptor and the CD131 protein (cluster of differentiation 131, also known under the names of cytokine receptor common subunit beta or the gene name CSF2RB). However, harnessing this potential has turned out to be challenging. The natural receptor agonist, Erythropoietin, has been dropped early on as a therapeutic agent due to its side effects and other issues. Furthermore, EPOR-CD131 agonist peptide-lipid complexes and conjugates have initially presented elegant alternatives when used in conjunction with vasorelaxant agents (Bader, 2017, PCT/EP2017/001289). These agents proved beneficial in cosmetic formulations in the short term but turned out to be harmful during prolonged administration. This can largely be attributed to a chronic overstimulation of regenerative capabilities, thereby leading to exhaustion of these capabilities. On molecular and cellular level, this is associated with partial stem cell exhaustion, epigenetic changes, impaired differentiation of the progenitor cells into mature cells, and shift of stem cells towards a ‘regeneration stimulation’-refractory phenotype. As a result, use of these agents must be controlled tightly to avoid harmful secondary effects.

[0107] However, this is challenging in practice. First, responsiveness to these agents underlies genotypic variability of multiple proteins of effector signalling pathways in the population. Second, contribution to and manifestation of unwanted long-term effects depends upon the pre-existing tissue condition. Third, individual compliance of self-administration/consumption and a potential compensatory reaction to the declining effect presents a major issue. In a product testing study, some testing individuals tried to compensate a decline in product performance by applying more product or at higher application frequency. However, this even aggravated the decline. Eventually, 58.4% of testing individuals who were initially satisfied with the product experienced a decline of beneficial effects at individual time points within 9 months. Moreover 13.3% of testing individuals even reported adverse effects, i.e. apparent worsening of the skin state compared to before starting the trial.

[0108] This invention discloses novel triggering agents that act as agonists to the EPOR/CD131 heterodimeric/heterooligomeric receptor and do not elicit the unwanted long-term effects observed in previous triggering agents of the same class. This is based on two improvements over the previous agents.

[0109] The first improvement is the incorporation of a fast inactivation mechanism, that quickly inactivates the active agent in situ, i.e. when applied to the skin. This leads to a short spike in trigger agent activity when new product is applied, which immediately decays. This temporal limitation of activity leads to an only mild decrease in immediate performance of the triggering agent, but also to a significant reduction in unwanted long-term effects.

[0110] To implement such a degradation mechanism but retain storability of the product, the degradation must commence or accelerate drastically once the agent is applied. Usually the time point of application coincides with the time point of leaving the storage container. This can be harnessed in combination with the difference of physical, chemical or biological conditions between the point of application, e.g. on the skin, compared to the conditions present in the storage container. This can be harnessed according to the following strategy:

[0111] This invention discloses a novel EPOR/CD131 receptor agonist that is sensitive to oxidation by environmental oxidation agents including molecular oxygen from the air in a suitable fashion, thereby entailing a suitably fast oxidation-induced inactivation of the compound upon application. Due to lack of oxidation agents in the storage container, oxidation-induced inactivation does not take place in the storage container.

[0112] The sequence of this peptide is the following:

TABLE-US-00018 (SEQ ID NO: 5) GGGGETTNMWAREWMGLPCQDQ

[0113] This peptide can be acylated at its N-terminus to increase tissue permeability, giving rise to the following structure:

TABLE-US-00019 (SEQ ID NO: 6) Acyl-GGGGETTNMWAREWMGLPCQDQ

[0114] Acyl can refer to any unbranched fatty acid with 5-42 carbon atoms attached to the peptide via an amide bond between the carboxyl function of the fatty acid and the amino function of the peptide N-terminus, for instance an myristoylation of the peptide N-terminus. Upon product contact with air oxygen and subsequent exhaustion of anti-oxidants, the peptide methionines get oxidised to methionine sulfoxide, thereby inactivating the peptide.

[0115] The second improvement is the incorporation of an antagonist, which is also subject to an equivalent degradation. Without an antagonist, application of more product entails application of more active agent, thereby eliciting a stronger and longer stimulation. With an antagonist, application of more product entails application of both more active agent (i.e. agonist) and more antagonist at a constant ratio. As a result, the receptor activation and its downstream signalling can be constrained and made less dependent on the amount of applied product. Rather than absolute amount of agonist and antagonist, their receptor affinity and their potential to activate or inhibit the receptor, respectively, govern the total receptor activation strength. Nevertheless, the antagonist needs to be subject to a similar inactivation as the agonist does. If it did not, the antagonist would become dominant upon inactivation of the agonist. This is unwanted, as it would also inhibit basal endogenous signalling. Furthermore, the antagonist would accumulate through repeated product application, thereby increasing the ratio (i.e. imbalance in this case) of active antagonist to agonist even further.

[0116] The sequence of a suitable antagonist compound is the following:

TABLE-US-00020 (SEQ ID NO: 17) GGGGETTNMWAHDWMGLPRADQ

[0117] This peptide can be acylated at its N-terminus to increase tissue permeability, giving rise to the following structure:

TABLE-US-00021 (SEQ ID NO: 10) Acyl-GGGGETTNMWAHDWMGLPRADQ

[0118] Acyl can refer to any unbranched fatty acid with 5-42 carbon atoms attached to the peptide via an amide bond between the carboxyl function of the fatty acid and the amino function of the peptide N-terminus, for instance an myristoylation of the peptide N-terminus.

[0119] Preferred concentrations of such EPOR/CD131 agonist and antagonist peptides in a final cosmetic product range from 30 pM to 250 nM.

[0120] Limiting Fibrotic ECM Remodelling by CD26/DPP4 Inhibition

[0121] The pro-fibrotic EPF lineage is characterised by CD26 expression and inhibition of CD26 can limit scarring upon injury (Rinkevich et al., 2015, Science, 348(6232)). On cellular and molecular level, this is characterised by reduced fibrosis-associated ECM alterations and reduced myofibroblast differentiation. However, as a result of impairing the natural scarring process by CD26 inhibition wounds take longer to close and heal. Previously low-potency CD26 inhibitors such as diprotin A, a slowly hydrolysable substrate for the CD26 protease, have been used (Rinkevich et al., 2015). High potency orally available small molecule CD26/Dpp4 inhibitors exist as gliptins, however gliptins are associated with severe adverse effects (Attaway, Mersfelder, Vaishnav, & Baker, 2014, Journal of Dermatological Case Reports, 8(1), 24-28; Fisman & Tenenbaum, 2015, Sep. 29, Cardiovascular Diabetology. BioMed Central Ltd.; Nakatani et al., 2012, Diabetes Therapy, 3(1), 1-5).

[0122] This invention discloses novel CD26/Dpp4 inhibitors suitable for cosmetic application. These include:

TABLE-US-00022 (SEQ ID NO: 15) EIHQEEPIGGQSGSGG-KPI

[0123] The dash between G and K denotes an iso-peptide bond between the carboxy function of G and the epsilon amino function of lysine. Accordingly, the lysine has a free alpha-amino function.

[0124] Moreover, the peptide can be acylated to enhance tissue delivery:

TABLE-US-00023 (SEQ ID NO: 16) EIHQEEPIGGK[acyl]SGSGG-KPI

[0125] K[acyl] denotes an amide bond between the epsilon amino function of lysine and the carboxy function of a fatty acid. Acyl can refer to any unbranched fatty acid with 5-42 carbon atoms, for instance myristic acid.

[0126] Preferred concentrations of such CD26/Dpp4 inhibitor peptides in a final cosmetic product range from 500 nM to 1 mM.

[0127] Combining Signalling Modules to a Trigger Factor Complex

[0128] Single skin regeneration enhancing modules disclosed by this invention or specific molecules thereof can be used by themselves in cosmetic products with the aim of skin state improvement. Accordingly, these modules can provide a benefit independently of each other.

[0129] Nevertheless, it is desirable to combine these modules in one product, thereby unlocking synergistic positive effects on the skin state.

[0130] Combination of Molecules Disclosed in this Invention with Conventional Cosmetic Ingredients

[0131] To the cosmetic formulation further adjuvants and additives can be added to broaden or enhance the described effects of the molecules according to the invention. Such agents are, for example: pycnogenol, coenzyme Q10, ginseng extract, quercetin extract, rice bran extract, soy bean extract, algae extract, tannins, tea extract, in particular green tea extract, mustard extract, alkaloid extracts from cayenne pepper, omega-3 and omega-6 fatty acids, peptides, amino acids, vitamins, in particular vitamin E acetate, sphingolipids, ceramides, growth factors, cytokines, matrikines, vasorelaxants

[0132] Cosmetic Formulation and Molecule Delivery

[0133] The formulations of this innovation can be combined with any cosmetic formulation, for example with any cream, lotion, serum etc.

[0134] Efficacy Test Data

[0135] The inventions disclosed herein can be used in cosmetic products.

[0136] To assess the efficacy of this invention in a human skin context a one-month controlled cosmetic skin improvement study was conducted. In this assay the cosmetic facial skin appearance upon application of the cosmetic formulations containing ingredients of this invention was monitored. For that purpose, the commercially available state-of-the-art facial skin imaging and data analysis platform, the Canfield Bio Visia™, was utilized, (https://www.canfieldscicom/imaging-systems/visia-complexion-analysis/). This platform provides the possibility of a (i) highly standardized, (ii) highly reproducible, (iii) quantitative, iv) non-invasive, and (vi) subject or tester bias-free skin quality analysis. It records several photos of the face from different angles and records absorption/reflection spectra. Using these data, the platform quantifies several parameters of skin quality, including ‘spots’, ‘wrinkles’, ‘pores’, ‘smoothness’, ‘UV spots’, and ‘brown spots’. The in-built software standardizes every parameter by comparison to a large database of skin feature norms and returns a percentage value to permit inter-subject comparison. Healthy subjects received standard cosmetic base formulations with or without trigger factor complexes in a blinded manner, i.e. the subjects were unaware of the identity of the received cosmetic cream. The cosmetic base formulations contained water, caprylic triglyceride, pentylene glycol, propylene glycol, hydrogenated phosphatidylcholine, ceramides, tocopheryl acetate, sodium ascorbate, vasorelaxants, matrikines, amino acids, ethanol and glycerine. Subjects were instructed to apply the cream twice a day and on how much to apply. Subject skin quality was assessed before the start of the application and after one month (30±3 days). As a control, to account for seasonal and lifestyle change-associated skin quality changes, quality of the hand exterior surface was monitored as well. Exterior hand surface skin quality did not change statistically significantly in any subject included in the analysis, thereby indicating that the assay timeline did not correlate with any lifestyle or season-related change in overall skin quality. This study lead to the results described in the section ‘Data 1: short-term study. Furthermore, the long-term effects of cosmetic products containing the trigger factor complexes on the facial skin were studied in two long-term nine-month studies wherein product dosage and application frequency were freely chosen by testing subjects to reflect commercial reality. The cosmetic base formulations were identical to the ones used in the one-month study. Participants of the study reported subjective impressions of state of their skin, the effect of the products, and side effects at any time point during the study in regular intervals and when noticing a change. In particular, the participants reported their impressions on how the performance of cosmetic products remained unchanged or changed over the course of the study. The two studies differed in the exact trigger factor complexes used which is detailed together with the study results in the sections ‘Data 2: long-term study 1’ and ‘Data 3: long-term study 2’ below.

EXAMPLES

[0137] Cosmetic performance information for 4 trigger factor complexes (TFC8-A, TFC8-B, TFC8-C, TFC8-D) obtained in the controlled one-month study is disclosed. Molecules included in these trigger factor complexes are listed in Tables 1-4. TFC8-A and TFC8-C only differ in the molecule of the stem cell homeostasis module. Likewise, TFC8-B and TFC8-D only differ in the molecule of the stem cell homeostasis module.

[0138] Example 1: The following trigger factor complex 1 (TFC8-A) was composed:

TABLE-US-00024 TFC8-A TGF beta 3 module [TGF beta 3 T57K L68H S102E]-LPETGGG-glycopolymer, (see SEQ ID NO: 18, wherein the glycopolymer is a polyvinyl made from 18 units of 4,6-O-(4-vinylbenzylidene)-α,α-D-trehalose and X in LPXTG is E) Stem cell LNPSECPKTVLGASTSTLDASYSTAEAENHVRL homeostasis module (See SEQ ID NO: 2) EPOR/ Myristoyl-GGGGETTNMWAREWMGLPCQDQ CD131 (see SEQ ID NO: 6, wherein the peptide is myristoylated on the N-terminus agonist module and acts as agonist),and Myristoyl-GGGGETTNMWAHDWMGLPRADQ, (see SEQ ID NO: 10, wherein the peptide is myristoylated on the N-terminus and acts as antagonist) CD26/Dpp4 EIHQEEPIGGQSGSGG-KPI inhibition module (see SEQ ID NO: 15, wherein the dash denotes an isopeptide bond to the epsilon amino group of lysine) Matrikine module LQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG (see SEQ ID NO: 11), and VKGESGKPGANGLSGERGPPGPQG (see SEQ ID NO: 12)

[0139] Example 2: The following trigger factor complex 2 (TFC8-B) was composed:

TABLE-US-00025 TFC8-B TGF beta 3 module [TGF beta 3 T57K L68H S102E]-LPETGGG-(Q-6doTh).sub.18 (see SEQ ID NO: 19, wherein (Q-6doTh).sub.18 denotes a sequence of 18 6-deoxy trehalose-functionalized glutamines and X in LPXTG is E) Stem cell Z1-LNPSECPKTVLGASTSTLDASYSTAEAENHVRL homeostasis (see SEQ ID NO: 4, wherein Z1 denotes a polyethylenglycol with a molecular module weight of 35 kDa covalently coupled to the peptide N-terminus) EPOR/ Myristoyl-GGGGETTNMWAREWMGLPCQDQ CD131 (see SEQ ID NO: 6, wherein the peptide is myristoylated on the N-terminus agonist module and acts as agonist), and Myristoyl-GGGGETTNMWAHDWMGLPRADQ (see SEQ ID NO: 10, wherein the peptide is myristoylated on the N-terminus and acts as antagonist) CD26/Dpp4 EIHQEEPIGGK[Myristoyl]SGSGG-KPI inhibition module (see SEQ ID NO: 16, wherein the dash denotes an isopeptide bond to the epsilon amino group of lysine. K[Myristoyl] denotes an myristoylation at the epsilon amino group of lysine) Matrikine module Myristoyl-LQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGG- KGDAGAPGERGPPG (see SEQ ID NO: 13, wherein the peptide is myristoylated on the N-terminus) and Myristoyl-VKGESGKPGANGLSGERGPPGPQG (see SEQ ID NO: 14, wherein the peptide is myristoylated on the N-terminus)

[0140] Example 3: The following trigger factor complex 3 (TFC 8C) was composed:

TABLE-US-00026 TFC8-C TGF beta 3 module [TGF beta 3 T57K L68H S102E]-LPETGGG-glycopolymer, (see SEQ ID NO: 18, wherein the glycopolymer is a polyvinyl made from 18 units of 4,6-O-(4-vinylbenzylidene)-α,α-D-trehalose and X in LPXTG is E) Stem cell homeostasis LNPSECPKTVLGAEYGKTLDASYSTAEAENHVRL (see SEQ ID NO: 1) module EPOR/ Myristoyl-GGGGETTNMWAREWMGLPCQDQ CD131 (see SEQ ID NO: 6, wherein the peptide is myristoylated on the N- agonist module terminus and acts as agonist),and Myristoyl-GGGGETTNMWAHDWMGLPRADQ (see SEQ ID NO: 10, wherein the peptide is myristoylated on the N- terminus and acts as antagonist) CD26/Dpp4 inhibition EIHQEEPIGGQSGSGG-KPI module (see SEQ ID NO: 15, wherein the dash denotes an isopeptide bond to the epsilon amino group of lysine) Matrikine module LQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPG (see SEQ ID NO: 11) and VKGESGKPGANGLSGERGPPGPQG (see SEQ ID NO: 12)

[0141] Example 4: The following trigger factor complex 4 (TFC 8D) was composed:

TABLE-US-00027 TFC8-D TGF beta 3 module [TGF beta 3 T57K L68H S102E]-LPETGGG-(Q-6doTh).sub.18 (see SEQ ID NO: 19, wherein -(Q-6doTh).sub.18 denotes a sequence of 18 6- deoxy trehalose-functionalized glutamines and X in LPXTG is E) Stem cell Z1-LNPSECPKTVLGAEYGKTLDASYSTAEAENHVRL homeostasis (see SEQ ID NO: 3, wherein Z1 denotes a polyethylenglycol with a molecular module weight of 35 kDa covalently coupled to the peptide N-terminus) EPOR/ Myristoyl-GGGGETTNMWAREWMGLPCQDQ CD131 (see SEQ ID NO: 6, wherein the peptide is myristoylated on the N-terminus agonist module and acts as agonist), and Myristoyl-GGGGETTNMWAHDWMGLPRADQ (see SEQ ID NO: 10, wherein the peptide is myristoylated on the N-terminus and acts as antagonist) CD26/Dpp4 EIHQEEPIGGK[Myristoyl]SGSGG-KPI inhibition module (see SEQ ID NO: 16, wherein the dash denotes an isopeptide bond to the epsilon amino group of lysine. K[Myristoyl] denotes an myristoylation at the epsilon amino group of lysine) Matrikine module Myristoyl-LQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGG- KGDAGAPGERGPPG (see SEQ ID NO: 13, wherein the peptide is myristoylated on the N-terminus), and Myristoyl-VKGESGKPGANGLSGERGPPGPQG (see SEQ ID NO: 14, wherein the peptide is myristoylated on the N-terminus)

[0142] Study Results (as Specified in FIGS. 1 and 2):

[0143] Short-Term Study (FIG. 1)

[0144] The trigger factor complexes TFC8-A, TFC8-B, TFC8-C, and TFC8-D as specified above were applied in a controlled one-month cosmetic product administration study. The conditions and implementation are described in the section ‘Efficacy test data’ above. The results of that controlled one-month study are shown in FIG. 1 which depicts the percentage change of normalized “Visia” score (y-axis) in relation to seven types of skin appearances (x-axis), which are here: spots (1), wrinkles (2), UV spots (3), brown spots (4), pores (5), red vascularization (6), and smoothness (7). Skin appearances are shown for all four trigger complexes as specified (the “Visia” score test is described above, in the section Efficacy Test Data). Changes relate to the normalized difference of values (normalized value after 1 month of application—normalized value before start of application). Bars depict mean normalized changes, error bars depict standard deviations. All changes are statistically significantly (p-value <5%) different from 0. Moreover, all changes are statistically significantly (p-value <5%) different from changes observed in subjects that received the vehicle control cosmetic base formulation without any trigger factor complex. All cosmetic formulations containing trigger factor complexes lead to an improvement in skin appearance as measured by skin parameters reported by the Canfield Bio Visia device over a trial period of 30±3 days.

[0145] Long-Term Studies

[0146] Study 1: The trigger factor complexes TFC8-A, TFC8-B, TFC8-C, and TFC8-D as specified above in the ‘Examples’ section were also applied in a nine-month cosmetic product administration study. The conditions and implementation are described in the section ‘Efficacy test data’ above. Said trigger factor complexes also performed well in the first nine-month long-term administration study with product dosage and application frequency freely chosen by testing subjects indicating broad customer product applicability. All four trigger factor complexes were associated with low risks of stem cell regeneration overstimulation and subsequent exhaustion. Overall, only 7.2% of testing subjects reported a decline of product performance and only 1.6% of testing subjects reported an apparent worsening of the subjectively perceived skin state within the testing period. No significant adverse effects were reported.

[0147] Study 2 (FIG. 2): To further investigate the role of the molecules of the stem cell homeostasis module of the trigger factor complex on the effect of long-term product administration on the skin state, another nine-month long-term study was conducted. The conditions and implementation are described in the section ‘Efficacy test data’ above. To ensure comparability and specifically investigate the four peptides of the stem cell homeostasis module (SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4), these four peptides were tested in conjunction with the same set of molecules of the other modules as specified by the trigger factor complex TFC8-D above in the ‘Examples’ section. As before, the carrier in the peptide derivatives SEQ ID NO: 3 and SEQ ID NO: 4 was a polyethyleneglycol with a molecular weight of 35 kDa. This second long-term study revealed that the stem cell homeostasis module molecules were differentially associated with the decline of product performance over the course of the study. The frequency of reported product performance decline associated for each of the four peptides are shown in Fici. 2. Error bars represent the 95% confidence intervals of the observed frequency.

[0148] Overall, the amino acid sequence of SEQ ID NO: 2, contained also in SEQ ID NO: 4, was more strongly associated with a decline in product performance during the study period than the sequence of SEQ ID NO: 1, contained also in SEQ ID NO: 3. These differences were statistically significant (p-value <5%). Secondly, the polyethyleneglycol carrier moderately reduced the frequency of product performance decline in case of both amino acid sequences. Accordingly, the frequency was lower for SEQ ID NO: 3 than for SEQ ID NO: 1 and lower for SEQ ID NO: 4 than for SEQ ID NO: 2.