ADMINISTRATION OF CALCIUM CHANNEL TRPC6 INHIBITORS USING BALLOONS, STENTS OR OTHER MEDICAL DEVICES
20230137816 · 2023-05-04
Inventors
- Heribert Schunkert (Orange, CT, US)
- Adnan Kastrati (New Haven, CT, US)
- Thorsten Kessler (Munchen, DE, US)
Cpc classification
A61K31/4545
HUMAN NECESSITIES
A61L2300/216
HUMAN NECESSITIES
A61K31/501
HUMAN NECESSITIES
A61L2300/416
HUMAN NECESSITIES
A61L29/16
HUMAN NECESSITIES
A61K31/5386
HUMAN NECESSITIES
A61L31/16
HUMAN NECESSITIES
A61K31/27
HUMAN NECESSITIES
A61K31/496
HUMAN NECESSITIES
A61K31/46
HUMAN NECESSITIES
A61K31/454
HUMAN NECESSITIES
A61K31/451
HUMAN NECESSITIES
International classification
A61K31/451
HUMAN NECESSITIES
A61K31/27
HUMAN NECESSITIES
A61K31/454
HUMAN NECESSITIES
A61K31/4545
HUMAN NECESSITIES
A61K31/46
HUMAN NECESSITIES
A61K31/496
HUMAN NECESSITIES
A61K31/4995
HUMAN NECESSITIES
A61K31/501
HUMAN NECESSITIES
A61K31/5386
HUMAN NECESSITIES
A61L29/16
HUMAN NECESSITIES
A61L31/16
HUMAN NECESSITIES
Abstract
The present invention relates to a medical device suitable for being inserted into the lumen of an anatomic structure of a subject, said medical device comprising means for administration of TRPC6 inhibitor, wherein said means comprises the TRPC6 inhibitor. The present invention further concerns a method of manufacturing a medical device suitable for being inserted into the lumen of an anatomic structure of a subject. Also, the invention relates to a TRPC6 inhibitor for use in the treatment or prevention of a disease associated with neointimal hyperplasia associated with the migration of smooth muscular cells. The invention also relates to a method of treating or preventing a disease associated with neointimal hyperplasia, said method comprising administering a TRPC6 inhibitor to a subject in need thereof. Also envisaged is a method of inhibiting migration of smooth muscle cells. The invention additionally relates to an in vitro test kit comprising: (a) small muscle cells (SMCs); (b) a surface suitable for SMC cultivation coated with a TRPC6 inhibitor. Also concerned is a pharmaceutical composition comprising a TRPC6 inhibitor and a pharmaceutically acceptable carrier.
Claims
1. A medical device suitable for being inserted into a lumen of an anatomic structure of a subject, said medical device comprising means for administration of a TRPC6 inhibitor, wherein said means comprises the TRPC6 inhibitor.
2. The medical device of claim 1, wherein the medical device is a catheter.
3. The medical device of claim 1, wherein the medical device is selected from the group consisting of a stent, a balloon, microcatheter or bioabsorbable scaffold,
4. The medical device of claim 1, wherein the lumen of the anatomic structure is a lumen of a blood vessel, the esophagus, trachea or urethra.
5. The medical device of claim 1, wherein the subject is a mammal.
6. The medical device of claim 1, wherein said means is a coating of the medical device.
7. The medical device of claim 1, wherein the coating further comprises a polymer.
8. The medical device of claim 1, wherein the TRPC6 inhibitor has the following formula (I): ##STR00351## wherein: R.sup.(I)1 and R.sup.(I)2 are each independently selected from the group consisting of halogen (preferably F, Cl, or Br), —CN and —NO.sub.2; and N.sup.(I) is 0, 1 or 2; or a pharmaceutically acceptable salt, solvate or hydrate thereof
9. A method of manufacturing a medical device suitable for being inserted into a lumen of an anatomic structure of a subject, wherein the method comprises contacting a surface of the medical device with a coating composition comprising a TRPC6 inhibitor.
10-15. (canceled)
16. The medical device of claim 1, wherein the lumen of the anatomic structrue is a lumen of a blood vessel.
17. The medical device of claim 1, wherein the subject is a human.
18. The medical device of claim 1, wherein the coating further comprises a solvent.
19. The medical device of claim 1, wherein the TRPC6 inhibitor is ##STR00352## or a pharmaceurically acceptable salt, solvent or hydrate thereof.
20. The medical device of claim 1, (a) wherein the TRPC6 inhibitor has the following formula (II): ##STR00353## wherein: R.sup.(II)1 and R.sup.(II)2 are each independently selected from the group consisting of —OH, ##STR00354## or a pharmaceutically acceptable salt, solvate or hydrate thereof; (b) wherein the TRPC6 inhibitor has the following formula (III): ##STR00355## wherein: R.sup.(III)1 is independently selected from the group consisting ##STR00356## R.sup.(III)2 is independently selected from the group consisting of —H, —CH.sub.3 and halogen (preferably F, Cl, Br); and R.sup.(III)3 is independently selected from the group consisting of ##STR00357## or a pharmaceutically acceptable salt, solvate or hydrate thereof; (c) wherein the TRPC6 inhibitor has the following formula (IV): ##STR00358## wherein: L.sup.(IV) is absent or is methylene or ethylene; Y.sup.(IV) is CH or N; A.sup.(IV) is CH or N; R.sup.(IV)1 is selected from the group consisting of: C.sub.1-6alkyl optionally substituted with I to 3 groups independently selected from the group consisting of halo, C3-6cycloalkyl and OC.sub.3-6cycloalkyl; phenyl optionally substituted with 1 to 3 groups independently selected from the group consisting of CF.sub.3, halo, C.sub.3-6cycloalkyl, OC.sub.3-6cycloalkyl, OC.sub.1-6alkyl optionally substituted with one to three halo; and C.sub.3-6cycloalkyl optionally substituted with 1 to 3 groups independently selected from the group consisting of halo and C.sub.1-6alkyl optionally substituted with 1 to 3 halo; R.sup.(IV)2 is selected from the group consisting of H, C.sub.1-6alkyl, OCF.sub.3, C.sub.3-6cycloalkyl, OC.sub.1-6alkyl; OC.sub.3-6cycloalkyl; R.sup.(IV)3 is selected from the group consisting of H, C.sub.1-6alkyl, C.sub.3-6cycloalkyl, OC.sub.3-6cycloalkyl; wherein each of the C.sub.1-6alkyl, C.sub.3-6cycloalkyl, OC.sub.3-6cycloalkyl of the R.sup.(IV)3 group may be optionally substituted with one to three groups each independently selected from the group consisting of halo, OH, SC.sub.1-6alkyl, N(C.sub.1-6alkyl).sub.2; and wherein one to three carbon atoms of the C.sub.1-6alkyl of the R.sup.(IV)3 group may optionally be replaced by one or two moieties selected from the group consisting of NH, (NC.sub.1-6alkyl), O, and S; R.sup.(IV)4 and R.sup.(IV)5 are each independently selected from the group consisting of H or C.sub.1-6alkyl; R.sup.(IV)3 and R.sup.(IV)4 can together with the atom to which they are attached join to form a 3 to 9-membered carbocyclyl ring which optionally may contain one to three heteroatoms selected from the group consisting of N, O, and S; or R.sup.(IV))3 and R.sup.(IV)5 can together form a 3 to 9-membered bicyclic ring which optionally may contain one to three heteroatoms selected from the group consisting of N, O, and S; R.sup.(IV)6 is selected from the group consisting of H, C.sub.1-6alkyl, CN, CF.sub.3, OCF.sub.3, C.sub.3-6cycloalkyl, OC.sub.1-6alkyl, and OC.sub.3-6cycloalkyl; R.sup.(IV)7 is selected from the group consisting of H and OC.sub.1-6alkyl; or a pharmaceutically acceptable salt, solvate or hydrate thereof; or (d) wherein the TRPC6 inhibitor has the following formula (V): ##STR00359## wherein: Y.sup.(V) is CH or N; A.sup.(V) is CH or N; R.sup.(V) is H, C.sub.1-3-alkyl, or OC.sub.1-3alkyl, R.sup.(V)2 is H, C.sub.1-3alkyl or C.sub.3-6cycloalkyl wherein each of the C.sub.1-3alkyl or C.sub.3-6cycloalkyl of the R.sup.2 group may be optionally substituted with OH, halo or OC.sub.1-3alkyl; R.sup.(V)3 is H or C.sub.1-3alkyl; R.sup.(V)2 and R.sup.(V)3 together with the carbon to which they are attached may optionally join to form a 3- to 6-membered carbocyclic ring; R.sup.(V)4 represents C.sub.1-6alkyl which may optionally be substituted with one to three groups independently selected from the group consisting of halo, C.sub.3-6cycloalkylmethyl and C.sub.3-6cycloalkylethyl, where the C.sub.3-6cycloalkyl of the C.sub.3-6cycloalkylmethyl and C.sub.3-6cycloalkylethyl may optionally be substituted with one to three groups independently selected from the group consisting of halo and methyl, 1,2,3-thiadiazoylmethyl, thiazoylmethyl, isoxazolylmethyl or a group of formula ##STR00360## wherein n.sup.(V) is 0 or 1; R.sup.(IV)5 is selected from the group consisting of H, halo, CF.sub.3, OCF.sub.3, CN, C.sub.1-3alkyl, OC.sub.1-3alkyl, C.sub.3-6cycloalkyl; wherein each of the C.sub.1-3alkyl and OC.sub.1-3alkyl of the R.sup.(V)5 groups may optionally be substituted with one to three groups each independently selected from the group consisting of halo, oxo, NH.sub.2, NH(C.sub.1-3alkyl), and N(C.sub.1-3alkyl).sub.2; R.sup.(V)6 is selected from the group consisting of H, halo, C.sub.1-3alkyl, and OC.sub.1-3alkyl; wherein R.sup.(V)5 and R.sup.(V)6 may join to form a 5- or 6-membered carbocyclic ring wherein one or two carbon atoms of the 5- or 6-membered carbocyclic ring may optionally be replaced by one or two oxygen atoms; R.sup.(V)7 is selected from the group consisting of H, halo, C.sub.1-3alkyl and OC.sub.1-3alkyl, wherein the C.sub.1-3alkyl of the R.sup.(V)7 group may optionally be substituted with one to three substituents selected from the group consisting of halo; R.sup.(V)8 is selected from the group consisting of H and halo; R.sup.(V)9 is H or C.sub.1-3alkyl; wherein R.sup.(V)2 and R.sup.(V)9 may join to form a bicyclic ring; R.sup.(V)10 is H or C.sub.1-3alkyl; or a pharmaceutically acceptable salt, solvate or hydrate thereof.
21. A method of treating or preventing a disease associated with neointimal hyperplasia, wherein the neointimal hyperplasia is associated with the migration of smooth muscular cells, said method comprising administering a TRPC6 inhibitor to a subject in need thereof.
22. The method of claim 21, comprising inhibiting the migration of smooth muscle cells (SMCs).
23. The method of claim 21, wherein the TRPC6 inhibitor is administered systemically.
24. The method of claim 21, wherein the TRPC6 inhibitor is administered via a medical device, said medical device comprising means for administration of the TRPC6 inhibitor.
25. The method of 21, wherein the disease is stenosis or restenosis.
26. The method of claim 25, wherein the stenosis or restenosis is stenosis or restenosis of a blood vessel.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0016] The Figures show:
[0017]
[0018]
[0019]
[0020]
DETAILED DESCRIPTION
[0021] The inventors of the present invention show that migration of vascular smooth muscle cells (VSMCs) is a hallmark of neointima formation. Further, the inventors found that increased Trpc6 (Transient receptor potential cation channel, subfamily C, member 6) protein level and, subsequently, activity is a molecular correlate of the initiation of SMC migration/proliferation and neointima (hyperplasia) formation.
[0022] Specifically, the inventors surprisingly found that Trpc6−/− mice display a reduced neointima area (1.90±0.27 vs. 2.82±0.28, p=0.03) and neointima/media ratio (1.44±0.15 vs. 2.16±0.18, p=0.01) compared to wildtype mice upon wire injury (
[0023] To further confirm data, human aortic vascular smooth muscle cells (VSMC) were cultured in a culture dish coated with SAR7334—an TRPC6 inhibitor. Afterwards, the local migration was analyzed in comparison to a control cell culture not contacted with the TRPC6 inhibitor. The culture in contact with the TRPC6 inhibitor has a reduced local migration than the control culture. This again indicates that TRPC6 inhibitors reduce migration of VSMCs (
[0024] In a further experiment the inventors performed a scratch wound assay in which a confluent layer of human aortic VSMCs is “injured” by a scratch. The cells were either treated with OAG—an activator of TRPC6 or SAR 7334—an inhibitor of TRPC6. The treatment with the TRPC6 activator (OAG) leads to an increase in wound reclosure secondary to vascular injury compared to vehicle treatment after eight and 12 hours (vehicle 69.05±7.03 vs. OAG 93.09±3.67 [10.sup.3 pixels], p=0.01 and vehicle 156.93±7.06 vs. OAG 179.14±3.61 [10.sup.3 pixels], p=0.01, respectively;
[0025] On the other hand, the TRPC6 inhibitor SAR7334 reduces VSMC migration after 12 hours (111.4±15.5 vs. 130.0±10.6 [10.sup.3 pixels], p=0.04;
[0026] Therefore, the administration of a TRPC6 inhibitor to previously injured VSMCs keeps the migration capacity of VSMCs at control levels (6 and 8 hours after injury) or even reduces it (12 hours after injury). Thus, this experiment shows that TRPC6 inhibitors promote normal neointimal formation after injury, while reducing the risk of neointimal hyperplasia, which ultimately can lead to a stenosis or restenosis.
[0027] That TRPC6 is indeed associated with an increased risk of restenosis after coronary stenting is shown in
[0028] Furthermore, immunoblotting of proteins secondary to wire injury confirmed highest Trpc6 protein levels at three days after vascular injury with a subsequent reduction at seven and 14 days. Therefore, Trpc6 expression is restricted to the early phase after vascular damage. In undamaged vessels and at later points in time after damage, Trpc6 expression is below the detection limit (
[0029] In summary, the inventors have found that by inhibiting TRPC6 the migration of SMCs can be controlled/decreased. A TRPC6 inhibitor can thus be used in reduction of the occurrence or risk of neointimal hyperplasia/stenosis and/or restenosis.
[0030] To the knowledge of the authors to reduce the risk of neointima formation after stenting, mTOR inhibitor (e.g. rapamycine) coated stents are regularly used to locally inhibit SMC proliferation (A. Kalra et al., New-Generation Coronary Stents: Current Data and Future Directions. Curr Atheroscler Rep 19, 14 2017). However, mTOR inhibition is not specific for proliferating SMCs of the neointima, but affects all cells in the surrounding. In addition, current drug-eluting stents reveal certain safety concerns, as due to delayed healing they are linked to an increased risk of thrombosis E. Camenzind, P. G. Steg, W. Wijns, Stent thrombosis late after implantation of first-generation drug-eluting stents: a cause for concern. Circulation 115, 1440-1455; discussion 1455 2007; A. V. Finn et al., Vascular responses to drug eluting stents: importance of delayed healing. Arterioscler Thromb Vasc Biol 27, 1500-1510 2007; T. F. Luscher et al., Drug-eluting stent and coronary thrombosis: biological mechanisms and clinical implications. Circulation 115, 1051-1058 2007). If thrombosis develops it further needs to be counteracted by the prolonged administration of platelet inhibitors.
[0031] Compared to the use of mTOR inhibitors when utilizing TRPC6 inhibitors for treating or preventing neointimal hyperplasia/stenosis and/or restenosis a) a different aspect of neointimal hyperplasia/stenosis and/or restenosis formation is targeted (migration of SMCs vs. proliferation of SMCs) and b) lower side effects are to be expected.
[0032] Accordingly, the present invention relates to a medical device suitable for being inserted into the lumen of an anatomic structure of a subject, said medical device comprising means for administration of a TRPC6 inhibitor, wherein said means comprises the TRPC6 inhibitor. The term medical device, as used herein is any device intended to be used for medical purposes. The medical device is suitable for being inserted into the lumen of an anatomic structure. In particular, the medical device according to the invention can be inter alia be inserted into canals, vessels, passageways, or body cavities. The medical device can for example be a catheter, stent, a balloon, a microcatheter, or a bioabsorbable scaffold.
[0033] It is thus envisioned that the medical device can be a catheter.
[0034] The term catheter, as used herein, refers to any suitable catheter. Catheters are known to the skilled person. A catheter may be a tubular medical device suitable for insertion into the lumen of an anatomical structure, e.g. esophagus, trachea, urethra, or a blood vessel. Preferably, the catheter is suitable for insertion into the lumen of a blood vessel, more preferably the lumen of an artery. Also, the catheter may be suitable for insertion into the lumen of the esophagus. The catheter may be suitable for insertion into the lumen of the trachea. The catheter may be suitable for insertion into the lumen of the urethra. A catheter may permit injection or withdrawal of fluids, or may only be used in order to keep the lumen of an anatomical structure open.
[0035] It is also contemplated that the medical device can be a stent or a balloon.
[0036] The term balloon, as used herein refers to any suitable balloon. Balloons are known to the skilled person and inter alia described by Li et al. (2019) “Drug-coated balloon versus drug-eluting stent in de novo small coronary vessel disease: A systematic review and meta-analysis.” Medicine (Baltimore); 98(21):e15622. A balloon may be a small bag that can be inflated with e.g. air or gas. The balloon can be inserted into the lumen of an anatomic structure, such as oesophagus, trachea, urethra, blood vessel, and then be inflated with e.g. air or gas in order to keep the lumen open. Preferably, the balloon can be inserted into the lumen of a blood vessel, more preferably the lumen of an artery. Also, the balloon can be inserted into the lumen of the esophagus. The balloon can be inserted into the lumen of the trachea. The balloon can be inserted into the lumen of the urethra. The balloon can also be made of plastic.
[0037] The medical device can be a stent.
[0038] The term stent, as used herein, refers to any suitable stent. Stents are known to the skilled person and inter alia described by Htay and Liu (2005) “Drug eluting stent: a review and update” Vasc Health Risk Manag. 2005;1(4):263-76. Also stents for e.g. the oesophagus are known and are inter alia described in Kang (2019) “A Review of Self-Expanding Esophageal Stents for the Palliation Therapy of Inoperable Esophageal Malignancies” BioMed Research International volume 2019, Article ID 9265017, 11 pages. Stents for the trachea and laropharyinx are known and inter alia described by Dipak et al. (2005) “Tracheal stent in the treatment of tracheal stenosis” The Medical Journal of Malaysia 60(4):498-501 and stents for the urethra are also known and inter alia described by Eisenberg et al. (2007) “Preservation of Lower Urinary Tract Function in Posterior Urethral Stenosis: Selection of Appropriate Patients for Urethral Stents” Journal of Urology, volume 178, issue 6, page: 2456-2461.
[0039] The stent may be a short narrow tube. The stent may be of any suitable material. For example, the stent may be of metal (e.g. stainless steel, cobalt, chromium, nickel-titanium shape memory alloy (nitinol), and titanium or alloys comprising or consisting of these; examples of such alloys are titanium—or cobalt/chromium-based alloys) or plastic. The stent may be a microporous stent, e.g. a microporous coronary stent, e.g. made of metal. A stent can also be in the form of a mesh. Stents can be inserted into the lumen of an anatomical structure such as esophagus, trachea, urethra, blood vessel, and can be used to keep a previously blocked lumen open. Preferably, the stent can be inserted into the lumen of a blood vessel, more preferably the lumen of an artery. Also, the stent can be inserted into the lumen of the esophagus. The stent can be inserted into the lumen of the trachea. The stent can be inserted into the lumen of the urethra.
[0040] A stent can have virtually any structural pattern that is compatible with a bodily lumen in which it is implanted. For example, a stent can be composed of a pattern or network of circumferential and longitudinally extending interconnecting structural elements or struts. In general, the struts are arranged in patterns, which are designed to contact the lumen walls of a vessel and to maintain vascular patency.
[0041] The medical device may also be a biodegradable scaffold. The biodegradable scaffold may be any suitable biodegradable scaffold. Biodegradable scaffolds are temporary scaffold (implants) that may reabsorb over time. Biodegradable scaffolds are known to the skilled person and inter alia described in Omar and Kumbhani (2019) “The Current Literature on Bioabsorbable Stents: a Review” Current Atherosclerosis Reports volume 21, Article number: 54. They are indicated for example for improving coronary luminal diameter in patients with ischemic heart disease due to de novo native coronary artery lesions. An example for such biodegradable scaffold is Magmaris, from Biotronik. The biodegradable scaffold can be inserted into the lumen of an anatomical structure such as esophagus, trachea, urethra, blood vessel. Preferably, the biodegradable scaffold can be inserted into the lumen of a blood vessel, more preferably the lumen of an artery. Also, the biodegradable scaffold can be inserted into the lumen of the esophagus. The biodegradable scaffold can be inserted into the lumen of the trachea. The biodegradable scaffold can be inserted into the lumen of the urethra.
[0042] The medical device may also be a microcatheter. A microcatheter as used herein may be any suitable microcatheter. Microcatheter are known to the skilled person and inter alia described by Karalis et al. (2017) “Microcatheters: A valuable tool in the presence of a challenging coronary anatomy in the setting of acute coronary interventions. Case report and mini review” Cardiovascular Revascularization Medicine; volume 18, issue 6, supplement 1, pages 48-51 and Vemmou et al. (2019) “Recent advances in microcatheter technology for the treatment of chronic total occlusions” Expert Review of Medical Devices , volume 16, 2019, issue 4, pages 267-273. The microcatheter can be inserted into the lumen of an anatomical structure such as esophagus, trachea, urethra, blood vessel. Preferably, the microcatheter can be inserted into the lumen of a blood vessel, more preferably the lumen of an artery. Also, the microcatheter can be inserted into the lumen of the esophagus. The microcatheter can be inserted into the lumen of the trachea. The microcatheter can be inserted into the lumen of the urethra.
[0043] Therefore, according to the invention, the medical device as defined herein allows, upon its insertion into the lumen of an anatomical structure, to hold the lumen of said anatomical structure open. In particular, the medical device may allow for passage of air or liquid through the lumen of the anatomical structure.
[0044] The term lumen, as used herein, refers to any suitable lumen of an anatomical structure of a subject. For example, the lumen may be the inside space of a tubular anatomical structure. The lumen may be a canal that allows for liquid, food or gas/air passage. In particular, the lumen of the anatomic structure may be the lumen of a blood vessel, the trachea, the esophagus or urethra. Preferably, the lumen is the lumen of a blood vessel, more preferably the lumen of an artery. Also, the lumen may be the lumen of the esophagus. The lumen may be the lumen of the trachea. The lumen may be the lumen of the urethra.
[0045] An anatomical structure as used herein may be any anatomical structure. For example, the anatomical structure may be the esophagus, trachea, urethra or blood vessels. Preferably, the anatomic structure is a blood vessel. More preferably, the blood vessel may be an artery. Also, the anatomical structure may be the esophagus. The anatomical structure may be the trachea. The anatomical structure may be the urethra.
[0046] The invention envisages that the medical device is inserted in the lumen of an anatomical structure of a subject. A “subject” as used herein may be any suitable subject. Preferably, the term “subject” as used herein refers to a mammal. The subject may be a dog, cat, horse, sheep, goat, cattle or a human subject, preferably a human subject.
[0047] Restenosis is the recurrence of stenosis after a procedure. As used herein stenosis may refer to any stenosis.
[0048] Stenosis is an abnormal narrowing in a blood vessel or other tubular organs or anatomic structures of a subject. Restenosis is the re-occurrence of stenosis.
[0049] Accordingly, the stenosis and/or restenosis may be a stenosis and/or restenosis of blood vessels, esophagus, trachea or urethra. Preferably, the stenosis and/or restenosis is a stenosis and/or restenosis of a blood vessel, more preferably of an artery. Also, the stenosis and/or restenosis may be a stenosis and/or restenosis of the esophagus. The stenosis and/or restenosis may be a stenosis and/or restenosis of the trachea. The stenosis and/or restenosis may be a stenosis and/or restenosis of the urethra. Therefore, the subject may also be a subject that has been afflicted with stenosis and/or restenosis. More specifically, the subject may also be a subject has been or is affected by or at risk of stenosis and/or restenosis of blood vessels, esophagus, trachea or urethra. Preferably, the subject is a subject that has been or is affected by or at risk of stenosis and/or restenosis of a blood vessel, more preferably of an artery. In a merely illustrative and non-limiting example, stenosis and/or restenosis may refer to a lumen reduction of ≥50% of a blood vessel, other tubular organ or anatomic structure (e.g. esophagus, trachea, or urethra) compared to the lumen of the of said blood vessel, other tubular organ or anatomic structure (e.g. esophagus, trachea, or urethra) not affected by stenosis and/or restenosis. The stenosis and/or restenosis may also be a blood vessel stenosis and/or restenosis such as a vascular stenotic lesion or a stenosis and/or restenosis in heart valves. Thus, the subject may also have been or may be afflicted with or be at risk of a vascular stenotic/restenotic lesion or a stenosis and/or restenosis in heart valves.
[0050] The vascular stenotic/restenotic lesion can be any vascular stenotic/restenotic lesion. Non-limiting examples include peripheral artery stenosis/restensois, coronary artery stenosis and/or restenosis, carotid artery stenosis and/or restenosis which may predispose to (strokes and transient ischemic episodes) or renal artery stenosis and/or restenosis. Thus, the subject may also be have been or may be afflicted with or be at risk of peripheral artery stenosis and/or restenosis, coronary artery stenosis and/or restenosis or renal artery stenosis and/or restenosis.
[0051] The stenosis and/or restenosis may also be a stenosis and/or restenosis in heart valves. The stenosis in heart valves can be any stenosis and/or restenosis in heart valves. Examples of a stenosis in heart valves includes the pulmonary valve stenosis and/or restenosis (thickening of the pulmonary valve, therefore causing narrowing), mitral valve stenosis and/or restenosis (thickening of the mitral valve (of the left heart), therefore causing narrowing), tricuspid valve stenosis and/or restenosis (thickening of the tricuspid valve (of the right heart), therefore causing narrowing), aortic valve stenosis and/or restenosis (thickening of the aortic valve, therefore causing narrowing).
[0052] An aortic stenosis and/or restenosis is a narrowing (stenosis) of the aortic valve, the valve between the left ventricle of the heart and the aorta. This narrowing impedes the delivery of blood to the body through the aorta and makes the heart work harder.
[0053] Thus, the subject may also have been or may be afflicted with or be at risk of a stenosis of heart valves such as pulmonary valve stenosis and/or restenosis, mitral valve stenosis and/or restenosis, tricuspid valve stenosis and/or restenosis, aortic valve stenosis and/or restenosis, preferably the subject may also be afflicted with or be at risk of aortic valve stenosis and/or restenosis.
[0054] Stenosis may also be a stenosis and/or restenosis of the esophagus. Smooth muscle cells also seem to play a role in esophageal stenosis (Jeng et al. (2003) “Restenosis following balloon dilation of benign esophageal stenosis” World J Gastroenterol. 2003 Nov. 15; 9(11): 2605-2608 and Oue and Puri (1999) “Smooth Muscle Cell Hypertrophy versus Hyperplasia in Infantile Hypertrophic Pyloric Stenosis” Pediatric Research, volume 45, pages 853-857). Thus, it is plausible that TRPC6 signaling is also involved in SMC migration in esophageal stenosis and restenosis. Esophagal stenosis and/or restenosis is known to the skilled person. Non-limiting examples include pyloric stenosis and/or restenosis or esophageal stricture.
[0055] Thus, the subject may also have been or may be afflicted with or be at risk of pyloric stenosis and/or restenosis or esophageal stricture.
[0056] As used herein a pyloric stenosis is a narrowing of the opening from the stomach to the first part of the small intestine (the pylorus). Symptoms include projectile vomiting without the presence of bile.
[0057] Stenosis and/or restenosis may also be a stenosis and/or restenosis of the trachea. Smooth muscle cells also seem to play a role in tracheal stenosis (Wang et al. (2016) “Paclitaxel Drug-eluting Tracheal Stent Could Reduce Granulation Tissue Formation in a Canine Model”;129(22): 2708-2713). Thus, it is plausible that TRPC6 signaling is also involved in SMC migration in tracheal stenosis and restenosis. Such stenosis and/or restenosis are known to the skilled person. Non-limiting examples include subglottic stenosis or larygotracheal stenosis and/or restenosis.
[0058] Thus, the subject may also have been or may be afflicted with or be at risk of subglottic stenosis or larygotracheal stenosis and/or restenosis. As used herein a subglottic stenosis and/or restenosis is a congenital or acquired narrowing of the subglottic airway. A laryngotracheal stenosis and/or restenosis refers to abnormal narrowing of the central air passageways. This can occur at the level of the larynx, trachea, carina or main bronchi.
[0059] Stenosis and/or restenosis may also be a stenosis and/or restenosis of the urethra. Smooth muscle cells also seem to play a role in urethral stenosis (Will et al. (2011) “Paclitaxel Inhibits Ureteral Smooth Muscle Cell Proliferation and Collagen Production in the Absence of Cell Toxicity”, pages 335-340. Thus, it is plausible that TRPC6 signaling is also involved in SMC migration in urethral stenosis and restenosis. Urethral stenosis and/or restenosis is known to the skilled person. Non-limiting examples include urethral meatal stenosis and/or restenosis.
[0060] As used herein urethral meatal stenosis and/or restenosis may be any urethral meatal stenosis and/or restenosis. It refers to a narrowing (stenosis) of the opening of the urethra at the external meatus thus constricting the opening through which urine leaves the body from the urinary bladder.
[0061] Thus, the subject may also have been or be afflicted with or be at risk of urethral meatal stenosis and/or restenosis.
[0062] Restenosis can inter alia pertain to an artery or other large blood vessel, but also uretha, trachea and esophagus that has become narrowed (suffered from stenosis), received treatment to clear the stenosis e.g. insertion of a suitable stent and subsequently become renarrowed (restenosis). This is usually restenosis of an artery, or other blood vessel, or possibly a vessel within an organ. Accordingly, restenosis preferably refers to restenosis of a blood vessel, more preferably an artery. Restenosis may also refer to restenosis of the esophagus. Restenosis may also refer to restenosis of the trachea. Restenosis may also refer to restenosis of the urethra. Preferably, the subject is a subject have been or may be afflicted with or at risk of restenosis. The subject may also be a subject that has undergone angioplasty.
[0063] In particular, in the context of the invention the restenosis can be caused by neointima hyperplasia following therapeutic procedures such e.g. inserting a medical device such as a stent in the lumen of the anatomical structure affected by stenosis. Procedures frequently used to treat the vascular damage from narrowing and renarrowing (stenosis) of blood vessels are known to the skilled person and include vascular surgery, cardiac surgery, and angioplasty (Corriere et al. (2009) “Restenosis after renal artery angioplasty and stenting: Incidence and risk factors” J Vasc Surg. 50(4): 813-819.e1.
[0064] For example, restenosis may occur after angioplasty. In case restenosis occurs after balloon angioplasty it is called a post-angioplasty restenosis (PARS). Thus, the subject may also be a subject at risk of developing or afflicted with PARS.
[0065] Thus, restenosis may be an in-stent restenosis or ISR, occurring after vascular, tracheal, eosophagal or urethreal surgery, wherein a medical device such as a stent is employed, and where restenosis occurs afterwards. Thus, the subject may be a subject that has undergone stent therapy.
[0066] The presence of restenosis can be measured by methods known to the skilled artisan, for example follow-up imaging such as angiography or duplex ultrasound. These techniques allow identifying proliferating and/or migrating cells forming neointima or visualize the lumen of an anatomic structure. Angiography techniques allow visualizing the lumen of blood vessels or other anatomical structures. This is traditionally done by injecting a radio-opaque contrast agent into the blood vessel and imaging using X-ray based techniques such as fluoroscopy.
[0067] Duplex ultrasound employs the Doppler effect to generate imaging of the movement of tissues and body fluids (usually blood), and their relative velocity. This technique can allow therefore to evaluate, for example, whether the lumen of a blood vessel is undergoing restenosis based on the movement and velocity of blood flowing through it. Restenosis can also be individuated or diagnosed based on symptoms, such as recurrent chest pain (angina) or major heart attack (myocardial infarction).
[0068] Accordingly, the subject in the context of the invention may be a s subject at risk of or afflicted with vascular injury. Vascular injuries are known to the skilled person and inter alia described by Wani et al. (2012) “Vascular Injuries: Trends in Management” Trauma Mon.;17(2):266-9. Vascular injuries may be divided into following groups: spasm, thrombosis, contusion/Intimal flap, laceration/transection, A-V (arteriovenous) fistula, aneurysm and pseudoaneurysm. In particular, in the context of the present invention the vascular injury is an injury causing neointima hyperplasia leading to restenosis, as defined herein.
[0069] Accordingly, the subject may be at risk of or is afflicted with neointimal hyperplasia.
[0070] The term neointima hyperplasia as used herein is known to the skilled person and inter alia described by Zain et al. (2019) “Neointimal Hyperplasia.” StatPearls Publishing; Available from: https://www.ncbi.nlm.nih.gov/books/NBK499893/ and Subbotin (2007) “Analysis of arterial intimal hyperplasia: review and hypothesis” Theoretical Biology and Medical Modelling, 4:41.
[0071] Neointimal hyperplasia can result in restenosis and/or stenosis, which is a (re)narrowing of a previously treated vascular lesion, and it is a crucial problem in interventional cardiovascular medicine. Neointima hyperplasia can become critical, when the blood flow is massively reduced in the context of a restenosis.
[0072] Neointima hyperplasia is characterized by an accumulation of inflammatory cells, migration and proliferation of vascular smooth muscle cells (SMCs), and the synthesis of extracellular matrix (ECM) components resulting in neointimal hyperplasia (A. C. Newby, A. B. Zaltsman, Molecular mechanisms in intimal hyperplasia. The Journal of pathology 190, 300-309 (2000). Activation of SMCs involve signaling cascades including the mTOR pathway, which controls cell cycle progression by phosphorylating ribosomal S6 protein kinase (R. J. Shaw, L. C. Cantley, Ras, Pl(3)K and mTOR signalling controls tumour cell growth. Nature 441, 424-430 2006).
[0073] Neointima can form as a result of vascular surgery such as angioplasty or stent placement. It is discussed to be due to proliferation of smooth muscle cells in the media giving rise to appearance of fused intima and media. Neointimal hyperplasia may result in an increase in the thickness of the lining of a blood vessel e.g. in response to injury or vascular reconstruction such as stent-therapy compared to the thickness of the lining of the blood vessel before injury. Thus, the neointimal hyperplasia may be a thickened layer of intima of the blood vessel than the intima before neointima hyperplasia.
[0074] Neointimal hyperplasia may be arterial neointimal hyperplasia secondary to arterial manipulation in endarterectomy or angioplasty or a venous graft associated neointimal hyperplasia secondary to coronary artery bypass grafting or arteriovenous grafting/fistula formation.
[0075] The subject may be a subject having the rs2513192 single nucleotide polymorphism (NCBI dbSNP number rs2513192 [Homo sapiens] released Jul. 9, 2019). In particular, the authors found that the A allele was linked to both increased TRPC6 expression and SMC migration. Furthermore, the A allele was also associated with development of restenosis (
[0076] According to the invention, the medical device comprises means for an administration of a TRPC6 inhibitor.
[0077] The mean as used herein may be any suitable means. Such means are also known to the skilled person. The TRPC6 inhibitor can be released from the means at a target site, e.g. a site affected by stenosis and/or restenosis, to administer the TRPC6 inhibitor. For example, the means may be a coating of the medical device. The skilled person knows how coatings can be applied to medical devices, in particular to a surface of the medical device, and also knows how such coatings are prepared. The medical device may be a catheter. The medical device may be a stent. The medical device may be a balloon. The medical device may be a microcatheter. The medical device may be a bioabsorbable scaffold. Preferably, the medical device is a stent or a balloon. In this regard, coating of a medical device such as a stent is inter alia described by U.S. Pat. No. 8,679,520. The coating may be localized at least at the surface of the medical device, which is in contact with the layer of the anatomical structure which is closest to the lumen of the anatomical structure. In this context the layer of the anatomical structure which is closest to the lumen may be the tunica intima, which is is the layer which is closest to the lumen of a blood vessel. In addition or alternatively, the coating may be localized in pores of the medical device.
[0078] The coating as used herein may comprise the TRPC6 inhibitor. The TRPC6 inhibitor can be released from the coating at a target site, e.g. a site affected by stenosis and/or restenosis, to administer the TRPC6 inhibitor.
[0079] The coating may further comprise a polymer. Representative examples of polymers that can be used to form the coating include ethylene vinyl alcohol copolymer (commonly known by the generic name EVOH or by the trade name EVAL); poly(hydroxyvalerate); poly(L-lactic acid); polycaprolactone; poly(lactide-co-glycolide); poly(hydroxybutyrate); poly(hydroxybutyrate-co-valerate); polydioxanone; polyorthoester; polyanhydride; poly(glycolic acid); poly(D,L-lactic acid); poly(glycolic acid-co-trimethylene carbonate); polyphosphoester; polyphosphoester urethane; poly(amino acids); cyanoacrylates; poly(trimethylene carbonate); poly(iminocarbonate); copoly(ether-esters) (e.g., PEO/PLA); polyalkylene oxalates; polyphosphazenes; biomolecules, such as fibrin, fibrinogen, cellulose, starch, collagen and hyaluronic acid; polyurethanes; silicones; polyesters; polyolefins; polyisobutylene and ethylene-alphaolefin copolymers; acrylic polymers and copolymers; vinyl halide polymers and copolymers, such as polyvinyl chloride; polyvinyl ethers, such as polyvinyl methyl ether; polyvinylidene halides, such as polyvinylidene fluoride and polyvinylidene chloride; polyacrylonitrile; polyvinyl ketones; polyvinyl aromatics, such as polystyrene; polyvinyl esters, such as polyvinyl acetate; copolymers of vinyl monomers with each other and olefins, such as ethylene-methyl methacrylate copolymers, acrylonitrile-styrene copolymers, ABS resins, and ethylene-vinyl acetate copolymers; polyamides, such as Nylon 66 and polycaprolactam; alkyd resins; polycarbonates; polyoxymethylenes; polyimides; polyethers; epoxy resins; polyurethanes; rayon; rayon-triacetate; cellulose; cellulose acetate; cellulose butyrate; cellulose acetate butyrate; cellophane; cellulose nitrate; cellulose propionate; cellulose ethers; and carboxymethyl cellulose. Furthermore, various combinations of polymers can be employed. The appropriate mixture of polymers can be coordinated with biologically active materials of interest to produce desired effects when coated on a medical device in accordance with the invention.
[0080] Alternatively, the coating may be a polymer-free coating.
[0081] Additionally or alternatively, the coating may comprise a solvent. Therefore, the coating composition applied on the surface of the medical device may comprise a TRPC6 inhibitor, a polymer, and/or a solvent. In this context, representative examples of solvents can include N,N-dimethylacetamide (DMAC) having the formula CH.sub.3-CO—N(CH.sub.3).sub.2, N,N-dimethylformamide (DMFA) having the formula H—CO—N(CH.sub.3).sub.2, tetrahydrofuran (THF) having the formula C.sub.4H.sub.8O, dimethylsulfoxide (DMSO) having the formula (CH.sub.3).sub.2S—O, or trifluoro acetic anhydride (TFAA) having the formula (CF.sub.3—CO).sub.2O (see e.g. U.S. Pat. No. 7,335,265-1). Further, examples of useful solvents include tetrahydrofuran, dichloromethane, chloroform, toluene, acetone, isooctane, 1,1,1,-trichloroethane, ethyl acetate, N-methylpyrrolidone (NMP), dimethylsulfoxide (DMSO), dimethylformamide (DMF), and dimethylacetamide (DMAC)), acetone/cyclohexanone solvent, and mixture thereof (see e.g. U.S. Pat. No. 7,105,198 and WO2007130257).
[0082] The TRPC6 inhibitor, as used herein, can be any suitable TRPC6 inhibitor. In general, a TRPC6 inhibitor is an inhibitor of the activity of the Transient Receptor Potential C6 (TRPC6) channel. The Transient Receptor Potential C6 (TRPC6) channel belongs to the larger family of TRP ion channels (Desai et al., 2005 Eur J Physiol 451 :11-18; Clapham et al., 2001 Nat Neurosci 2:387-396; Clapham, 2003 Nature 426: 517-524; Clapham et al., 2002 IUPHAR Compendium). TRPC6 is a non-selective calcium permeable cation channel. In addition to calcium ions, TRPC6 channels are permeable to other cations, for example sodium. Thus, TRPC6 channels modulate not only intracellular calcium concentration, but also membrane potential by modulating the flux of cations including calcium and sodium ions. Although non-selective cation channels such as TRPC6 modulate, among other things, calcium ion flux, they are mechanistically distinct from voltage-gated calcium channels. Generally, voltage-gated calcium channels respond to depolarization of the potential difference across the membrane and can open to permit an influx of calcium from the extracellular medium and a rapid increase in intracellular calcium levels or concentrations.
[0083] TRPC6 function has been implicated in, among other things, the modulation of myogenic tone. TRPC6 is highly expressed in SMCs, vascular SMCs, cardiomyocytes, pulmonary arteries, the aorta, heart, liver, brain, and kidney.
[0084] A TRPC6 inhibitor as used herein, is defined as any suitable inhibitor capable of decreasing or inhibiting the activity of a TRPC6. The TRPC6 may a sequence of SEQ ID NO. 1 or a sequence having 70%, 75% 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a sequence as shown in SEQ ID NO. 1.
[0085] The inhibitor may be a compound/molecule decreasing or abolishing the activity or expression of TRPC6 or the TRPC6 pathway. The inhibitor may achieve this effect by decreasing or inhibiting the transcription of the gene encoding the TRPC6 and/or decreasing the translation of the mRNA encoding the TRPC6. It can also be that the inhibitor leads to that TRPC6 performs its biochemical function with decreased efficiency in the presence of the inhibitor than in the absence of the inhibitor. Further, it is possible that the inhibitor results in that TRPC6 performs its cellular function with decreased efficiency in the presence of the inhibitor than in the absence of the inhibitor.
[0086] The inhibitor can also be an antagonist of the pathway to be inhibited.
[0087] In preferred embodiments, the TRPC6 inhibitor acts by binding to the TRPC6 channel.
[0088] Methods for testing if a compound/molecule is capable to decrease or block the activity of a TRPC6 are known to the skilled person. For example, an inhibitor of the TRPC6 can be tested by performing a scratch wound assay or radius migration assay as defined in the Examples and wherein the inhibitor has the same or equivalent effect on smooth muscle cell migration as observed with SAR7334.
[0089] In accordance with the present invention, the term “identical” or “percent identity” in the context of two or more polypeptide sequences such as SEQ ID NO: 1 refers to two or more sequences or subsequences that are the same, or that have a specified percentage of amino acids that are the same (e.g., at least 85%, 90%, 95%, 96%, 97%, 98% or 99% identity), when compared and aligned for maximum correspondence over a window of comparison, or over a designated region as measured using a sequence comparison algorithm as known in the art, or by manual alignment and visual inspection. Sequences having, for example, 80% to 95% or greater sequence identity are considered to be substantially identical. Such a definition also applies to the complement of a test sequence. Those having skill in the art will know how to determine percent identity between/among sequences using, for example, algorithms such as those based on CLUSTALW computer program (Thompson Nucl. Acids Res. 2 (1994), 4673-4680) or FASTDB (Brutlag Comp. App. Biosci. 6 (1990), 237-245), as known in the art.
[0090] Also available to those having skills in this art are the BLAST and BLAST 2.6 algorithms (Altschul Nucl. Acids Res. 25 (1977), 3389-3402). The BLASTP program for amino acid sequences uses as defaults a word size (W) of 6, an expect threshold of 10, and a comparison of both strands. Furthermore, the BLOSUM62 scoring matrix (Henikoff Proc. Natl. Acad. Sci., USA, 89, (1989), 10915; Henikoff and Henikoff (1992) ‘Amino acid substitution matrices from protein blocks.’ Proc Natl Acad Sci USA. 1992 Nov. 15;89(22):10915-9) can be used.
[0091] For example, BLAST2.6, which stands for Basic Local Alignment Search Tool (Altschul, Nucl. Acids Res. 25 (1997), 3389-3402; Altschul, J. Mol. Evol. 36 (1993), 290-300; Altschul, J. Mol. Biol. 215 (1990), 403-410), can be used to search for local sequence alignments.
[0092] In particular, in the context of the present invention a TRPC6 inhibitor is a compound which is able to inhibit the migration of SMCs.
[0093] As used herein SMCs (smooth muscle cells) refer to any smooth muscle cell. Smooth muscle cells are known to the skilled person and inter alia described by Jaslove and Nelson (2018) “Smooth muscle: a stiff sculptor of epithelial shapes.” Philos Trans R Soc Lond B Biol Sci. 2018 Nov. 5; 373(1759): 20170318. Smooth muscle is a mesenchymal tissue that surrounds the epithelia of organs including the gut, blood vessels, lungs, bladder, ureter, uterus, oviduct and epididymis. Smooth muscle may be identified as α-smooth muscle actin (α-SMA)-expressing cells. SMCs may contractile or synthetic. Contractile SMCs are elongated, spindleshaped cells, whereas synthetic SMCs are less elongated and have a cobblestone morphology which is referred to as epithelioid or rhomboid.
[0094] The skilled person also knows vascular smooth vascular cells as inter alia described by Rensen et al. (2007) Regulation and characteristics of vascular smooth muscle cell phenotypic diversity” Neth Heart J.; 15(3): 100-108.
[0095] The migration of SMCs can be measured by methods known in the art. Further methods are defined in the examples. For example, the effect a TRPC6 inhibitor has on SMC or VSMC migration can be determined by scratch wound assay or radius migration assay. These assays are known to the skilled person and inter alia described by Cory G. Scratch-wound assay Methods Mol. Biol. 2011 769:25-30; William J. Ashbya and Andries Zijlstra Established and Novel Methods of Interrogating Two-Dimensional Cell Migration lntegr Biol (Camb). 2012; 4(11): 1338-1350.
[0096] The TRPC6 inhibitor may reduce the migration of SMCs to the site at risk of neointima formation or undergoing neointima formation. The TRPC6 inhibitor may additionally or alternatively reduce the migration of SMCs in a scratch wound assay (as explained in the examples) when compared to a scratch wound assay in the absence of the TRPC6 inhibitor.
[0097] In this context, the term “reduce” can mean that the amount of total SMCs that migrate, as measured by scratch wound assay or radius migration assay, is reduced by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or by 100% in the presence of the TRPC6 inhibitor as described herein compared to the amount of SMCs that migrate in absence of the TRPC6 inhibitor (
[0098] Accordingly, the TRPC6 inhibitor may act by preventing the migration of SMCs to the site at risk of neointima formation or undergoing neointima formation. Preferably, “prevent” means that, after administration of the TRPC6 inhibitor, about 70%, 80%, 90%, 95% or 100% of the total SMCs are located in the media portion of the blood vessel wall, i.e do not migrate in the sub endothelium of the blood vessel.
[0099] In preferred embodiments, the TRPC6 inhibitor is the compound SAR7334.
[0100] According to embodiments of the invention, the TRPC6 inhibitor may have the following formula (I)
##STR00001##
[0101] wherein: R.sup.(I)1 and R.sup.(I)2 are each independently selected from the group consisting of halogen (preferably F, Cl, or Br), —CN and —NO.sub.2; and n.sup.(I) is 0, 1 or 2; or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0102] As used herein and throughout the entire description, the term “pharmaceutically acceptable salt” refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S. M., et al. (1977) J. Pharm. Sci. 66: 1-19). Physiologically acceptable salts of the compounds of the present invention are in particular salts with a nontoxic salt component and preferably are pharmaceutically utilizable salts. They can contain inorganic or organic salt components. Such salts can be formed, for example, from compounds of the present invention which contain an acidic group, for example a 15 carboxylic acid group (HO—CO—) or a sulfonic acid group (H0—S(0)2—) and nontoxic inorganic or organic bases. Suitable bases are, for example, alkali metal compounds or alkaline earth metal compounds, such as sodium hydroxide, potassium hydroxide, sodium carbonate or sodium hydrogencarbonate, or ammonia, organic amino compounds and quaternary ammonium hydroxides. Reactions of compounds of the present invention with bases for the preparation of the salts are in general carried out according to customary procedures in a solvent or diluent. On account of the physiological and chemical stability, advantageous salts of acidic groups are in many cases sodium, potassium, magnesium or calcium salts or ammonium salts which can also carry one or more organic groups on the nitrogen atom. Compounds of the present invention which contain a basic, i.e. protonatable, group, for example an amino group or another basic heterocycle, can be present in the form of their acid addition salts with physiologically acceptable acids, for example as salt with hydrogen chloride, hydrogen bromide, phosphoric acid, sulfuric acid, acetic acid, benzoic acid, methanesulfonic acid, p-toluenesulfonic acid, which in general can be prepared from the compounds of the present invention by reaction with an acid in a solvent or diluent according to customary procedures. As usual, in particular in the case of acid addition salts of a compound containing two or more basic groups, in an obtained salt the ratio of the salt components can deviate upward or downward from the stoichiometric ratio, such as the molar ratio 1:1 or 1:2 in the case of the acid addition salt of a compound of the present invention containing one or two basic groups with a monovalent acid, and vary depending on the applied conditions. The present invention comprises also salts containing the components in a non-stoichiometric ratio, and an indication that an acid addition salt of a compound of the present invention contains an acid in equimolar amount, for example, also allows for a lower or higher amount of acid in the obtained salt, for example about 0.8 or about 1.1 mol of acid per mol of compound of the present invention. If the compounds of the present invention simultaneously contain an acidic and a basic group in the molecule, the invention also includes internal salts (betaines, zwitterions) in addition to the salt forms mentioned. The present invention also comprises all salts of the compounds of the present invention which, because of low physiological tolerability, are not directly suitable for use as a pharmaceutical, but are suitable as intermediates for chemical reactions or for the preparation of physiologically acceptable salts, for example by means of anion exchange or cation exchange. A subject of the present invention also are solvates of the compounds of the present invention and their salts, such as hydrates and adducts with alcohols like (CrC4)alkanols, in particular physiologically acceptable solvates, as well as active metabolites of compounds of the present invention.
[0103] As used herein and throughout the entire description, the term “pharmaceutically acceptable” may in particular mean approved by a regulatory agency or other generally recognized pharmacopoeia for use in animals, and more particularly in humans.
[0104] In a particularly preferred embodiment, the TRPC6 inhibitor is SAR7334, having the following formula:
##STR00002##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0105] Alternatively the compound may have the formula
##STR00003##
[0106] or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0107] In some embodiments, the TRPC6 inhibitor has the following formula (II):
##STR00004##
wherein: R.sup.(II)1 and R.sup.(II)2 are each independently selected from the group consisting of —OH,
##STR00005##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0108] Preferably, the TRPC6 inhibitor of formula (II) is selected from the group consisting of larixyl diacetate:
##STR00006## ##STR00007##
[0109] Accordingly, the TRPC6 inhibitor may be larixyl diacetate or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may be larixyl carmabate or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may be larixyl methylether or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may also be larixyl formyester, or a pharmaceutically acceptable salt, solvate or hydrate thereof. Also, the TRPC6 inhibitor may be larixyl monoproprionate, or a pharmaceutically acceptable salt, solvate or hydrate thereof. Furthermore, the TRPC6 inhibitor may be larixyl dipropionate, or a pharmaceutically acceptable salt, solvate or hydrate thereof. Finally, the TRPC6 inhibitor may be larixyl monophenylacetate or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0110] In preferred embodiments, the TRPC6 inhibitor may be larixyl carbamate, having the following formula:
##STR00008##
[0111] Or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0112] In some embodiments, the TRPC6 inhibitor may have the following formula (III):
##STR00009##
wherein: R.sup.(III)1 is independently selected from the group consisting of
##STR00010##
R.sup.(III)2 is independently selected from the group consisting of —H, —CH.sub.3 and halogen (preferably F, Cl, Br); and R.sup.(III)3 is independently selected from the group consisting of
##STR00011##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0113] In preferred embodiments, the TRPC6 inhibitor is selected from the group consisting of the compounds of the formulas:
##STR00012## ##STR00013##
Accordingly, the TRPC6 inhibitor may be
##STR00014##
or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may be
##STR00015##
or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may be
##STR00016##
or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may be
##STR00017##
or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may be
##STR00018##
or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may be
##STR00019##
or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may be
##STR00020##
The TRPC6 inhibitor may be
##STR00021##
or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may be
##STR00022##
or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may be
##STR00023##
or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may be
##STR00024##
(BTDM) or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0114] In preferred embodiments, the TRPC6 inhibitor is GSK2332255B or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0115] In preferred embodiments, the TRPC6 inhibitor is GSK2833503A or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0116] In preferred embodiments, the TRPC6 inhibitor is BTDM or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0117] In some embodiments, the TRPC6 inhibitor is selected from the group consisting of
##STR00025## ##STR00026##
[0118] Accordingly, the TRPC6 inhibitor may be 2910-0498, or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may also be 5408-0428, or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may also be 6228-0353, or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may also be 6228-0473, or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may also be 8010-3846, or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may also be 8016-8488, or a pharmaceutically acceptable salt, solvate or hydrate thereof. The TRPC6 inhibitor may also be Pyr3 or a pharmaceutically acceptable salt, solvate or hydrate thereof. In preferred embodiments, the TRPC6 inhibitor is 8009-5364, or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0119] In some embodiments the TRPC6 inhibitor may have the formula (IV), as disclosed in WO 2019/081637:
##STR00027##
wherein: [0120] L.sup.(IV) is absent or is methylene or ethylene; [0121] Y.sup.(IV) is CH or N; [0122] A.sup.(IV) is CH or N; [0123] R.sup.(V)1 is selected from the group consisting of: [0124] C.sub.1-6alkyl optionally substituted with 1 to 3 groups independently selected from the group consisting of halo, C.sub.3-6cycloalkyl and OC.sub.3-6cycloalkyl; [0125] phenyl optionally substituted with 1 to 3 groups independently selected from the group consisting of CF.sub.3, halo, C.sub.3-6cycloalkyl, OC.sub.3-6cycloalkyl, OC.sub.1-6alkyl optionally substituted with one to three halo; and [0126] C.sub.3-6cycloalkyl optionally substituted with 1 to 3 groups independently selected from the group consisting of halo and C.sub.1-6alkyl optionally substituted with 1 to 3 halo; [0127] R.sup.(IV)2 is selected from the group consisting of H, C.sub.1-6alkyl, OCF.sub.3, C.sub.3-6cycloalkyl, OC.sub.1-6alkyl; OC.sub.3-6cycloalkyl; [0128] R.sup.(IV)3 is selected from the group consisting of H, C.sub.1-6alkyl, C.sub.3-6cycloalkyl, OC.sub.3-6cycloalkyl; wherein each of the C.sub.1-6alkyl, C.sub.3-6cycloalkyl, OC.sub.3-6cycloalkyl of the R.sup.(IV)3 group may be optionally substituted with one to three groups each independently selected from the group consisting of halo, OH, OC.sub.1-6alkyl, SC.sub.1-6alkyl, N(C.sub.1-6alkyl).sub.2; and wherein one to three carbon atoms of the C.sub.1-6alkyl of the R.sup.(IV)3 group may optionally be replaced by one or two moieties selected from the group consisting of NH, (NC.sub.1-6alkyl), O, and S; [0129] R.sup.(IV)4 and R.sup.(IV)5 are each independently selected from the group consisting of H or C.sub.1-6alkyl; [0130] R.sup.(IV)3 and R.sup.(IV)4 can together with the atom to which they are attached join to form a 3 to 9-membered carbocyclyl ring which optionally may contain one to three heteroatoms selected from the group consisting of N, O, and S; or [0131] R.sup.(IV)3 and R.sup.(IV)5 can together form a 3 to 9-membered bicyclic ring which optionally may contain one to three heteroatoms selected from the group consisting of N, O, and S; [0132] R.sup.(IV)6 is selected from the group consisting of H, C.sub.1-6alkyl, CN, CF.sub.3, OCF.sub.3, C.sub.3-6cycloalkyl, OC.sub.1-6alkyl, and OC.sub.3-6cycloalkyl; [0133] R.sup.(IV)7 is selected from the group consisting of H and OC.sub.1-6alkyl;
[0134] or a pharmaceutically acceptable salt, solvate or hydrate thereof
[0135] The term “C1-n-alkyl”, wherein n is an integer selected from 2, 3, 4, 5 or 6, preferably 4 or 6, either alone or in combination with another radical denotes an acyclic, saturated, branched or linear hydrocarbon radical with 1 to n C atoms. For example the term C1-5-alkyl embraces the radicals H3C—, H3C—CH2—, H3C—CH2—CH2—, H3C—CH(CH3)—, H3C—CH2—CH2—CH2—, H3C—CH2—CH(CH3)—, H3C—CH(CH3)—CH2—, H3C—C(CH3)2—, H3C—CH2—CH2—CH2—CH2—, H3C—CH2—CH2—CH(CH3)—, H3C—CH2—CH(CH3)—CH2—, H3C—CH(CH3)—CH2—CH2—, H3C—CH2—C(CH3)2—, H3C—C(CH3)2—CH2—, H3CCH(CH3)—CH(CH3)— and H3C—CH2—CH (C H2C H 3)—.
[0136] The term “C3-n-cycloalkyl”, wherein n is an integer from 4 to n, either alone or in combination with another radical denotes a cyclic, saturated, unbranched hydrocarbon radical with 3 to n C atoms. For example, the term C3-6-cycloalkyl includes cyclopropyl, cyclobutyl, cyclopentyl, and cyclohexyl.
[0137] By the term “halo” added to an “alkyl”, “alkylene” or “cycloalkyl” group (saturated or unsaturated) is such a alkyl or cycloalkyl group wherein one or more hydrogen atoms are replaced by a halogen atom selected from among fluorine, chlorine or bromine, preferably fluorine and chlorine, particularly preferred is fluorine. Examples include: H2FC—, HF2C—, F3C—.
[0138] The term “carbocyclyl” as used either alone or in combination with another radical, means a mono- bi- or tricyclic ring structure consisting of 3 to 9 carbon atoms and optionally a heteroatom selected from the group consisting of N, O, and S. The term “carbocyclyl” refers to fully saturated ring systems and encompasses fused, bridged and spirocyclic systems.
[0139] Many of the terms given above may be used repeatedly in the definition of a formula or group and in each case have one of the meanings given above, independently of one another. The compounds of the invention are only those which are contemplated to be ‘chemically stable’ as will be appreciated by those skilled in the art. For example, a compound which would have a ‘dangling valency’, or a ‘carbanion’ are not compounds contemplated by the inventive methods disclosed herein.
[0140] Accordingly, the TRPC6 inhibitor, as disclosed in WO 2019/081637, may be:
##STR00028##
[0141] The TRPC6 inhibitor may also be:
##STR00029##
[0142] The TRPC6 inhibitor may also be:
##STR00030##
[0143] The TRPC6 inhibitor may also be:
##STR00031##
[0144] The TRPC6 inhibitor may also be:
##STR00032##
[0145] The TRPC6 inhibitor may also be:
##STR00033##
[0146] The TRPC6 inhibitor may also be:
##STR00034##
[0147] The TRPC6 inhibitor may also be:
##STR00035##
[0148] The TRPC6 inhibitor may also be:
##STR00036##
[0149] The TRPC6 inhibitor may also be:
##STR00037##
[0150] The TRPC6 inhibitor may also be:
##STR00038##
[0151] The TRPC6 inhibitor may also be:
##STR00039##
[0152] The TRPC6 inhibitor may also be:
##STR00040##
[0153] The TRPC6 inhibitor may also be:
##STR00041##
[0154] The TRPC6 inhibitor may also be:
##STR00042##
[0155] The TRPC6 inhibitor may also be:
##STR00043##
[0156] The TRPC6 inhibitor may also be:
##STR00044##
[0157] The TRPC6 inhibitor may also be:
##STR00045##
[0158] The TRPC6 inhibitor may also be:
##STR00046##
[0159] The TRPC6 inhibitor may also be:
##STR00047##
[0160] The TRPC6 inhibitor may also be:
##STR00048##
[0161] The TRPC6 inhibitor may also be:
##STR00049##
[0162] The TRPC6 inhibitor may also be:
##STR00050##
[0163] The TRPC6 inhibitor may also be:
##STR00051##
[0164] The TRPC6 inhibitor may also be:
##STR00052##
[0165] The TRPC6 inhibitor may also be:
##STR00053##
[0166] The TRPC6 inhibitor may also be:
##STR00054##
[0167] The TRPC6 inhibitor may also be:
##STR00055##
[0168] The TRPC6 inhibitor may also be:
##STR00056##
[0169] The TRPC6 inhibitor may also be:
##STR00057##
[0170] The TRPC6 inhibitor may also be:
##STR00058##
[0171] The TRPC6 inhibitor may also be:
##STR00059##
[0172] The TRPC6 inhibitor may also be:
##STR00060##
[0173] The TRPC6 inhibitor may also be:
##STR00061##
[0174] The TRPC6 inhibitor may also be:
##STR00062##
[0175] The TRPC6 inhibitor may also be:
##STR00063##
[0176] The TRPC6 inhibitor may also be:
##STR00064##
[0177] The TRPC6 inhibitor may also be:
##STR00065##
[0178] The TRPC6 inhibitor may also be:
##STR00066##
[0179] The TRPC6 inhibitor may also be:
##STR00067##
[0180] The TRPC6 inhibitor may also be:
##STR00068##
[0181] The TRPC6 inhibitor may also be:
##STR00069##
[0182] The TRPC6 inhibitor may also be:
##STR00070##
[0183] The TRPC6 inhibitor may also be:
##STR00071##
[0184] The TRPC6 inhibitor may also be:
##STR00072##
[0185] The TRPC6 inhibitor may also be:
##STR00073##
[0186] The TRPC6 inhibitor may also be:
##STR00074##
[0187] The TRPC6 inhibitor may also be:
##STR00075##
[0188] The TRPC6 inhibitor may also be:
##STR00076##
[0189] The TRPC6 inhibitor may also be:
##STR00077##
[0190] The TRPC6 inhibitor may also be:
##STR00078##
[0191] The TRPC6 inhibitor may also be:
##STR00079##
[0192] The TRPC6 inhibitor may also be:
##STR00080##
[0193] The TRPC6 inhibitor may also be:
##STR00081##
[0194] The TRPC6 inhibitor may also be:
##STR00082##
[0195] The TRPC6 inhibitor may also be:
##STR00083##
[0196] The TRPC6 inhibitor may also be:
##STR00084##
[0197] The TRPC6 inhibitor may also be:
##STR00085##
[0198] The TRPC6 inhibitor may also be:
##STR00086##
[0199] The TRPC6 inhibitor may also be:
##STR00087##
[0200] The TRPC6 inhibitor may also be:
##STR00088##
[0201] The TRPC6 inhibitor may also be:
##STR00089##
[0202] The TRPC6 inhibitor may also be:
##STR00090##
[0203] The TRPC6 inhibitor may also be:
##STR00091##
[0204] The TRPC6 inhibitor may also be:
##STR00092##
[0205] The TRPC6 inhibitor may also be:
##STR00093##
[0206] The TRPC6 inhibitor may also be:
##STR00094##
[0207] The TRPC6 inhibitor may also be:
##STR00095##
[0208] The TRPC6 inhibitor may also be:
##STR00096##
[0209] The TRPC6 inhibitor may also be:
##STR00097##
[0210] The TRPC6 inhibitor may also be:
##STR00098##
[0211] The TRPC6 inhibitor may also be:
##STR00099##
[0212] The TRPC6 inhibitor may also be:
##STR00100##
[0213] The TRPC6 inhibitor may also be:
##STR00101##
[0214] The TRPC6 inhibitor may also be:
##STR00102##
[0215] The TRPC6 inhibitor may also be:
##STR00103##
[0216] The TRPC6 inhibitor may also be:
##STR00104##
[0217] The TRPC6 inhibitor may also be:
##STR00105##
[0218] The TRPC6 inhibitor may also be:
##STR00106##
[0219] The TRPC6 inhibitor may also be:
##STR00107##
[0220] The TRPC6 inhibitor may also be:
##STR00108##
[0221] The TRPC6 inhibitor may also be:
##STR00109##
[0222] The TRPC6 inhibitor may also be:
##STR00110##
[0223] The TRPC6 inhibitor may also be:
##STR00111##
[0224] The TRPC6 inhibitor may also be:
##STR00112##
[0225] The TRPC6 inhibitor may also be:
##STR00113##
[0226] The TRPC6 inhibitor may also be:
##STR00114##
[0227] The TRPC6 inhibitor may also be:
##STR00115##
[0228] The TRPC6 inhibitor may also be:
##STR00116##
[0229] The TRPC6 inhibitor may also be:
##STR00117##
[0230] The TRPC6 inhibitor may also be:
##STR00118##
[0231] The TRPC6 inhibitor may also be:
##STR00119##
[0232] The TRPC6 inhibitor may also be:
##STR00120##
[0233] The TRPC6 inhibitor may also be:
##STR00121##
[0234] The TRPC6 inhibitor may also be:
##STR00122##
[0235] In some embodiments, the TRPC6 inhibitor may have the following formula (V), as disclosed in WO2019/161010:
##STR00123##
wherein:
Y.SUP.(V) .is CH or N;
A.SUP.(V) .is CH or N;
R.SUP.(V)1 .is H, C1-3alkyl, or OC1-3alkyl;
[0236] R.sup.(V)2 is H, C1-3alkyl or C3-6cycloalkyl wherein each of the C1-3alkyl or C3-6cycloalkyl of the R2 group may be optionally substituted with OH, halo or OC1-3alkyl;
R.SUP.(V)3 .is H or C1-3alkyl;
[0237] R.sup.(V)2 and R.sup.(V)3 together with the carbon to which they are attached may optionally join to form a 3- to 6-membered carbocyclic ring;
R.sup.(V)4 represents [0238] C1-6alkyl which may optionally be substituted with one to three groups independently selected from the group consisting of halo, [0239] C3-6cycloalkylmethyl and C3-6cycloalkylethyl, where the C3-6cycloalkyl of the C3-6cycloalkylmethyl and C3-6cycloalkylethyl may optionally be substituted with one to three groups independently selected from the group consisting of halo and methyl, [0240] 1,2,3-thiadiazoylmethyl, thiazoylmethyl, isoxazolylmethyl or [0241] a group of formula
##STR00124## [0242] wherein n(V) is 0 or 1;
R.sup.(V)5 is selected from the group consisting of H, halo, CF3, OCF3, CN, C1-3alkyl, OC1-3alkyl, C3-6cycloalkyl; wherein each of the C1-3alkyl and OC1-3alkyl of the R(V)5 groups may optionally be substituted with one to three groups each independently selected from the group consisting of halo, oxo, NH2, NH(C1-3alkyl), and N(C1-3alkyl)2;
R.sup.(V)6 is selected from the group consisting of H, halo, C1-3alkyl, and OC1-3alkyl;
wherein
R.sup.(V)5 and R.sup.(V)6 may join to form a 5- or 6-membered carbocyclic ring wherein one or two carbon atoms of the 5- or 6-membered carbocyclic ring may optionally be replaced by one or two oxygen atoms;
R.sup.(V)7 is selected from the group consisting of H, halo, C1-3alkyl and OC1-3alkyl, wherein the C1-3alkyl of the R.sup.(V)7 group may optionally be substituted with one to three substituents selected from the group consisting of halo;
R.sup.(V)8 is selected from the group consisting of H and halo;
R.sup.(V)9 is H or C1-3alkyl; wherein
R.sup.(V)2 and R.sup.(V)9 may join to form a bicyclic ring;
R.SUP.(V)10 .is H or C1-3alkyl;
[0243] or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0244] Accordingly the TRPC6 inhibitor, as disclosed in WO 2019/161010, may be—
##STR00125##
[0245] The TRPC6 inhibitor may also be:
##STR00126##
[0246] The TRPC6 inhibitor may also be:
##STR00127##
[0247] The TRPC6 inhibitor may also be:
##STR00128##
[0248] The TRPC6 inhibitor may also be:
##STR00129##
[0249] The TRPC6 inhibitor may also be:
##STR00130##
[0250] The TRPC6 inhibitor may also be:
##STR00131##
[0251] The TRPC6 inhibitor may also be:
##STR00132##
[0252] The TRPC6 inhibitor may also be:
##STR00133##
[0253] The TRPC6 inhibitor may also be:
##STR00134##
[0254] The TRPC6 inhibitor may also be:
##STR00135##
[0255] The TRPC6 inhibitor may also be:
##STR00136##
[0256] The TRPC6 inhibitor may also be:
##STR00137##
[0257] The TRPC6 inhibitor may also be:
##STR00138##
[0258] The TRPC6 inhibitor may also be:
##STR00139##
[0259] The TRPC6 inhibitor may also be:
##STR00140##
[0260] The TRPC6 inhibitor may also be:
##STR00141##
[0261] The TRPC6 inhibitor may also be:
##STR00142##
[0262] The TRPC6 inhibitor may also be:
##STR00143##
[0263] The TRPC6 inhibitor may also be:
##STR00144##
[0264] The TRPC6 inhibitor may also be:
##STR00145##
[0265] The TRPC6 inhibitor may also be:
##STR00146##
[0266] The TRPC6 inhibitor may also be:
##STR00147##
[0267] The TRPC6 inhibitor may also be:
##STR00148##
[0268] The TRPC6 inhibitor may also be:
##STR00149##
[0269] The TRPC6 inhibitor may also be:
##STR00150##
[0270] The TRPC6 inhibitor may also be:
##STR00151##
[0271] The TRPC6 inhibitor may also be:
##STR00152##
[0272] The TRPC6 inhibitor may also be:
##STR00153##
[0273] The TRPC6 inhibitor may also be:
##STR00154##
[0274] The TRPC6 inhibitor may also be:
##STR00155##
[0275] The TRPC6 inhibitor may also be:
##STR00156##
[0276] The TRPC6 inhibitor may also be:
##STR00157##
[0277] The TRPC6 inhibitor may also be:
##STR00158##
[0278] The TRPC6 inhibitor may also be:
##STR00159##
[0279] The TRPC6 inhibitor may also be:
##STR00160##
[0280] The TRPC6 inhibitor may also be:
##STR00161##
[0281] The TRPC6 inhibitor may also be:
##STR00162##
[0282] The TRPC6 inhibitor may also be:
##STR00163##
[0283] The TRPC6 inhibitor may also be:
##STR00164##
[0284] The TRPC6 inhibitor may also be:
##STR00165##
[0285] The TRPC6 inhibitor may also be:
##STR00166##
[0286] The TRPC6 inhibitor may also be:
##STR00167##
[0287] The TRPC6 inhibitor may also be:
##STR00168##
[0288] The TRPC6 inhibitor may also be:
##STR00169##
[0289] The TRPC6 inhibitor may also be:
##STR00170##
[0290] The TRPC6 inhibitor may also be:
##STR00171##
[0291] The TRPC6 inhibitor may also be:
##STR00172##
[0292] The TRPC6 inhibitor may also be:
##STR00173##
[0293] The TRPC6 inhibitor may also be:
##STR00174##
[0294] The TRPC6 inhibitor may also be:
##STR00175##
[0295] The TRPC6 inhibitor may also be:
##STR00176##
[0296] The TRPC6 inhibitor may also be:
##STR00177##
[0297] The TRPC6 inhibitor may also be:
##STR00178##
[0298] The TRPC6 inhibitor may also be BI 764198, available from Boehringer Ingelheim, Ingelheim am Rhein, Germany (https://www.boehringer-ingelheim.de/pressemitteilung/entwicklung-potentieller-therapie-fuer-schwere-covid19-komplikationen).
[0299] The present invention also relates to a method of manufacturing a medical device suitable for being inserted into the lumen of an anatomic structure of a subject, wherein the method comprises contacting the surface of the medical device with a coating composition comprising a TRPC6 inhibitor. The medical device may be any medical device as disclosed herein, e.g. a stent or a balloon. Accordingly, the medical device may be a catheter. The medical device may be a stent. Also, the medical device may be a balloon. The medical device may be a bioabsorbable scaffold. The medical device may be a microcatheter.
[0300] According to the invention, said method may comprise contacting a surface of the medical device with a coating composition comprising the TRPC6 inhibitor. In particular, in the context of the invention said contacting comprises the step of preparing a coating composition including the TRPC6 inhibitor as defined herein. The skilled person knows how to prepare a suitable coating composition, and any coating composition which comprises a TRPC6 inhibitor and which is suitable for depositing a coating onto a medical device may be used. For example, the coating composition may be a liquid, e.g. a solution comprising the TRPC6 inhibitor.
[0301] In this context, the means for the administration of a TRPC6 inhibitor may refer to a coating which is formed by a depositing a coating composition onto the medical device.
[0302] Further according to the invention, the coating composition applied on the surface of the medical device may comprise a TRPC6 inhibitor and a polymer as disclosed herein.
[0303] Said coating composition may further comprise a polymer, and/or a solvent as disclosed herein. In particular, the medical device according to the invention can be coated with a coating composition comprising a biocompatible polymer. Additionally, said polymer may be dissolved in a solvent.
[0304] Representative examples of polymers that can be used in the coating composition include ethylene vinyl alcohol copolymer (commonly known by the generic name EVOH or by the trade name EVAL); poly(hydroxyvalerate); poly(L-lactic acid); polycaprolactone; poly(lactide-co-glycolide); poly(hydroxybutyrate); poly(hydroxybutyrate-co-valerate); polydioxanone; polyorthoester; polyanhydride; poly(glycolic acid); poly(D, L-lactic acid); poly(glycolic acid-co-trimethylene carbonate); polyphosphoester; polyphosphoester urethane; poly(amino acids); cyanoacrylates; poly(trimethylene carbonate); poly(iminocarbonate); copoly(ether-esters) (e.g., PEO/PLA); polyalkylene oxalates; polyphosphazenes; biomolecules, such as fibrin, fibrinogen, cellulose, starch, collagen and hyaluronic acid; polyurethanes; silicones; polyesters; polyolefins; polyisobutylene and ethylene-alphaolefin copolymers; acrylic polymers and copolymers; vinyl halide polymers and copolymers, such as polyvinyl chloride; polyvinyl ethers, such as polyvinyl methyl ether; polyvinylidene halides, such as polyvinylidene fluoride and polyvinylidene chloride; polyacrylonitrile; polyvinyl ketones; polyvinyl aromatics, such as polystyrene; polyvinyl esters, such as polyvinyl acetate; copolymers of vinyl monomers with each other and olefins, such as ethylene-methyl methacrylate copolymers, acrylonitrile-styrene copolymers, ABS resins, and ethylene-vinyl acetate copolymers; polyamides, such as Nylon 66 and polycaprolactam; alkyd resins; polycarbonates; polyoxymethylenes; polyimides; polyethers; epoxy resins; polyurethanes; rayon; rayon-triacetate; cellulose; cellulose acetate; cellulose butyrate; cellulose acetate butyrate; cellophane; cellulose nitrate; cellulose propionate; cellulose ethers; and carboxymethyl cellulose. Furthermore, various combinations of polymers can be employed. The appropriate mixture of polymers can be coordinated with biologically active materials of interest to produce desired effects when coated on a medical device in accordance with the invention.
[0305] Representative examples of solvents can include N,N-dimethylacetamide (DMAC) having the formula CH.sub.3—CO—N(CH.sub.3).sub.2, N,N-dimethylformamide (DMFA) having the formula H—CO—N(CH.sub.3).sub.2, tetrahydrofuran (THF) having the formula C.sub.4H.sub.8O, dimethylsulfoxide (DMSO) having the formula (CH.sub.3).sub.2S—O, or trifluoro acetic anhydride (TFAA) having the formula (CF.sub.3—CO).sub.2O (see e.g. U.S. Pat. No. 7,335,265-1). Further, examples of useful solvents include tetrahydrofuran, dichloromethane, chloroform, toluene, acetone, isooctane, 1,1,1,trichloroethane, ethyl acetate, N-methylpyrrolidone (NMP), dimethylsulfoxide (DMSO), dimethylformamide (DMF), and dimethylacetamide (DMAC)), acetone/cyclohexanone solvent, and mixture thereof (see e.g. U.S. Pat. No. 7,105,198 and WO2007130257).
[0306] Depending on the volatility of the particular solvent employed, the solvent can evaporate essentially upon contact with the medical device, e.g. a stent, so that a coating comprising the TRPC6 inhibitor is formed. Evaporation of the solvent(s) can be induced by application of a warm gas between each repetition which can prevent coating defects and minimize interaction between the active agent and the solvent. The medical device may be positioned below a nozzle blowing the warm gas. After evaporation of the solvent, the TRPC6 inhibitor remains on the surface of the medical device. In addition or alternatively, the TRPC6 inhibitor can remain in pores of the medical device.
[0307] Although most of the medical devices (or at least a part of them) that are used today to decrease the rate of restenosis are coated with polymeric material, polymers are known to induce inflammatory responses which can translate into delayed healing and thus increased risk for an adverse outcome. Accordingly, the medical device of the invention may comprise a polymer-free coating. Accordingly, said coating composition may comprise a TRPC6 inhibitor and a solvent and does not comprise a polymer.
[0308] The coating composition comprising the TRPC6 inhibitor and preferably a solvent and a polymer, may then applied to the medical device by methods known in the art. For example, said methods include dip-coating and/or spray-coating or any other acceptable method known in the art.
[0309] The medical device may be coated by any procedure suitable for coating a solid material with a solution. The medical device may e.g. be dipped into a solution containing the TRPC6 inhibitor. Alternatively, it can be dipped consecutively in two solutions, wherein one solution contains the TRPC6 inhibitor and the other the second drug defined elsewhere herein.
[0310] The concentration of the drug solution is preferably from about 0.1 to about 10%, more preferably from about 0.2 to about 5%, still more preferably from about 0.3 to about 3% and most preferably from about 0.5 to about 1%.
[0311] Thereafter, the medical device may be dried e.g. by mild heating, air-drying or any other suitable method known to the artisan. The medical device may be coated using e.g. dip coating. Dip-coating typically involves immersing the medical device into a liquid coating Solution.
[0312] Also, a method of coating a medical device, e.g. a stent, via dip coating may e.g. comprise immersing a portion of the medical device into a coating liquid, and withdrawing the immersed portion of the medical device from the coating liquid. The medical device is simultaneously rotated with respect to the coating composition while the medical device is being immersed and withdrawn. The various methods of dip-coating are known to the skilled in the art. A method of dip-coating can be the one described in U.S. Pat. No. 7,105,198B2.
[0313] In embodiments of the invention, the medical device, e.g. a stent, is spray-coated. Typically, the conventional spray-coating methods are usually implemented with a device such as an airbrush. A coating on a medical device may be fabricated by spraying a coating composition including polymer and drug on the medical device. Spray coating a medical device typically involves mounting or disposing a medical device on a support, followed by spraying a coating material from a nozzle onto the mounted medical device. A spray apparatus, such as EFD 780S spray device with VALVEMATE 7040 control system (manufactured by EFD Inc., East Providence, R.I., can be used to apply a composition to a stent. The various methods of spray coating are known to the person skilled in the art. A method of spray coating can be the one described in WO2007/130257.
[0314] In embodiments, the coating machine described by Wessely and coworkers may be used, which permits individual, on-site coating of medical devices such as stents e.g. with a unique microporous surface (Wessely R. et al., 2005, Arterioscler Thromb Vasc Biol 25: 748-753) allowing for individualizable, dose-adjustable, and multiple coatings with identical or various compounds, designated ISAR (individualizable drug-eluting stent system to abrogate restenosis). Preferably, medical devices, such as e.g. stents, can be coated using the drug solutions as defined above.
[0315] Therefore, according to the method of the invention, the surface of the medical device defined elsewhere herein may be contacted with the coating composition of the invention by dip coating or spray coating.
[0316] The present invention also relates to a medical device obtainable or being obtained by a method as disclosed herein.
[0317] The present invention also relates to a TRPC6 inhibitor for use in the treatment or prevention of a disease associated with neointimal hyperplasia, wherein the neointimal hyperplasia is associated with the migration of smooth muscular cells.
[0318] The stenosis and/or restenosis may be a stenosis and/or restenosis of a blood vessel. The stenosis and/or restenosis may be a stenosis and/or restenosis of the esophagus. The stenosis and/or restenosis may be a stenosis and/or restenosis of the trachea. The stenosis and/or restenosis may be a stenosis and/or restenosis of the urethra. preferably a blood vessel, more preferably an artery. Preferably, the stenosis and/or restenosis is a stenosis and/or restenosis of a blood vessel, more preferably of an artery. Thus, the disease may be a vascular stenotic/restenotic lesion or a stenosis and/or restenosis in heart valves.
[0319] Non-limiting examples of a stenosis and/or restenosis of blood vessels include peripheral artery stenosis and/or restenosis, coronary artery stenosis and/or restenosis, carotid artery stenosis and/or restenosis which may predispose to (strokes and transient ischemic episodes) or renal artery stenosis and/or restenosis. Thus, the disease may be a peripheral artery stenosis and/or restenosis, coronary artery stenosis and/or restenosis or renal artery stenosis and/or restenosis.
[0320] The stenosis and/or restenosis may also be a stenosis and/or restenosis in heart valves. The stenosis in heart valves can be any stenosis and/or restenosis in heart valves. Examples of a stenosis and/or restenosis in heart valves includes the pulmonary valve stenosis and/or restenosis, mitral valve stenosis and/or restenosis, tricuspid valve stenosis and/or restenosis, aortic valve stenosis and/or restenosis.
[0321] Thus, the disease may be a pulmonary valve stenosis and/or restenosis, mitral valve stenosis and/or restenosis, tricuspid valve stenosis and/or restenosis, aortic valve stenosis and/or restenosis, preferably an aortic valve stenosis and/or restenosis.
[0322] Stenosis may also be a stenosis and/or restenosis of the esophagus. Smooth muscle cells also seem to play a role in esophageal stenosis Non-limiting examples include pyloric stenosis and/or restenosis or esophageal stricture.
[0323] Thus, the subject may also have been or may be afflicted with or be at risk of pyloric stenosis and/or restenosis or esophageal stricture.
[0324] Stenosis and/or restenosis may also be a stenosis and/or restenosis of the trachea. Such stenosis and/or restenosis are known to the skilled person. Non-limiting examples include subglottic stenosis or larygotracheal stenosis and/or restenosis. Thus, the disease may be subglottic stenosis or larygotracheal stenosis and/or restenosis.
[0325] Stenosis and/or restenosis may also be a stenosis and/or restenosis of the urethra. Non-limiting examples include urethral meatal stenosis and/or restenosis.
[0326] As used herein urethral meatal stenosis and/or restenosis may be any urethral meatal stenosis and/or restenosis. Thus, the disease is a urethral meatal stenosis and/or restenosis.
[0327] The disease may be a post-angioplasty restenosis (PARS). The restenosis may be an in-stent restenosis or ISR.
[0328] The use may comprise inhibiting or decreasing the migration of smooth muscle cells (SMCs), preferably by inhibiting or decreasing the migration of SMCs within the lumen of the anatomical structure compared to the migration present in the absence of the inhibitor. In particular, the migration of the SMCs may be inhibited or decreased/prevented by the TRPC6 inhibitor.
[0329] Especially, treatment or prevention may be achieved by applying a compound which inhibits the migration of smooth vascular muscle cells, thereby reducing the risk of neointimal hyperplasia/restenosis.
[0330] As such the term “treating” or “treatment” includes administration of a TRPC6 inhibitor, preferably in the form of a medicament, to a subject, defined elsewhere herein, suffering from a disease associated with neointima hyperplasia for the purpose of ameliorating or improving symptoms.
[0331] As used herein, the terms “prevent”, “prevention” or “prophylaxis”, and “preventing” refers to the reduction in the risk of acquiring or developing a disease associated with neointima formation. Also meant by “prophylaxis” is the reduction or inhibition of the recurrence of a disease associated with neointima formation.
[0332] In particular, the TRPC6 inhibitor can prevent neointima formation by inhibiting or decreasing the migration of smooth muscle cells (SMC). For example, the migration of SMCs to the site at risk of neointima formation or affected by neointima formation may be decreased or inhibited.
[0333] Preferably, “prevent” may mean that, after administration of the TRPC6 inhibitor, about 70%, 80%, 90%, 95% or 100% of the total SMCs are located in the media portion of the blood vessel wall, i.e. do not migrate in the sub endothelium of the blood vessel.
[0334] The migration of the SMCs can inter alia be determined by cell migration assays as defined elsewhere herein and described in the Examples.
[0335] A disease associated with neointima hyperplasia as used herein may refer to any disease that includes the risk of occurrence of neointimal hyperplasia.
[0336] Preferably, the disease may be restenosis or stenosis. It is envisioned that the TRPC6 inhibitor is systemically administered for treatment or prevention.
[0337] Thus, the TRPC6 inhibitor may be administered orally, parentally, intravenously, intraarterially or per orally. The systemic administration of a TRPC6 inhibitor may take place via pumping through a catheter. It is also contemplated that the TRPC6 inhibitor is administered via a medical device as disclosed herein. The medical device may be catheter. The medical device may be a stent. The medical device may be a balloon. The medical device may be a microcatheter. The medical device may be a bioabsorbable scaffold. Preferably, the medical device is a stent or a balloon. This administration may include inserting the medical device into a lumen of an anatomical structure of a subject, preferably to a site at risk of neointima hyperplasia or affected by neointima hyperplasia. For example, administration may include implanting a stent comprising a coating, wherein the coating comprises the TRPC6 inhibitor.
[0338] The TRPC6 inhibitor may be administered in a therapeutically effective amount.
[0339] It is further envisioned that the TRPC6 inhibitor is administered between 2 and 7 days after the vascular injury. It is also envisioned that the medical device is inserted between 2 and 7 days after the vascular injury.
[0340] The present invention also relates to a method of treating or preventing a disease associated with neointimal hyperplasia, said method comprising administering a TRPC6 inhibitor to a subject in need thereof.
[0341] The TRPC6 inhibitor may be administered in a therapeutically effective amount. The TRPC6 inhibitor may be administered to a subject in need thereof. It is also contemplated that the subject in need thereof is a subject at risk or affected by neointimal hyperplasia. The neointimal hyperplasia may be associated with the migration of smooth muscular cells.
[0342] The present invention also relates to a method of inhibiting migration of smooth muscle cells, said method comprising contacting the smooth muscle cells with a TRPC6 inhibitor and determining the migration of the smooth muscle cells compared to the migration of smooth muscle cells in the absence or before the contacting with the TRPC6 inhibitor.
[0343] It is envisioned that the migration of the smooth muscle cells is determined by scratch wound assay and/or by radius migration assay. The method may be an in vitro method.
[0344] The present invention also relates to a kit comprising the medical device as disclosed herein.
[0345] The present invention also relates to an in vitro test kit comprising:
(a) small muscle cells (SMCs); and
(b) a surface suitable for SMC cultivation coated with a TRPC6 inhibitor and
c) optionally a negative control.
[0346] The present invention also relates to a pharmaceutical composition comprising a TRPC6 inhibitor and a pharmaceutically acceptable excipient.
[0347] Therefore, the TRPC6 inhibitor may be in the form of orally administrable suspensions or tablets. Said orally administrable suspensions and tablets are prepared according to techniques available in the art of pharmaceutical formulation and may contain microcrystalline cellulose for imparting bulk, alginic acid or sodium alginate as a suspending agent, methylcellulose as a viscosity enhancer, and sweeteners/flavoring agents known in the art. As immediate release tablets, these compositions may contain microcrystalline cellulose, dicalcium phosphate, starch, magnesium stearate and lactose and/or other excipients, binders, extenders, disintegrants, diluents, and lubricants known in the art. The compound may also be administered as part of an injectable preparation (intravenously or intraarterially). The injectable solutions or suspensions may be formulated according to known art, using suitable non-toxic, parenterally acceptable diluents or solvents, such as mannitol, 1,3-butanediol, water, Ringer's solution or isotonic sodium chloride solution, or suitable dispersing or wetting and suspending agents, such as sterile, bland, fixed oils, including synthetic mono- or diglycerides, and fatty acids, including oleic acid.
[0348] It is further envisioned that the pharmaceutical composition additionally comprises at least one further drug. The further drug may be a mTOR-Inhibitor of the limus family (e.g. sirolimus, everolimus, biolimus, zotarolimus etc., preferably sirolimus). Alternatively or in addition, the further drug may be paclitaxel. The further drug may also be a anti-infectives such as antibiotics and antiviral agents, analgesics and analgesic combinations, anorexics and appetite suppressants, anthelmintics, anesthetics, antiarthritics, antiasthma agents, anticonvulsants, antidepressants, antidiabetic agents, antidiarrheals, antihistamines, anti-inflammatory agents, antimigraine preparations, antimotion sickness agents, antinauseants, antineoplastics, antiparkinsonism agents, antipruritics, antipsychotics, antipyretics, antispasmodics, anticholinergics, sympathomimetics, xanthine derivatives, cardiovascular preparations including calcium channel blockers, beta blockers, antiarrhythmics, antihypertensives, diuretics, vasodilators (general, coronary, peripheral and cerebral), central nervous system stimulants, cough and cold preparations, decongestants, diagnostics, hormones, hypnotics, immunosuppressives, muscle relaxants, parasympatholytics, parasympathomimetics, psychostimulants, sedatives, tranquilizers, antioxidants, vitamins, minerals, and herbal extracts or preparations.
[0349] It is further contemplated that the pharmaceutical composition is coated on a medical device. The medical device may be a catheter. The medical device may be a stent. The medical device may be a balloon. The medical device may be a microcatheter. The medical device may be a bioabsorbable scaffold. Preferably, the medical device is a stent or a balloon.
[0350] The present invention also relates to a pharmaceutical composition as disclosed herein for use in the treatment or prevention of a disease associated with neointimal hyperplasia, wherein the neointimal hyperplasia is associated with the migration of smooth muscular cells as also described elsewhere herein.
[0351] The present invention is further characterized by the following items:
[0352] 1. A medical device suitable for being inserted into the lumen of an anatomic structure of a subject, said medical device comprising means for administration of TRPC6 inhibitor, wherein said means comprises the TRPC6 inhibitor.
[0353] 2. The medical device of item 1, wherein the medical device is selected from the group consisting of a catheter, stent, a balloon, microcatheter or bioabsorbable scaffold.
[0354] 3. The medical device of item 1 or 2, wherein the medical device is a catheter.
[0355] 4. The medical device of item 1 or 2, wherein the medical device is a stent or a balloon.
[0356] 5. The medical device of any one of the preceding items, wherein the inserting of the medical device results in maintenance of/leads to holding open the lumen of the anatomical structure.
[0357] 6. The medical device of any one of the preceding items, wherein the lumen of the anatomic structure is a lumen of a blood vessel, the esophagus or urethra.
[0358] 7. The medical device of any one of the preceding items, wherein the lumen of the anatomic structure is a lumen of a blood vessel, preferably an artery.
[0359] 8. The medical device of any one of the preceding items, wherein the subject is a mammal, preferably a human.
[0360] 9. The medical device of any one of the preceding items, wherein subject is afflicted with or at risk of restenosis.
[0361] 10. The medical device of any one of the preceding items, wherein the restenosis is caused by neointima hyperplasia following endovascular procedures.
[0362] 11. The medical device of any one of the preceding items, wherein the restenosis is an in-stent restenosis or ISR.
[0363] 12. The medical device of any one of the preceding items, wherein, wherein the restenosis is a post-angioplasty restenosis or PARS.
[0364] 13. The medical device of any one of the preceding items, wherein the restenosis is measured by follow-up imaging or duplex ultrasound.
[0365] 14. The medical device of any one of the preceding items, wherein the follow-up imaging is angiography.
[0366] 15. The medical device of any one of the preceding items, wherein the restenosis causes recurrent chest pain (angina) or major heart attack (myocardial infarction).
[0367] 16. The medical device of any one of the preceding items, wherein the subject is at risk of or is afflicted with vascular injury.
[0368] 17. The medical device of any one of the preceding items, wherein the subject is at risk of or is afflicted with neointimal hyperplasia.
[0369] 18. The medical device of any one of the preceding items, wherein the neointimal hyperplasia is a thickened layer of intima of the blood vessel than the intima before neointima hyperplasia.
[0370] 19. The medical device of any one of the preceding items, wherein the subject has the rs2513192 single nucleotide polymorphism.
[0371] 20. The medical device of any one of the preceding items, wherein said means is a coating of the medical device.
[0372] 21. The medical device of any one of the preceding items, wherein the coating is localized at least at the surface of the medical device, which is in contact with the lumen of the anatomical structure.
[0373] 22. The medical device of any one of the preceding items, wherein the coating further comprises a polymer.
[0374] 23. The medical device of any one of the preceding items, wherein the polymer is selected from the group consisting of ethylene vinyl alcohol copolymer (commonly known by the generic name EVOH or by the trade name EVAL); poly(hydroxyvalerate); poly(L-lactic acid); polycaprolactone; poly(lactide-co-glycolide); poly(hydroxybutyrate); poly(hydroxybutyrate-co-valerate); polydioxanone; polyorthoester; polyanhydride; poly(glycolic acid); poly(D,L-lactic acid); poly(glycolic acid-co-trimethylene carbonate); polyphosphoester; polyphosphoester urethane; poly(amino acids); cyanoacrylates; poly(trimethylene carbonate); poly(iminocarbonate); copoly(ether-esters) (e.g., PEO/PLA); polyalkylene oxalates; polyphosphazenes; biomolecules, such as fibrin, fibrinogen, cellulose, starch, collagen and hyaluronic acid; polyurethanes; silicones; polyesters; polyolefins; polyisobutylene and ethylene-alphaolefin copolymers; acrylic polymers and copolymers; vinyl halide polymers and copolymers, such as polyvinyl chloride; polyvinyl ethers, such as polyvinyl methyl ether; polyvinylidene halides, such as polyvinylidene fluoride and polyvinylidene chloride; polyacrylonitrile; polyvinyl ketones; polyvinyl aromatics, such as polystyrene; polyvinyl esters, such as polyvinyl acetate; copolymers of vinyl monomers with each other and olefins, such as ethylene-methyl methacrylate copolymers, acrylonitrile-styrene copolymers, ABS resins, and ethylene-vinyl acetate copolymers; polyamides, such as Nylon 66 and polycaprolactam; alkyd resins; polycarbonates; polyoxymethylenes; polyimides; polyethers; epoxy resins; polyurethanes; rayon; rayon-triacetate; cellulose; cellulose acetate; cellulose butyrate; cellulose acetate butyrate; cellophane; cellulose nitrate; cellulose propionate; cellulose ethers; and carboxymethyl cellulose.
[0375] 24. The medical device of any one of the preceding items, wherein the coating further comprises a solvent.
[0376] 25. The medical device of any one of the preceding items, wherein the solvent is selected from the group consisting of N,N-dimethylacetamide (DMAC) having the formula CH.sub.3—CO—N(CH.sub.3).sub.2, N,N-dimethylformamide (DMFA) having the formula H—CO—N(CH.sub.3).sub.2, tetrahydrofuran (THF) having the formula C.sub.4H.sub.8O, dimethylsulfoxide (DMSO) having the formula (CH.sub.3).sub.2S—O, or trifluoro acetic anhydride (TFAA) having the formula (CF3—CO)2O, and mixture thereof; or wherein the solvent is selected from the group consisting of tetrahydrofuran, dichloromethane, chloroform, toluene, acetone, isooctane, 1,1,1,-trichloroethane, ethyl acetate, N-methylpyrrolidone (NMP), dimethylsulfoxide (DMSO), dimethylformamide (DMF), and dimethylacetamide (DMAC)), acetone/cyclohexanone solvent, and mixture thereof.
[0377] 26. The medical device of any one of the preceding items, wherein the administration is a local or systemic administration.
[0378] 27. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor has the following formula (I):
##STR00179##
wherein: [0379] R.sup.(I)1 and R.sup.(I)2 are each independently selected from the group consisting of halogen (preferably F, Cl, or Br), —CN and —NO.sub.2; and n.sup.(I) is 0, 1 or 2; or a pharmaceutically acceptable salt, solvate or hydrate thereof. [0380] The medical device of any one of the preceding items, wherein the TRPC6 inhibitor is
##STR00180##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0381] 29. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor is
##STR00181##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0382] 30. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor has the following formula (II):
##STR00182##
wherein:
R.sup.(II)1 and R.sup.(II)2 are each independently selected from the group consisting of —OH,
##STR00183##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0383] 31. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor is selected from the group consisting of
##STR00184## ##STR00185##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0384] 32. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor is
##STR00186##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0385] 33. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor has the following formula (III):
##STR00187##
wherein:
R.sup.(III)1 is independently selected from the group consisting of
##STR00188##
R.sup.(III)2 is independently selected from the group consisting of —H, —CH.sub.3 and halogen (preferably F, Cl, Br); and
R.sup.(III)3 is independently selected from the group consisting of
##STR00189##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0386] 34. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor is selected from the group consisting of
##STR00190## ##STR00191##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0387] 35. The medical device of any one of the preceding items, wherein the
[0388] TRPC6 inhibitor is
##STR00192##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0389] 36. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor is
##STR00193##
more preferably
##STR00194##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0390] 37. The medical device of any one of the preceding items, wherein the
[0391] TRPC6 inhibitor is
##STR00195##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0392] 38. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor is selected from the group consisting of
##STR00196## ##STR00197##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0393] 39. The medical device of any one of the preceding items, wherein the
[0394] TRPC6 inhibitor is
##STR00198##
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0395] 40. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor has the following formula (IV):
##STR00199##
wherein: [0396] L.sup.(IV) is absent or is methylene or ethylene; [0397] Y.sup.(IV) is CH or N; [0398] A.sup.(IV) is CH or N; [0399] R.sup.(IV)1 is selected from the group consisting of: [0400] C.sub.1-6alkyl optionally substituted with 1 to 3 groups independently selected from the group consisting of halo, C.sub.3-6cycloalkyl and OC.sub.3-6cycloalkyl; [0401] phenyl optionally substituted with 1 to 3 groups independently selected from the group consisting of CF.sub.3, halo, C.sub.3-6cycloalkyl, OC.sub.3-6cycloalkyl, OC.sub.1-6alkyl optionally substituted with one to three halo; and [0402] C.sub.3-6cycloalkyl optionally substituted with 1 to 3 groups independently selected from the group consisting of halo and C.sub.1-6alkyl optionally substituted with 1 to 3 halo; [0403] R.sup.(IV)2 is selected from the group consisting of H, C.sub.1-6alkyl, OCF.sub.3, C.sub.3-6cycloalkyl, OC.sub.1-6alkyl; OC.sub.3-6cycloalkyl; [0404] R.sup.(IV)3 is selected from the group consisting of H, C.sub.1-6alkyl, C.sub.3-6cycloalkyl, OC.sub.3-6cycloalkyl; wherein each of the C.sub.1-6alkyl, C.sub.3-6cycloalkyl, OC.sub.3-6cycloalkyl of the R.sup.(IV)3 group may be optionally substituted with one to three groups each independently selected from the group consisting of halo, OH, OC.sub.1-6alkyl, SC.sub.1-6alkyl, N(C.sub.1-6alkyl).sub.2; and wherein one to three carbon atoms of the C.sub.1-6alkyl of the R.sup.(IV)3 group may optionally be replaced by one or two moieties selected from the group consisting of NH, (NC.sub.1-6alkyl), O, and S; [0405] R.sup.(IV)4 and R.sup.(IV)5 are each independently selected from the group consisting of H or C.sub.1- 6alkyl; [0406] R.sup.(IV)3 and R.sup.(IV)5 can together with the atom to which they are attached join to form a 3 to 9-membered carbocyclyl ring which optionally may contain one to three heteroatoms selected from the group consisting of N, O, and S; or [0407] R.sup.(IV)3 and R.sup.(IV)5 can together form a 3 to 9-membered bicyclic ring which optionally may contain one to three heteroatoms selected from the group consisting of N, O, and S; [0408] R.sup.(IV)6 is selected from the group consisting of H, C.sub.1-6alkyl, CN, CF.sub.3, OCF.sub.3, C.sub.3- 6cycloalkyl, OC.sub.1-6alkyl, and OC.sub.3-6cycloalkyl; [0409] R.sup.(IV)7 is selected from the group consisting of H and OC.sub.1-6alkyl; [0410] or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0411] 41. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor is selected from the group consisting of compounds 1 to 95 in the Table below:
TABLE-US-00001 Cpd No. Structure Compound Name 1
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0412] 42. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor has the following formula (V):
##STR00295##
wherein: [0413] Y.sup.(V) is CH or N; [0414] A.sup.(V) is CH or N; [0415] R.sup.(V)1 is H, C.sub.1-3alkyl, or OC.sub.1-3alkyl; [0416] R.sup.(V)2 is H, C.sub.1-3alkyl or C.sub.3-6cycloalkyl wherein each of the C.sub.1-3alkyl or C.sub.3-6cycloalkyl of the R.sup.2 group may be optionally substituted with OH, halo or OC.sub.1-3alkyl; [0417] R.sup.(V)3 is H or C.sub.1-3alkyl; [0418] R.sup.(V)2 and R.sup.(V)3 together with the carbon to which they are attached may optionally join to form a 3- to 6-membered carbocyclic ring; [0419] R.sup.(V)4 represents [0420] C.sub.1-6alkyl which may optionally be substituted with one to three groups independently selected from the group consisting of halo, [0421] C.sub.3-6cycloalkylmethyl and C.sub.3-6cycloalkylethyl, where the C.sub.3-6cycloalkyl of the C.sub.3- 6cycloalkylmethyl and C.sub.3-6cycloalkylethyl may optionally be substituted with one to three groups independently selected from the group consisting of halo and methyl, [0422] 1,2,3-thiadiazoylmethyl, thiazoylmethyl, isoxazolylmethyl or [0423] a group of formula
##STR00296##
wherein n.sup.(V) is 0 or 1; [0424] R.sup.(V)5 is selected from the group consisting of H, halo, CF.sub.3, OCF.sub.3, CN, C.sub.1-3alkyl, OC.sub.1- 3alkyl, C.sub.3-6cycloalkyl; wherein each of the C.sub.1-3alkyl and OC.sub.1-3alkyl of the R.sup.(V)5 groups may optionally be substituted with one to three groups each independently selected from the group consisting of halo, oxo, NH.sub.2, NH(C.sub.1-3alkyl), and N(C.sub.1-3alkyl).sub.2; [0425] R.sup.(V)6 is selected from the group consisting of H, halo, C.sub.1-3alkyl, and OC.sub.1-3alkyl;
wherein [0426] R.sup.(V)5 and R.sup.(V)6 may join to form a 5- or 6-membered carbocyclic ring wherein one or two carbon atoms of the 5- or 6-membered carbocyclic ring may optionally be replaced by one or two oxygen atoms; [0427] R.sup.(V)7 is selected from the group consisting of H, halo, C.sub.1-3alkyl and OC.sub.1-3alkyl, wherein the C.sub.1-3alkyl of the R.sup.(V)7 group may optionally be substituted with one to three substituents selected from the group consisting of halo; [0428] R.sup.(V)8 is selected from the group consisting of H and halo; [0429] R.sup.(V)9 is H or C.sub.1-3alkyl; wherein [0430] R.sup.(V)2 and R.sup.(V)9 may join to form a bicyclic ring; [0431] R.sup.(V)10 is H or C.sub.1-3alkyl; [0432] or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0433] 43. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor is selected from the group consisting of compounds 1 to 54 in the Table below:
TABLE-US-00002 Cpd No. Structure Structure Name 1
or a pharmaceutically acceptable salt, solvate or hydrate thereof.
[0434] 43a. The medical device of any one of the preceding items, wherein the TRPC6 inhibitor is BI 764198.
[0435] 44. A method of manufacturing a medical device suitable for being inserted into the lumen of an anatomic structure of a subject, wherein the method comprises contacting the surface of the medical device with a coating composition comprising a TRPC6 inhibitor.
[0436] 45. The method of item 44, wherein the medical device is a medical device as defined in any one of the preceding items.
[0437] 46. The method of item 44 or 45, wherein a surface of the medical device is contacted with the coating composition by dip coating or spray coating.
[0438] 47. The method of any one of items 44-46, wherein the TRPC6 inhibitor is as defined in any one of the preceding items.
[0439] 48. A medical device obtainable or being obtained by a method of any one of items 44 to 47.
[0440] 49. A TRPC6 inhibitor for use in the treatment or prevention of a disease associated with neointimal hyperplasia, wherein the neointimal hyperplasia is associated with the migration of smooth muscular cells.
[0441] 50. The TRPC6 inhibitor for use of items 49, said use comprising inhibiting or decreasing the migration of smooth muscle cells (SMCs), preferably by inhibiting or decreasing the migration of SMCs within the lumen of the anatomical structure compared to the migration present in the absence of the inhibitor.
[0442] 51. The compound for use of item 49 or 50, wherein the TRPC6 inhibitor is a TRPC6 inhibitor as defined in any one of the preceding items.
[0443] 52. The TRPC6 inhibitor for use of any one of items 49-51, wherein the TRPC6 inhibitor is administered systemically.
[0444] 53. The TRPC6 inhibitor for use of any one of items 49-52, wherein the TRPC6 inhibitor is administered orally, parentally, intravenously, intraarterially, per oral, etc.
[0445] 54. The TRPC6 inhibitor for use of any one of items 49-53, wherein said TRPC6 inhibitor is administered via a medical device, said medical device comprising means for administration of the TRPC6 inhibitor, optionally wherein the medical device is a medical device as defined in any one of the preceding items.
[0446] 55. The TRPC6 inhibitor for use of any one of items 49-54, wherein the medical device is inserted into a the lumen of an anatomical structure of a subject to a site at risk of neointima hyperplasia or affected by neointima hyperplasia, preferably wherein the medical device is a stent comprising a coating, said coating comprising the TRPC6 inhibitor.
[0447] 56. The TRPC6 inhibitor for use of any one of items 49-55, wherein the disease is restenosis.
[0448] 57. The TRPC6 inhibitor for use of any one of items 49-56, wherein said use comprises dilating the lumen of an anatomic structure of the subject at the site at risk of neointima formation or affected by neointima formation, preferably by using a balloon comprising a coating, said coating comprising the TRPC6 inhibitor.
[0449] 58. The TRPC6 inhibitor for use of any one of items 49-57, wherein said use comprises administering the TRPC6 inhibitor between 2 and 7 days after the vascular injury.
[0450] 59. The TRPC6 inhibitor for use of any one of items 49-58, wherein said use comprises inserting the medical device between 2 and 7 days after the vascular injury.
[0451] 60. The TRPC6 inhibitor for use any one of items 49-59, said use comprising inhibiting the migration of smooth muscle cells (SMCs) within the lumen of the anatomical structure compared to the migration present in the absence of the inhibitor.
[0452] 61. A method of treating or preventing a disease associated with neointimal hyperplasia, said method comprising administering a TRPC6 inhibitor to a subject in need thereof.
[0453] 62. The method of item 61, wherein the TRPC6 inhibitor is administered systemically to the subject.
[0454] 63. The method of claim 61, wherein the TRPC6 inhibitor is administered via a medical device, said medical device comprising means for administration of the TRPC6 inhibitor, optionally wherein the medical device is a medical device as defined in any one of the preceding items.
[0455] 64. The method of item 63, wherein the medical device is inserted into a the lumen of an anatomical structure of a subject, preferably to a site at risk of neointima formation or affected by neointima formation.
[0456] 65. The method of any one of items 61-64, wherein the TRPC6 inhibitor is administered in a therapeutically effective amount.
[0457] 66. The method of any one of items 61-65, wherein the TRPC6 inhibitor is administered to a subject in need thereof.
[0458] 67. The method of any one of items 61-66, wherein the subject in need thereof is a subject at risk or affected by neointimal hyperplasia.
[0459] 68. The method of any one of items 61-67, wherein the neointimal hyperplasia is associated with the migration of smooth muscular cells.
[0460] 69. A method of inhibiting migration of smooth muscle cells, said method comprising contacting the smooth muscle cells with a TRPC6 inhibitor and determining the migration of the smooth muscle cells compared to the migration of smooth muscle cells in the absence or before the contacting with the TRPC6 inhibitor.
[0461] 70. The method of item 69, wherein the migration of the smooth muscle cells is determined by scratch wound assay.
[0462] 71. The method of item 69 or 70, wherein the migration of the smooth muscle cells is determined by radius migration assay.
[0463] 72. The method of any one of items 69 to 71, wherein the method is an in vitro method.
[0464] 73. A kit comprising the medical device as defined in any one of the preceding items.
[0465] 74. An in vitro test kit comprising: [0466] (a) small muscle cells (SMCs); [0467] (b) a surface suitable for SMC cultivation coated with a TRPC6 inhibitor.
[0468] 75. The kit of item 74, wherein the kit further includes a negative control.
[0469] 76. A pharmaceutical composition comprising a TRPC6 inhibitor and a pharmaceutically acceptable carrier.
[0470] 77. The pharmaceutical composition of item 76 comprising a TRPC6 inhibitor as defined in any one of the preceding items.
[0471] 78. The pharmaceutical composition of item 76 or 77, wherein the pharmaceutical composition additionally comprises at least one further drug.
[0472] 79. The pharmaceutical composition of any one of items 76-78, wherein the at least one further drug is selected from the group consisting of paclitaxel and an mTOR inhibitor such as e.g. sirolimus, everolimus, biolimus, zotarolimus.
[0473] 80. The pharmaceutical composition of any one of items 76-79, wherein the pharmaceutical composition is coated on a medical device.
[0474] 81. The pharmaceutical composition of any one of items 76-80 for use in the treatment or prevention of a disease associated with neointimal hyperplasia, wherein the neointimal hyperplasia is associated with the migration of smooth muscular cells.
[0475] 82. The pharmaceutical composition of any one of items 76-81, said use comprising inhibiting or decreasing the migration of smooth muscle cells (SMCs), preferably by inhibiting or decreasing the migration of SMCs within the lumen of the anatomical structure compared to the migration present in the absence of the inhibitor.
[0476] Unless otherwise stated, the following terms used in this document, including the description and claims, have the definitions given below.
[0477] Those skilled in the art will recognize, or be able to ascertain, using not more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.
[0478] It is to be noted that as used herein, the singular forms “a”, “an”, and “the”, include plural references unless the context clearly indicates otherwise. Thus, for example, reference to “a reagent” includes one or more of such different reagents and reference to “the method” includes reference to equivalent steps and methods known to those of ordinary skill in the art that could be modified or substituted for the methods described herein.
[0479] Unless otherwise indicated, the term “at least” preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.
[0480] The term “and/or” wherever used herein includes the meaning of “and”, “or” and “all or any other combination of the elements connected by said term”.
[0481] The term “about” or “approximately” as used herein means within 20%, preferably within 10%, and more preferably within 5% of a given value or range. It includes, however, also the concrete number, e.g., about 20 includes 20.
[0482] Throughout this specification and the claims which follow, unless the context requires otherwise, the word “comprise”, and variations such as “comprises” and “comprising”, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. When used herein the term “comprising” can be substituted with the term “containing” or “including” or sometimes when used herein with the term “having”.
[0483] When used herein “consisting of” excludes any element, step, or ingredient not specified in the claim element. When used herein, “consisting essentially of” does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim.
[0484] In each instance herein any of the terms “comprising”, “consisting essentially of” and “consisting of” may be replaced with either of the other two terms.
[0485] It should be understood that this invention is not limited to the particular methodology, protocols, material, reagents, and substances, etc., described herein and as such can vary. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention, which is defined solely by the claims.
[0486] All publications cited throughout the text of this specification (including all patents, patent applications, scientific publications, manufacturer's specifications, instructions, etc.) are hereby incorporated by reference in their entirety. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention. To the extent the material incorporated by reference contradicts or is inconsistent with this specification, the specification will supersede any such material.
[0487] The following sequence has been used in the present invention:
TABLE-US-00003 SEQ ID What Sequence 1 Uniprot MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDS no. ELGEDGCPQAPLPCYGYYPCFRGS Q9Y210| DNRLAHRRQTVLREKGRRLANRGPAYMFSDRSTSLS HUMAN IEEERFLDAAEYGNIPVVRKMLEE Short CHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKE transient NLSRVGDALLLAISKGYVRIVEAI receptor LSHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRF potential SHDVTPIILAAHCQEYEIVHTLLR channel KGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINA 6 YKGLASPAYLSLSSEDPVMTALEL SNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLC RNTEEVEAILNGDVETLQSGDHGR PNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLS GLRQQTMAVKFLVVLAVAIGLPFL ALIYWFAPCSKMGKIMRGPFMKFVAHAASFTIFLGL LVMNAADRFEGTKLLPNETSTDNA KQLFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQ GPKEYLFELWNMLDFGMLAIFAAS FIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNV KYYNLARIKWDPSDPQIISEGLYA IAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFK FMVIFIMVFVAFMIGMFNLYSYYI GAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYN HKFIENIGYVLYGVYNVTMVIVLL NMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEE GRTLPVPFNLVPSPKSLFYLLLKL KKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSH EDLSKLSLDKKQVGHNKQPSIRSS EDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKES DEVNEGELKEIKQDISSLRYELLE EKSQNTEDLAE LIRELGEKLSMEPNQEETNR
EXAMPLES
Example 1
[0488] Wire-Induced Femoral Artery Injury
[0489] All animal studies were performed with permission of the government of Upper Bavaria (55.2-1-54-2532-17-14) and according to international guidelines. Wire injury was performed in in 8 to 12 weeks old C57BL/6J (Jackson Laboratories, Bar Habor, Me., USA) and Trpc6.sup.-/- mice which have been described previously (59). Wire-injury was performed in 8 to 12 weeks old C57BL/6J mice as described previously (60). In brief, after skin incision, the left femoral artery was exposed by blunt dissection and a 0.38 mm guidewire (No. C-SF-15-15, COOK, Bloomington, Ind., USA) was inserted towards the iliac artery. To denude and dilate the femoral artery, the wire was left in place for 1 minute. Surgery was carried out using a dissection microscope (Stemi200C, Zeiss, Jena, Germany). Mice were sacrificed after 3, 7, or 14 days by intraperitoneal administration of an overdose of pentobarbital. To avoid blood inside the femoral arteries mice were perfused with PBS via the left ventricle and the descending aorta. Both femoral arteries (injured and non-injured) were carefully removed, snap-frozen in liquid nitrogen and stored at −80° C. until further analysis. For histological analyses, femoral arteries were fixed in 4% paraformaldehyde.
[0490] Histology and Morphometry
[0491] Femoral arteries were embedded in paraffin. 2 μm serial cross-sections were cut starting from the ligation as reference point using a microtome (HM 340E, Thermo Fisher Scientific, Waltham, Mass., USA). Sections were mounted on microscope slides, deparaffinized and rehydrated in graded alcohol. Ten to 15 sections per femoral artery at 25 μm intervals were stained with haematoxylin and eosin and embedded in pertex (Medite Cancer Diagnostics, Chicago, Ill., USA). Stained tissue sections were digitalized (Leica DMRB and Leica DFC450C, Leica Camera AG, Wetzlar, Germany) and morphometrically analyzed by an investigator blinded to Trpc6 genotype using ImageJ v. 1.47. Lumen area as well as circumferences of the internal (IEL) and external elastic lamina (EEL) were measured. Intima and media area as well as neointima/media ratio were calculated.
[0492] Immunoblotting
[0493] Trpc6 protein expression was analyzed in non-injured and injured (3, 7 or 14 days) femoral arteries of C57BL/6J mice. Snap-frozen femoral arteries were manually disrupted in 40 μl radioimmunoprecipitation assay (RIPA) buffer (Cell Signaling Technology, Denvers, Mass., USA). After 3×30 s of sonification cell lysate was separated from cell debris by centrifugation at 4° C. Protein concentration was determined using a BCA assay (Pierce, Thermo Fisher, Schwerte, Germany). Laemmli buffer (4x, Sigma-Aldrich, St. Louis, Mo., USA) was added and the mixture was incubated at 95° C. for 5min. 10 μg protein of each sample was loaded on a 4-20% gradient gel. Gel electrophoresis was performed using a Mini-PROTEAN Tetra Cell system (Bio-Rad Laboratories, Hercules, Calif., USA) and immunoblotting was performed using a transfer system (Trans-Blot® Turbo, Bio-Rad Laboratories, Hercules, Calif., USA) according to the manufacturer's instructions. After blocking with 5% low fat milk in phosphate buffered saline with Tween (PBST), membranes were incubated overnight at 4° C. with the primary anti-Trpc6 antibody (rabbit AK 861 affinity purified, 1:200 (66)). Membranes were washed with PBST three times for 5min and anti-rabbit IgG-HRP linked secondary antibody (Cell Signaling Technology, Danvers, Mass., USA, 7074S, 1:100,000) was applied for 1h at room temperature. Membranes were rinsed with PBST three times for 10min and incubated with enhanced chemiluminescence substrate (Thermo Fisher Scientific SuperSignal West Dura Extended Duration Substrate; Life Technologies, Carlsbad, Calif., USA). An ImageQuant LAS 4000 system (GE Healthcare Life Sciences, Pittsburgh, Pa., USA) was used for luminescence detection. Signal intensities were quantified using ImageQuant TL (GE Healthcare Life Sciences, Pittsburgh, Pa., USA) and normalized to signal intensities for Gapdh in the same sample.
[0494] Cell Culture
[0495] Human aortic smooth muscle cells (hAoSMC) were purchased from PromoCell (Heidelberg, Germany) and cultured at 37° C. in a humidified 5% CO.sub.2 atmosphere in the recommended cell culture medium (PromoCell, Heidelberg, Germany).
[0496] Cell Migration Assay
[0497] For scratch wound assays, cells were seeded in 24 well plates at a density of 100,000 cells per well. After they had grown to confluence for 24 h the cell monolayer was scratched in the middle with a 200 μl pipette tip. Cells were washed with PBS and incubated in growth medium supplemented with OAG (Sigma-Aldrich, St. Louis, Mo., USA) at final concentration of 100 μM or SAR 7334 (Bio-Techne, Wiesbaden, Germany) at a final concentration of 100 μM. 1% DMSO was used as control. Wound area was measured directly after the scratch (t.sub.0) and after 6 h (t.sub.1), 8 h (t.sub.2) and 12 h (t.sub.3) with a phase-contrast microscope (Axiovert 100, Zeiss, Oberkochen, Germany) and assessed with ImageJ version 1.47v. Wound reclosure was measured as Δt.sub.0-t.sub.1 (6 h), Δt.sub.0-t.sub.2 (8 h), and Δt.sub.0-t.sub.3 (12 h) in pixels. Scratch assays were performed in triplicates. For radius assays, 24-well plates were coated with gelatin solution (Pelobiotech, Planegg, Germany). Culture cylinders (total diameter 4 mm, inner diameter 2 mm; Bioptechs, Butler, Pa., USA) were then placed in the middle of the well and cells were seeded at a density of 100,000 cells per well around the cylinders. 20 μL of SAR 7334 with a final concentration of 100 nM in gelatin were added to the inner of the cylinders. 1% DMSO was used as control. After 24 h of incubation cylinders were removed and pictures were acquired immediately (t.sub.0) and after 48 h (t.sub.1) using a phase-contrast microscopy system (Axiovert 100, Zeiss, Oberkochen, Germany). Wound reclosure was measured as Δt.sub.0-t.sub.1 (48 h) in pixels. Measurements were performed in duplicates.
[0498] Cell Proliferation Assay
[0499] Cell proliferation was assessed using of a colorimetric bromodeoxyuridine (BrdU) enzyme-linked immunosorbent assay (ELISA) according to manufacturer's protocol (Roche Applied Science, Penzberg, Germany). Briefly, cells were seeded in 96 well plates at a density of 10,000 cells per well in starving medium, i.e., lacking FBS and growth factors. After 24 h, the starving medium was replaced by growth medium which was either supplemented with 1-Oleoyl-2-acetyl-sn-glycerol (OAG; Sigma-Aldrich, St. Louis, Mo., USA) at a final concentration of 100 μM, SAR 7334 (Tocris Bioscience, Bristol, UK) at a final concentration of 100 nM or with 1% of DMSO which was used as vehicle. After incubation for another 24 h, 10 μl of BrdU solution were added. Absorbance was measured at 370 nm with a reference wavelength of 492 nm in the Infinite M200 PRO microplate reader using the iControl v1.10 software (both Tecan Group, Männedorf, Switzerland) after further 24 h. Measurements were performed in triplicates.
[0500] Analysis of Binary Restenosis and Late Lumen Loss in Humans
[0501] Available genotyping data from previous genome-wide association studies and subsequent analyses (67, 68) were used to correlate rs2513192 genotype and risk of binary restenosis. Rs2513192 genotype was available in 4,247 individuals and 6,028 lesions. Characteristics are depcited in table S2. Information on binary restenosis, defined as a diameter reduction of 50% or more, was available in 3,068 (72.2%) individuals (one or more lesions with binary restenosis) and 4,279 (71%) lesions. A logistic regression model with computation of odds ratios (OR) and 95% Confidence Intervals (CI) was used to assess the association of rs2513192 genotype with the primary endpoint binary restenosis. To avoid overfitting, selection of covariates in the logistic regression model was performed using the least absolute shrinkage and selection operator regression method after entering all baseline and procedural characteristics as candidates (R package “glmnet”, version 2.0-13). The resulting variables for the logistic regression model were age, gender, body mass index, diabetes mellitus, hypertension, smoking status, hypercholesterolemia, previous myocardial infarction, previous coronary artery bypass graft surgery, clinical presentation with acute coronary syndrome, multivessel disease, lesion complexity, chronic occlusion, restenotic lesion, lesion length, reference diameter before stent implantation, stenosis before implantation, implantation of drug eluting stents as well as total stented length.
[0502] Statistical Analyses
[0503] Distribution of data was assessed using Kolmogorov-Smirnov test. Unless otherwise stated, normally distributed data was analyzed using Student's unpaired/paired t-test. Not normally distributed data was analyzed with Mann-Whitney-test. Categorical data was analyzed using chi-square test. P-values<0.05 were regarded significant. GraphPad Prism version 8.0.1 for Mac OS X (GraphPad Software, La Jolla, Calif., USA) was used.
Example 2
[0504] Expression of Trpc6 in the femoral artery of the mouse after vascular damage. NI, non-injured (undamaged vessel), 3d/7d/14d, 3/7/14 days after vessel damage; a.u., arbitrary units; Gapdh, loading control.
Example 3
[0505] Cell Migration Assay
[0506] For scratch wound assays, cells were seeded in 24 well plates at a density of 100,000 cells per well. After they had grown to confluence for 24 h the cell monolayer was scratched in the middle with a 200 μl pipette tip. Cells were washed with PBS and incubated in growth medium supplemented with OAG (Sigma-Aldrich, St. Louis, Mo., USA) at final concentration of 100 μM or SAR 7334 (Bio-Techne, Wiesbaden, Germany) at a final concentration of 100 nM. 1% DMSO was used as control. Wound area was measured directly after the scratch (t0) and after 6 h (t1), 8 h (t2) and 12 h (t3) with a phase-contrast microscope (Axiovert 100, Zeiss, Oberkochen, Germany) and assessed with ImageJ version 1.47v. Wound reclosure was measured as Δt0-t1 (6 h), Δt0-t2 (8 h), and Δt0-t3 (12 h) in pixels. Scratch assays were performed in triplicates. For radius assays, 24-well plates were coated with gelatin solution (Pelobiotech, Planegg, Germany). Culture cylinders (total diameter 4 mm, inner diameter 2 mm; Bioptechs, Butler, Pa., USA) were then placed in the middle of the well and cells were seeded at a density of 100,000 cells per well around the cylinders. 20 μL of SAR 7334 with a final concentration of 100 nM in gelatin were added to the inner of the cylinders. 1% DMSO was used as control. After 24 h of incubation cylinders were removed and pictures were acquired immediately (t0) and after 48 h (t1) using a phase-contrast microscopy system (Axiovert 100, Zeiss, Oberkochen, Germany). Wound reclosure was measured as Δt0-t1 (48 h) in pixels. Measurements were performed in duplicates.
Example 4
[0507] Analysis of Binary Restenosis and Late Lumen Loss in Humans
[0508] Available genotyping data from previous genome-wide association studies and subsequent analyses (67, 68) were used to correlate rs2513192 genotype and risk of binary restenosis. Rs2513192 genotype was available in 4,247 individuals and 6,028 lesions. Characteristics are depcited in table S2. Information on binary restenosis, defined as a diameter reduction of 50% or more, was available in 3,068 (72.2%) individuals (one or more lesions with binary restenosis) and 4,279 (71%) lesions. A logistic regression model with computation of odds ratios (OR) and 95% Confidence Intervals (CI) was used to assess the association of rs2513192 genotype with the primary endpoint binary restenosis. To avoid overfitting, selection of covariates in the logistic regression model was performed using the least absolute shrinkage and selection operator regression method after entering all baseline and procedural characteristics as candidates (R package “glmnet”, version 2.0-13). The resulting variables for the logistic regression model were age, gender, body mass index, diabetes mellitus, hypertension, smoking status, hypercholesterolemia, previous myocardial infarction, previous coronary artery bypass graft surgery, clinical presentation with acute coronary syndrome, multivessel disease, lesion complexity, chronic occlusion, restenotic lesion, lesion length, reference diameter before stent implantation, stenosis before implantation, implantation of drug eluting stents as well as total stented length.
Example 5
[0509] Manufacture of a Stent Comprising a Coating with a TRPC6 Inhibitor
[0510] TRPC6 inhibitor SAR7334 was dissolved in a solvent (e.g. dichloromethane or tetrahydrofuran) to give a coating composition comprising SAR7334 in a concentration of 1% by weight based on 100% by weight of the coating composition. A stainless steel microporous coronary stent was dipped into the coating composition in order to prepare a coating via dip coating. After removing from the coating composition, the stent was dried in a stream of warm air to give a coating on the stent, wherein the TRPC6 inhibitor SAR 7334 is localized on the surface and/or in pores of the stent. Alternatively, the stent may be coated by spray coating, e.g. using the stent-coating machine described by Wessely and coworkers (Wessely R. et al., 2005, Arterioscler Thromb Vasc Biol 25: 748 — 753, also see above).