GENETIC MODIFICATION OF MAMMALIAN CELLS TO CONFER RESISTANCE TO CSF1R ANTAGONISTS
20230203500 · 2023-06-29
Inventors
- Mathew Blurton-Jones (Irvine, CA, US)
- Jean Paul Chadarevian (Irvine, CA, US)
- Robert Spitale (Irvine, CA, US)
- Sunil Gandhi (Irvine, CA, US)
- Whitney England (Irvine, CA, US)
- Hayk Davtyan (Irvine, CA, US)
- Jonathan Hasselmann (Irvine, CA, US)
Cpc classification
A61K35/30
HUMAN NECESSITIES
A61K31/713
HUMAN NECESSITIES
A61K9/0019
HUMAN NECESSITIES
C12N2320/32
CHEMISTRY; METALLURGY
C12N2310/20
CHEMISTRY; METALLURGY
C12N2506/45
CHEMISTRY; METALLURGY
A61K31/444
HUMAN NECESSITIES
C12N15/11
CHEMISTRY; METALLURGY
C12N5/0622
CHEMISTRY; METALLURGY
C12N15/1138
CHEMISTRY; METALLURGY
International classification
C12N15/113
CHEMISTRY; METALLURGY
A61K31/713
HUMAN NECESSITIES
Abstract
Microglia/monocytes exist within a ‘niche’ which limits the total number of microglia/monocytes/macrophages that reside within a mammalian central nervous system (CNS). Therefore, methods are needed that can help therapeutically modify microglia, monocytes, and macrophages or the cells that give rise to them to compete with endogenous microglia and partially or completely occupy the CNS niche. The present disclosure features therapeutic microglia, monocytes, or macrophages that have a selective advantage in comparison to endogenous brain resident microglia in their response to CSF1R inhibitors. Specifically, therapeutic cells developed in the present disclosure do not die at a given dose of CSF1R inhibitor that is sufficient to kill endogenous microglia. The therapeutic cells described herein can be used to treat neurological diseases.
Claims
1. A modified human cell comprising a polynucleotide comprising a nucleic acid sequence encoding a modified CSF1R protein consisting of SEQ ID NO: 4 or SEQ ID NO: 6, wherein the modified CSF1R protein a) binds to ATP, b) is activated by a CSF1R ligand that induces phosphorylation of the modified CSF1R protein, and c) is resistant to inhibition by PLX3397, PLX5562, Edicotinib or BLZ945 when compared to a CSF1R protein consisting of the amino acid sequence of SEQ ID NO: 2.
2. The modified human cell of claim 1, wherein the modified human cell is an induced pluripotent stem cell (iPSC), a hematopoietic stem cell (HSC), an erythromyeloid progenitor cell, or a hematopoietic progenitor cell.
3. The modified human cell of claim 1, wherein the modified human cell is an iPSC-derived microglia cell.
4. The modified human cell of claim 3, further comprising a transgene that is not otherwise expressed by the CSF1R-expressing cell.
5. An in vitro cell population comprising a plurality of cells, wherein at least 80% of the plurality of cells are the modified human cell of claim 3.
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWING(S)
[0019] The features and advantages of the present disclosure will become apparent from a consideration of the following detailed description presented in connection with the accompanying drawings in which:
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
DETAILED DESCRIPTION OF THE DISCLOSURE
[0032] Although embodiments of the disclosure have been described in detail, certain variations and modifications will be apparent to those skilled in the art, including embodiments that do not provide all the features and benefits described herein. It will be understood by those skilled in the art that the present disclosure extends beyond the specifically disclosed embodiments to other alternative or additional embodiments and/or uses and obvious modifications and equivalents thereof. Moreover, while a number of variations have been shown and described in varying detail, other modifications, which are within the scope of the present disclosure, will be readily apparent to those of skill in the art based upon this disclosure. It is also contemplated that various combinations or sub-combinations of the specific features and aspects of the embodiments may be made and still fall within the scope of the present disclosure. Accordingly, it should be understood that various features and aspects of the disclosed embodiments can be combined with or substituted for one another in order to form varying modes of the present disclosure. Thus, it is intended that the scope of the present disclosure herein disclosed should not be limited by the particular disclosed embodiments described herein.
[0033] As used herein, the singular forms “a,” “an,” and “the” are intended to include the plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the terms “including,” “includes,” “having,” “has,” “with,” or variants thereof are used in either the detailed description and/or the claims, such terms are intended to be inclusive in a manner similar to the term “comprising.”
[0034] Terms
[0035] As used herein, a “CSF1R expressing cell” may refer to cells that express CSF1R or cells that may be induced to express CSF1R or cells that are differentiated into cells that express CSF1R. Non-limiting examples of CSF1R-expressing cells may include but are not limited to microglia, monocytes, HSPCs (hematopoietic stem or progenitor cells), macrophages, dendritic cells, Langerhans cells, Kupffer cells, Hofbauer cells, Extravillous trophoblasts, phagocytes, or primitive macrophages from pluripotent stem cells. Additionally, a CSF1R expressing cell may refer to microglia that has been directly reprogrammed from iPSCs, monocytes, or fibroblasts via either genetic or small molecule approaches.
[0036] As used herein, “CSF1R expressing phagocyte” may refer to a cell that expresses the CSF1R receptor and has the capacity for phagocytosis; the process by which a cell uses its plasma membrane to engulf extracellular particles or bacteria, substrates, proteins, lipids, or aggregates and then internalizes this region to form a phagosome. Non-limiting examples of CSF1R-expressing phagocytes may include but are not limited to microglia, macrophages, monocytes, dendritic cells, or other phagocytes. In some embodiments, a CSF1R-expressing phagocyte is a CSF1R-expressing cell.
[0037] As used herein, “differential resistance” may refer to a state occurring in a modified cell in which the inhibition by a CSF1R antagonist of a CSF1R signal exhibits a different dose-response relationship or magnitude of response than is observed in an unmodified cell. In other embodiments, differential resistance may refer to altering the proliferation or survival of an unmodified CSF1R-expressing cell relative to the modified CSF1R-expressing cell. In some embodiments, differential resistance may comprise a partial, complete, increased, or decreased resistance to a CSF1R antagonist.
[0038] As used herein, “CSF1R signal inhibition” may refer to a dose-dependent reduction caused by a CSF1R antagonist in a step of a CSF1R signaling cascade, such as phosphorylation or dephosphorylation events, gene expression, etc.
[0039] As used herein, “partial resistance” refers to modified cells that are still destroyed by higher doses of CSF1R antagonist. Partial resistance could be due to increased binding constant (Kd) or ATP, reduced kinase activity, reduced binding affinity to CSF1 ligand, or reduced signal transduction.
[0040] As used herein, “complete resistance” refers to modified cells in which CSF1R signal inhibition never occurs at any concentration of the antagonist.
[0041] As used herein, an “increased resistance” refers to modified cells in which CSF1R signal inhibition occurs at an increased concentration of the antagonist relative to what is observed in unmodified cells.
[0042] As used herein, a “decreased resistance” refers to modified cells in which CSF1R signal inhibition occurs at a lower concentration of a receptor antagonist relative to what is observed in unmodified cells.
[0043] As used herein, the terms “subject” and “patient” are used interchangeably. As used herein, a subject can be a non-primate (e.g., cows, pigs, horses, cats, dogs, rats, mice, etc.) or a primate (e.g., monkey, ape, and human). In specific embodiments, the subject is a human. In one embodiment, the subject is a mammal (e.g., a human) having a disease, disorder, or condition described herein. In another embodiment, the subject is a mammal (e.g., a human) at risk of developing a disease, disorder or condition described herein. In certain instances, the term patient refers to a human under medical care or animals under veterinary care.
[0044] As used herein, the term “neurological diseases” refers to injuries, trauma, disorders, or diseases that affect the brain as well as the nerves found throughout the body and the spinal cord.
[0045] As used herein, the terms “treat” or “treatment” or “treating” refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow the development of the disease (e.g., a neurological disease), such as slowing down the development of a disorder, or reducing at least one adverse effect or symptom of a condition, disease or disorder, e.g., any disorder characterized by insufficient or undesired organ or tissue function. Treatment is generally “effective” if one or more symptoms or clinical markers are reduced, as that term is defined herein. Alternatively, a treatment is “effective” if the progression of a disease is reduced or halted. That is, “treatment” includes not just the improvement of symptoms or decrease of markers of the disease, but also a cessation or slowing of progress or worsening of a symptom that would be expected in absence of treatment. Beneficial or desired clinical results include, but are not limited to, alleviation of one or more symptom(s), diminishment of the extent of disease, stabilized (e.g., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. “Treatment” can also mean prolonging survival as compared to expected survival if not receiving treatment. “Treatment” also includes ameliorating a disease, lessening the severity of its complications, preventing it from manifesting, preventing it from recurring, merely preventing it from worsening, mitigating an inflammatory response included therein, or a therapeutic effort to affect any of the aforementioned, even if such therapeutic effort is ultimately unsuccessful.
[0046] Referring now to
[0047] Cells within the central nervous system can exist inside a ‘niche’ which can limit the total number of cells that can reside within the mammalian CNS. The present disclosure aims to use CSF1R-expressing cells (e.g., CSF1R expressing phagocytes, HSPCs, dendritic cells, erythromyeloid progenitors, microglia, macrophages, or monocytes) to develop new treatments for neurological disease and injury. However, for some diseases, the engraftment and/or maturation of such cells within the CNS will likely be limited by the presence of existing endogenous microglia. For such indications, a method that can provide a selective survival or proliferative advantage to the transplanted mammalian cells would improve engraftment and thus therapeutic activity. Importantly, such an approach must also be safe and not induce uncontrolled proliferation.
[0048] The present disclosure features modified CSF1R-expressing cells or their progenitors or stem cells that are differentiated into cells that express CSF1R, wherein the modified CSF1R-expressing cells have differential resistance to CSF1R antagonists. Also encompassed are methods of making modified cells according to the present disclosure, which may include, in the case of an induced pluripotent stem cells (iPSC)- or hematopoietic stem and progenitor cells (HSPCs)-derived modified cell, introducing a modification into an undifferentiated cell, optionally screening or selecting for the modification, and differentiating the modified cell into a cell or cell lineages such as a monocyte or macrophage lineage.
[0049] The present disclosure features a cell (e.g., a human cell) exhibiting differential resistance to a CSF1R antagonist. In some embodiments, the present disclosure features a modified human cell exhibiting differential resistance to a CSF1R antagonist. The present disclosure may also feature a cell (e.g., a human cell) comprising a nucleic acid encoding a modified CSF1R protein exhibiting differential resistance to a CSF1R antagonist. In some embodiments, the present disclosure features a modified human cell comprising a nucleic acid encoding a modified CSF1R protein exhibiting differential resistance to a CSF1R antagonist. In some embodiments, the cell (e.g., a human cell) of the present disclosure expresses CSF1R and may be a CSF1R-expressing cell. In other embodiments, the cell (e.g., a human cell) of the present disclosure can be induced or differentiated to express CSF1R.
[0050] The present disclosure may also feature a modified cell as described herein that is expressing CSF1R. In some embodiments, the present disclosure features a modified human cell as described herein that is expressing CSF1R. The cell may be induced and/or differentiated to express CSF1R and may be selected from a group consisting of pluripotent stem cell, hematopoietic stem cell, an erythromyeloid progenitor, and hematopoietic progenitor cell.
[0051] In some embodiments, CSF1R-expressing cells (e.g., CSF1R-expressing human) cells may include but are not limited to microglia, macrophages, monocytes, or other phagocytes. In other embodiments, cells that can be induced or differentiated to express CSF1R may include but are not limited to pluripotent stem cell, hematopoietic stem cell, an erythromyeloid progenitor, or a hematopoietic progenitor cell. In some embodiments, the modified cell (e.g., the modified human cell) is a precursor cell including but not limited to microglia, monocytes, macrophages, hematopoietic progenitor cells (HPCs) and hematopoietic stem cells (HSCs), erythromyeloid progenitors (EMPs), primitive macrophages, and primitive macrophage progenitors (PMPs) or cord blood hematopoietic stem cells.
[0052] In some embodiments, the modified cells are differentially resistant to CSF1R antagonists. In some embodiments, CSF1R antagonists may include but are not limited to PLX5622, PLX3397 (pexidartinib), BLZ945, Ki20227, JNJ-40346527; JNJ-527 (Edicotinib), cFMS Receptor inhibitor 11, AZ304, ARRY-382, YM-90709, GVV2580, PLX108-01, PLX7486, PLX647, ARRY-382, JNJ-40346527, Emactuzumab (RG7155), AMG820, IMC-CS4 (LY3022855), MCS110, BPR1R024, AZD7507, JTE-952, JNJ-28312141, c-FMS-IN-8, or CSF1R-IN-22.
[0053] In other embodiments, a CSF1R antagonist may include any compound that inhibits CSF1R interaction with its cognate ligands (e.g., CSF1 or IL-34), substrates, or downstream effectors. Non-limiting examples of compounds that inhibit CSF1R interaction with its cognate ligands, substrates, or downstream effectors include but are not limited to antibodies or drugs that block the interactions between CSF1R and Phospholipase C-gamma2 (PLCg2), Spleen tyrosine kinase (Syk), and the Grb2/Gab2/Shp2 complex. In some embodiments, differential CSF1R antagonist resistance is conferred by modifying genes downstream of CSF1R. Non-limiting examples may include but are not limited to INPP5D (SHIP1), TREM2, DAP12, PLCG2, PI3K, AKT, PKC, FIMP, JNK, A-SMase, spleen tyrosine kinase (Syk), and the Grb2/Gab2/Shp2 complex. In other embodiments, partial CSF1R antagonist resistance is conferred by pretreating microglia with agonists or antagonists of CSF1R signaling. In further embodiments, CSF1R antagonists may include any compound that inhibits CSF1R signaling by blocking the ATP binding site (i.e., the ATP binding pocket).
[0054] Table 1 shows a wild type CSF1R sequence and non-limiting examples of modified CSF1R amino acid sequences (i.e., modified CSF1R protein described herein) as well as non-limiting examples of the nucleic acids sequences encoding the modified CSF1R protein described herein. Examples of such nucleic acids include those with one or more silent or conserved nucleic acid substitutions compared to the wild type nucleic acid sequence. Bolded nucleic acids (NAs) are examples of where one or more silent or conserved nucleic acid substitutions may be incorporated into the sequence. Potential nucleic acids are highlighted in the description.
TABLE-US-00001 SEQ ID Description Sequence NO: Wild Type atgggcccaggagttctgctgctcctgctggtggccacagcttggcatggtcagggaatcccagtgatag 1 CSF1R agcccagtgtccctgagctggtcgtgaagccaggagcaacggtgaccttgcgatgtgtgggcaatggc (nucleic acid) agcgtggaatgggatggccccccatcacctcactggaccctgtactctgatggctccagcagcatcctca gcaccaacaacgctaccttccaaaacacggggacctatcgctgcactgagcctggagaccccctggg aggcagcgccgccatccacctctatgtcaaagaccctgcccggccctggaacgtgctagcacaggag gtggtcgtgttcgaggaccaggacgcactactgccctgtctgctcacagacccggtgctggaagcaggc gtctcgctggtgcgtgtgcgtggccggcccctcatgcgccacaccaactactccttctcgccctggcatgg cttcaccatccacagggccaagttcattcagagccaggactatcaatgcagtgccctgatgggtggcag gaaggtgatgtccatcagcatccggctgaaagtgcagaaagtcatcccagggcccccagccttgacac tggtgcctgcagagctggtgcggattcgaggggaggctgcccagatcgtgtgctcagccagcagcgttg atgttaactttgatgtcttcctccaacacaacaacaccaagctcgcaatccctcaacaatctgactttca taataaccgttaccaaaaagtcctgaccctcaacctcgatcaagtagatttccaacatgccggcaactact cctgcgtggccagcaacgtgcagggcaagcactccacctccatgttcttccgggtggtagagagtgccta cttgaacttgagctctgagcagaacctcatccaggaggtgaccgtgggggaggggctcaacctcaaagtc atggtggaggcctacccaggcctgcaaggttttaactggacctacctgggacccttttctgaccaccagcc tgagcccaagcttgctaatgctaccaccaaggacacatacaggcacaccttcaccctctctctgccccgc ctgaagccctctgaggctggccgctactccttcctggccagaaacccaggaggctggagagctctgacg tttgagctcacccttcgataccccccagaggtaagcgtcatatggacattcatcaacggctctggcaccct tttgtgtgctgcctctgggtacccccagcccaacgtgacatggctgcagtgcagtggccacactgataggt gtgatgaggcccaagtgctgcaggtctgggatgacccataccctgaggtcctgagccaggagcccttcc acaaggtgacggtgcagagcctgctgactgttgagaccttagagcacaaccaaacctacgagtgcag ggcccacaacagcgtggggagtggctcctgggccttcatacccatctctgcaggagcccacacgcatc ccccggatgagttcctcttcacaccagtggtggtcgcctgcatgtccatcatggccttgctgctgctgct gctcctgctgctattgtacaagtataagcagaagcccaagtaccaggtccgctggaagatcatcgagagct atgagggcaacagttatactttcatcgaccccacgcagctgccttacaacgagaagtgggagttcccccg gaacaacctgcagtttggtaagaccctcggagctggagcctttgggaaggtggtggaggccacggcctt tggtctgggcaaggaggatgctgtcctgaaggtggctgtgaagatgctgaagtccacggcccatgctgat gagaaggaggccctcatgtccgagctgaagatcatgagccacctgggccagcacgagaacatcgtca accttctgggagcctgtacccatggaggccctgtactggtcatcacggagtactgttgctatggcgacctg ctcaactttctgcgaaggaaggctgaggccatgctgggacccagcctgagccccggccaggaccccg agggaggcgtcgactataagaacatccacctcgagaagaaatatgtccgcagggacagtggcttctcc agccagggtgtggacacctatgtggagatgaggcctgtctccacttcttcaaatgactccttctctgagca agacctggacaaggaggatggacggcccctggagctccgggacctgcttcacttctccagccaagtagc ccagggcatggccttcctcgcttccaagaattgcatccaccgggacgtggcagcgcgtaacgtgctgttg accaatggtcatgtggccaagattggggacttcgggctggctagggacatcatgaatgactccaactac attgtcaagggcaatgcccgcctgcctgtgaagtggatggccccagagagcatctttgactgtgtctacac ggttcagagcgacgtctggtcctatggcatcctcctctgggagatcttctcacttgggctgaatccctacc ctggcatcctggtgaacagcaagttctataaactggtgaaggatggataccaaatggcccagcctgcattt gccccaaagaatatatacagcatcatgcaggcctgctgggccttggagcccacccacagacccaccttc cagcagatctgctccttccttcaggagcaggcccaagaggacaggagagagcgggactataccaatct gccgagcagcagcagaagcggtggcagcggcagcagcagcagtgagctggaggaggagagctct agtgagcacctgacctgctgcgagcaaggggatatcgcccagcccttgctgcagcccaacaactatca gttctgctga Wild Type MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWD 2 CSF1R GPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVK (amino acid) DPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHT NYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPP ALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNN RYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVESAYLNLSS EQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANAT TKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSV IWTFINGSGTLLCAASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYP EVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAH THPPDEFLFTPVVVACMSIMALLLLLLLLLLYKYKQKPKYQVRWKIIESYEG NSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKED AVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPV LVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVR RDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFS SQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYI VKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILV NSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQE QAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIAQ PLLQPNNYQFC G795A atgggcccaggagttctgctgctcctgctggtggccacagcttggcatggtcagggaatcccagtgatag 3 CSF1R agcccagtgtccctgagctggtcgtgaagccaggagcaacggtgaccttgcgatgtgtgggcaatggc (nucleic acid) agcgtggaatgggatggccccccatcacctcactggaccctgtactctgatggctccagcagcatcctca where NNN gcaccaacaacgctaccttccaaaacacggggacctatcgctgcactgagcctggagaccccctggg may include: aggcagcgccgccatccacctctatgtcaaagaccctgcccggccctggaacgtgctagcacaggag GCT, GCC, gtggtcgtgttcgaggaccaggacgcactactgccctgtctgctcacagacccggtgctggaagcaggc GCA, and gtctcgctggtgcgtgtgcgtggccggcccctcatgcgccacaccaactactccttctcgccctggcatgg GCG. cttcaccatccacagggccaagttcattcagagccaggactatcaatgcagtgccctgatgggtggcag gaaggtgatgtccatcagcatccggctgaaagtgcagaaagtcatcccagggcccccagccttgacac tggtgcctgcagagctggtgcggattcgaggggaggctgcccagatcgtgtgctcagccagcagcgttg atgttaactttgatgtcttcctccaacacaacaacaccaagctcgcaatccctcaacaatctgactttcat aataaccgttaccaaaaagtcctgaccctcaacctcgatcaagtagatttccaacatgccggcaactactc ctgcgtggccagcaacgtgcagggcaagcactccacctccatgttcttccgggtggtagagagtgcctact tgaacttgagctctgagcagaacctcatccaggaggtgaccgtgggggaggggctcaacctcaaagtc atggtggaggcctacccaggcctgcaaggttttaactggacctacctgggacccttttctgaccaccagcc tgagcccaagcttgctaatgctaccaccaaggacacatacaggcacaccttcaccctctctctgccccgc ctgaagccctctgaggctggccgctactccttcctggccagaaacccaggaggctggagagctctgacg tttgagctcacccttcgataccccccagaggtaagcgtcatatggacattcatcaacggctctggcaccct tttgtgtgctgcctctgggtacccccagcccaacgtgacatggctgcagtgcagtggccacactgataggt gtgatgaggcccaagtgctgcaggtctgggatgacccataccctgaggtcctgagccaggagcccttcc acaaggtgacggtgcagagcctgctgactgttgagaccttagagcacaaccaaacctacgagtgcag ggcccacaacagcgtggggagtggctcctgggccttcatacccatctctgcaggagcccacacgcatc ccccggatgagttcctcttcacaccagtggtggtcgcctgcatgtccatcatggccttgctgctgctgctg ctcctgctgctattgtacaagtataagcagaagcccaagtaccaggtccgctggaagatcatcgagagcta tgagggcaacagttatactttcatcgaccccacgcagctgccttacaacgagaagtgggagttcccccg gaacaacctgcagtttggtaagaccctcggagctggagcctttgggaaggtggtggaggccacggcctt tggtctgggcaaggaggatgctgtcctgaaggtggctgtgaagatgctgaagtccacggcccatgctgat gagaaggaggccctcatgtccgagctgaagatcatgagccacctgggccagcacgagaacatcgtca accttctgggagcctgtacccatggaggccctgtactggtcatcacggagtactgttgctatggcgacctg ctcaactttctgcgaaggaaggctgaggccatgctgggacccagcctgagccccggccaggaccccg agggaggcgtcgactataagaacatccacctcgagaagaaatatgtccgcagggacagtggcttctcc agccagggtgtggacacctatgtggagatgaggcctgtctccacttcttcaaatgactccttctctgagca agacctggacaaggaggatggacggcccctggagctccgggacctgcttcacttctccagccaagtagc ccagggcatggccttcctcgcttccaagaattgcatccaccgggacgtggcagcgcgtaacgtgctgttg accaatggtcatgtggccaagattNNNgacttcgggctggctagggacatcatgaatgactccaacta cattgtcaagggcaatgcccgcctgcctgtgaagtggatggccccagagagcatctttgactgtgtctaca cggttcagagcgacgtctggtcctatggcatcctcctctgggagatcttctcacttgggctgaatccctac cctggcatcctggtgaacagcaagttctataaactggtgaaggatggataccaaatggcccagcctgcatt tgccccaaagaatatatacagcatcatgcaggcctgctgggccttggagcccacccacagacccacctt ccagcagatctgctccttccttcaggagcaggcccaagaggacaggagagagcgggactataccaat ctgccgagcagcagcagaagcggtggcagcggcagcagcagcagtgagctggaggaggagagct ctagtgagcacctgacctgctgcgagcaaggggatatcgcccagcccttgctgcagcccaacaactatc agttctgctga G795A MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWD 4 CSF1R GPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVK (amino acid) DPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHT NYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPP ALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNN RYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSS EQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANAT TKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSV IWTFINGSGTLLCAASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYP EVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAH THPPDEFLFTPVVVACMSIMALLLLLLLLLLYKYKQKPKYQVRWKIIESYEG NSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKED AVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPV LVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVR RDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFS SQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIADFGLARDIMNDSNYI VKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILV NSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQE QAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIAQ PLLQPNNYQFC G795C atgggcccaggagttctgctgctcctgctggtggccacagcttggcatggtcagggaatcccagtgatag 5 CSF1R agcccagtgtccctgagctggtcgtgaagccaggagcaacggtgaccttgcgatgtgtgggcaatggc (nucleic agcgtggaatgggatggccccccatcacctcactggaccctgtactctgatggctccagcagcatcctca acid): gcaccaacaacgctaccttccaaaacacggggacctatcgctgcactgagcctggagaccccctggg where NNN aggcagcgccgccatccacctctatgtcaaagaccctgcccggccctggaacgtgctagcacaggag may include: gtggtcgtgttcgaggaccaggacgcactactgccctgtctgctcacagacccggtgctggaagcaggc TGT and gtctcgctggtgcgtgtgcgtggccggcccctcatgcgccacaccaactactccttctcgccctggcatgg TGC. cttcaccatccacagggccaagttcattcagagccaggactatcaatgcagtgccctgatgggtggcag gaaggtgatgtccatcagcatccggctgaaagtgcagaaagtcatcccagggcccccagccttgacac tggtgcctgcagagctggtgcggattcgaggggaggctgcccagatcgtgtgctcagccagcagcgttg atgttaactttgatgtcttcctccaacacaacaacaccaagctcgcaatccctcaacaatctgactttcat aataaccgttaccaaaaagtcctgaccctcaacctcgatcaagtagatttccaacatgccggcaactactc ctgcgtggccagcaacgtgcagggcaagcactccacctccatgttcttccgggtggtagagagtgcctact tgaacttgagctctgagcagaacctcatccaggaggtgaccgtgggggaggggctcaacctcaaagtc atggtggaggcctacccaggcctgcaaggttttaactggacctacctgggacccttttctgaccaccagcc tgagcccaagcttgctaatgctaccaccaaggacacatacaggcacaccttcaccctctctctgccccgc ctgaagccctctgaggctggccgctactccttcctggccagaaacccaggaggctggagagctctgacg tttgagctcacccttcgataccccccagaggtaagcgtcatatggacattcatcaacggctctggcaccct tttgtgtgctgcctctgggtacccccagcccaacgtgacatggctgcagtgcagtggccacactgataggt gtgatgaggcccaagtgctgcaggtctgggatgacccataccctgaggtcctgagccaggagcccttcc acaaggtgacggtgcagagcctgctgactgttgagaccttagagcacaaccaaacctacgagtgcag ggcccacaacagcgtggggagtggctcctgggccttcatacccatctctgcaggagcccacacgcatc ccccggatgagttcctcttcacaccagtggtggtcgcctgcatgtccatcatggccttgctgctgctgctg ctcctgctgctattgtacaagtataagcagaagcccaagtaccaggtccgctggaagatcatcgagagcta tgagggcaacagttatactttcatcgaccccacgcagctgccttacaacgagaagtgggagttcccccg gaacaacctgcagtttggtaagaccctcggagctggagcctttgggaaggtggtggaggccacggcctt tggtctgggcaaggaggatgctgtcctgaaggtggctgtgaagatgctgaagtccacggcccatgctgat gagaaggaggccctcatgtccgagctgaagatcatgagccacctgggccagcacgagaacatcgtca accttctgggagcctgtacccatggaggccctgtactggtcatcacggagtactgttgctatggcgacctg ctcaactttctgcgaaggaaggctgaggccatgctgggacccagcctgagccccggccaggaccccg agggaggcgtcgactataagaacatccacctcgagaagaaatatgtccgcagggacagtggcttctcc agccagggtgtggacacctatgtggagatgaggcctgtctccacttcttcaaatgactccttctctgagca agacctggacaaggaggatggacggcccctggagctccgggacctgcttcacttctccagccaagtagc ccagggcatggccttcctcgcttccaagaattgcatccaccgggacgtggcagcgcgtaacgtgctgttg accaatggtcatgtggccaagattNNNgacttcgggctggctagggacatcatgaatgactccaacta cattgtcaagggcaatgcccgcctgcctgtgaagtggatggccccagagagcatctttgactgtgtctaca cggttcagagcgacgtctggtcctatggcatcctcctctgggagatcttctcacttgggctgaatccctac cctggcatcctggtgaacagcaagttctataaactggtgaaggatggataccaaatggcccagcctgcatt tgccccaaagaatatatacagcatcatgcaggcctgctgggccttggagcccacccacagacccacctt ccagcagatctgctccttccttcaggagcaggcccaagaggacaggagagagcgggactataccaat ctgccgagcagcagcagaagcggtggcagcggcagcagcagcagtgagctggaggaggagagct ctagtgagcacctgacctgctgcgagcaaggggatatcgcccagcccttgctgcagcccaacaactatc agttctgctga G795C MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWD 6 CSF1R GPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVK (amino acid) DPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHT NYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPP ALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNN RYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSS EQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANAT TKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSV IWTFINGSGTLLCAASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYP EVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAH THPPDEFLFTPVVVACMSIMALLLLLLLLLLYKYKQKPKYQVRWKIIESYEG NSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKED AVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPV LVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVR RDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFS SQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKICDFGLARDIMNDSNYI VKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILV NSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQE QAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIAQ PLLQPNNYQFC CSF1R atgggcccaggagttctgctgctcctgctggtggccacagcttggcatggtcagggaatcccagtgatag 7 G795V agcccagtgtccctgagctggtcgtgaagccaggagcaacggtgaccttgcgatgtgtgggcaatggc (nucleic acid) agcgtggaatgggatggccccccatcacctcactggaccctgtactctgatggctccagcagcatcctca where NNN gcaccaacaacgctaccttccaaaacacggggacctatcgctgcactgagcctggagaccccctggg may include: aggcagcgccgccatccacctctatgtcaaagaccctgcccggccctggaacgtgctagcacaggag GTT, GTC, gtggtcgtgttcgaggaccaggacgcactactgccctgtctgctcacagacccggtgctggaagcaggc GTA,and gtctcgctggtgcgtgtgcgtggccggcccctcatgcgccacaccaactactccttctcgccctggcatgg GTG cttcaccatccacagggccaagttcattcagagccaggactatcaatgcagtgccctgatgggtggcag gaaggtgatgtccatcagcatccggctgaaagtgcagaaagtcatcccagggcccccagccttgacac tggtgcctgcagagctggtgcggattcgaggggaggctgcccagatcgtgtgctcagccagcagcgttg atgttaactttgatgtcttcctccaacacaacaacaccaagctcgcaatccctcaacaatctgactttcat aataaccgttaccaaaaagtcctgaccctcaacctcgatcaagtagatttccaacatgccggcaactactc ctgcgtggccagcaacgtgcagggcaagcactccacctccatgttcttccgggtggtagagagtgcctact tgaacttgagctctgagcagaacctcatccaggaggtgaccgtgggggaggggctcaacctcaaagtc atggtggaggcctacccaggcctgcaaggttttaactggacctacctgggacccttttctgaccaccagcc tgagcccaagcttgctaatgctaccaccaaggacacatacaggcacaccttcaccctctctctgccccgc ctgaagccctctgaggctggccgctactccttcctggccagaaacccaggaggctggagagctctgacg tttgagctcacccttcgataccccccagaggtaagcgtcatatggacattcatcaacggctctggcaccct tttgtgtgctgcctctgggtacccccagcccaacgtgacatggctgcagtgcagtggccacactgataggt gtgatgaggcccaagtgctgcaggtctgggatgacccataccctgaggtcctgagccaggagcccttcc acaaggtgacggtgcagagcctgctgactgttgagaccttagagcacaaccaaacctacgagtgcag ggcccacaacagcgtggggagtggctcctgggccttcatacccatctctgcaggagcccacacgcatc ccccggatgagttcctcttcacaccagtggtggtcgcctgcatgtccatcatggccttgctgctgctgctg ctcctgctgctattgtacaagtataagcagaagcccaagtaccaggtccgctggaagatcatcgagagcta tgagggcaacagttatactttcatcgaccccacgcagctgccttacaacgagaagtgggagttcccccg gaacaacctgcagtttggtaagaccctcggagctggagcctttgggaaggtggtggaggccacggcctt tggtctgggcaaggaggatgctgtcctgaaggtggctgtgaagatgctgaagtccacggcccatgctgat gagaaggaggccctcatgtccgagctgaagatcatgagccacctgggccagcacgagaacatcgtca accttctgggagcctgtacccatggaggccctgtactggtcatcacggagtactgttgctatggcgacctg ctcaactttctgcgaaggaaggctgaggccatgctgggacccagcctgagccccggccaggaccccg agggaggcgtcgactataagaacatccacctcgagaagaaatatgtccgcagggacagtggcttctcc agccagggtgtggacacctatgtggagatgaggcctgtctccacttcttcaaatgactccttctctgagca agacctggacaaggaggatggacggcccctggagctccgggacctgcttcacttctccagccaagtagc ccagggcatggccttcctcgcttccaagaattgcatccaccgggacgtggcagcgcgtaacgtgctgttg accaatggtcatgtggccaagattNNNgacttcgggctggctagggacatcatgaatgactccaacta cattgtcaagggcaatgcccgcctgcctgtgaagtggatggccccagagagcatctttgactgtgtctaca cggttcagagcgacgtctggtcctatggcatcctcctctgggagatcttctcacttgggctgaatccctac cctggcatcctggtgaacagcaagttctataaactggtgaaggatggataccaaatggcccagcctgcatt tgccccaaagaatatatacagcatcatgcaggcctgctgggccttggagcccacccacagacccacctt ccagcagatctgctccttccttcaggagcaggcccaagaggacaggagagagcgggactataccaat ctgccgagcagcagcagaagcggtggcagcggcagcagcagcagtgagctggaggaggagagct ctagtgagcacctgacctgctgcgagcaaggggatatcgcccagcccttgctgcagcccaacaactatc agttctgctga CSF1R MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWD 8 G795V (amino GPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVK acid) DPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHT NYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPP ALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNN RYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSS EQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANAT TKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSV IWTFINGSGTLLCAASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYP EVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAH THPPDEFLFTPVVVACMSIMALLLLLLLLLLYKYKQKPKYQVRWKIIESYEG NSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKED AVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPV LVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVR RDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFS SQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIVDFGLARDIMNDSNYI VKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILV NSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQE QAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIAQ PLLQPNNYQFC
[0055] In some embodiments, the cell (e.g., the modified human cell) comprises one or more genetic modifications in a gene for a CSF1R receptor (i.e., CSF1R protein). In some embodiments, the cell (e.g., the modified human cell) comprises one or more genetic modifications in a CSF1R protein (i.e., a CSF1R receptor).
[0056] In some embodiments, the one or more genetic modifications in the CSF1R receptor (i.e., CSF1R protein) do not induce constitutively active CSF1R signaling. The modified CSF1R receptor (i.e., CSF1R protein) may still be activated (e.g., phosphorylated) with a ligand of the CSF1R protein. In some embodiment, the ligand of the CSF1R protein may include but is not limited to CSF1, IL-34, a CSF1R agonist or activating antibody, or a combination thereof. In some embodiments, the modified CSF1R protein is activated by a CSF1 ligand. In some embodiments, the CSF1 ligand induces phosphorylation of the modified CSF1R protein. In other embodiments, the modified CSF1R protein is activated by an IL-34 ligand. In some embodiments, the IL-34 ligand induces phosphorylation of the modified CSF1R protein.
[0057] In some embodiments, the one or more genetic modifications result in a modified ATP binding pocket. The modified ATP binding pocket of the CSF1R receptor (i.e., CSF1R protein) may have a reduced binding space (compared to a wild type CSF1R protein). In some embodiments, the modified ATP binding pocket cannot bind a drug (e.g., a CSF1R antagonist or agonist). In other embodiments, the modified ATP binding pocket can bind ATP. In some embodiments, the one or more genetic modifications in the CSF1R receptor do not interfere with the ATP binding activity of the CSF1R protein. In some embodiments, the one or more genetic modifications in the CSF1R receptor lack a pocket for a drug (e.g., a CSF1R antagonist or agonist) to bind but do not interfere with the normal ATP binding activity of the CSF1R protein.
[0058] In some embodiments, the one or more genetic modifications is a point mutation. In some embodiments, the one or more genetic modifications result in a single amino acid substitution. In other embodiments, the one or more genetic modifications result in single amino acid insertion. In further embodiments, the one or more genetic modifications result in single amino acid deletion.
[0059] In some embodiments, the one or more genetic modifications result in a change in the amino acid sequence of the CSF1R protein. The change in the amino acid sequence may optionally comprise the substitution of an amino acid residue selected from G795, L785, M637, E633, and V647. In some embodiments, the one or more genetic modifications result in an amino acid substitution. In some embodiments, the one or more genetic modifications result in a single amino acid substitution. The single amino acid point mutations may be selected from a group consisting of G795A, G795V, and G795C.
[0060] In some embodiments, the CSF1R gene is modified to confer partial or complete resistance to the CSF1R antagonist in the modified cells. In some embodiments, the CSF1R gene is modified with a single point mutation. In other embodiments, single point mutations of the CSF1R gene may include but are not limited to these single amino acid substitutions at positions G795, L785, M637, E633, and/or V647. As non-limiting examples, the substitutions may comprise G795A, G795V, or G795C, or G795D, or G795E, or G795F, or G795G, or G795H, or G7951, or G795K, or G795L, or G795M, or G795N, or G795P, or G795Q, or G795R or G795S, or G795T, or G795W, or G795Y.
[0061] Without wishing to be bound by any theories or mechanisms, the substitution of these residues or any other amino acid residue that is in direct contact with small molecule inhibitors bound to the ATP binding site would be predicted to alter their binding. Amino acid substitutions comprising slightly larger functional groups: serine; threonine; cysteine; valine; leucine; isoleucine; and methionine are expected to introduce bulky substituents that clash with plexxikon binding yet still permit ATP binding for CSF1R function. Much larger amino acid substitutions: phenylalanine, tyrosine, lysine, arginine, and tryptophan, are expected to sterically clash with both inhibitors and ATP thereby inhibiting normal CSF1R function. By contrast, substitutions with amino acids with less bulky side chains such as glycine or alanine may improve binding to antagonist species that are only weakly bound by the native sequence due to steric hindrance by slightly larger or incompatibly polar side chains. Those of skill in the art will appreciate, then, that these and other residues that define binding sites for allosteric antagonists may be subject to modification in accordance with the object of this disclosure.
[0062] In other embodiments, the one or more genetic modifications result in a change in a plurality of amino acids of the CSF1R protein. In some embodiments, the change in a plurality of amino acids are to adjacent amino acids. In other embodiments, the change in a plurality of amino acids are to non-adjacent amino acids.
[0063] In some embodiments, the one or more genetic modifications (e.g., point mutations) are within the ATP-binding pocket of the CSF1R protein (i.e., a CSF1R receptor). In other embodiments, the one or more genetic modifications (e.g., point mutations) are outside the ATP-binding pocket of the CSF1R protein (i.e., a CSF1R receptor). Without wishing to limit the present disclosure to any theories or mechanisms, it is believed that mutations outside the ATP-binding pocket of the CSF1R protein may work through allostery to inhibit antagonist binding.
[0064] In some embodiments, the one or more genetic modifications are introduced ex vivo. In other embodiments, the one or more genetic modifications are induced by transfecting or introducing into a cell (e.g., a human cell) a nucleic acid encoding a transgene. In further embodiments, the one or more genetic modifications are introduced by transduction or introduction of a targeted nuclease, nickase, or base-editing effector or ribonucleoprotein complex. In some embodiments, introducing the nucleic acid encoding a transgene in a cell comprises contacting the cell (e.g., the human cell) with a viral vector.
[0065] In some embodiments, the one or more genetic modifications (e.g., point mutations) in the CSF1R gene are generated via site-directed or random mutagenesis methods known in the art, including, without limitation, CRISPR-Cas, TALEN, and ZFN genome editing systems. Alternatively, or additionally, modified CSF1R transgenes may be introduced into cells (e.g., human cells) by, e.g., DNA or RNA vectors such as naked nucleic acids, liposome or other encapsulated nucleic acid vectors, artificial chromosomes, and/or viral vectors such as lentiviral and adeno-associated viral vectors.
[0066] In some embodiments, cells (e.g., human cells) comprising a modified CSF1R protein as described herein retain a gene expression profile of a cell (e.g., a human cell) comprising a wild-type CSF1R protein. In some embodiments, in vitro cells (e.g., in vitro human cells) comprising a modified CSF1R protein have a similar gene expression profile as in vitro cells (e.g., in vitro human cells) comprising a wild-type CSF1R protein. In other embodiments, cells (e.g., human cells) comprising a modified CSF1R protein that are transplanted in vivo have a similar gene expression profile of a transplanted cell (e.g., human cell) that does not compromise a modified CSF1R protein. In further embodiments, modified CSF1R-expressing cells (e.g., CSF1R-expressing phagocytes) as described herein retain a gene expression profile of wild-type CSF1R-expressing cells (e.g., CSF1R-expressing phagocytes).
[0067] The present disclosure may also feature a composition comprising a CSF1R-expressing cell as described herein. The present disclosure may also feature a composition comprising a CSF1R-expressing phagocyte as described herein. In some embodiments, the composition comprises a plurality of cells. In some embodiments, at least 0.1%, at least 1%, at least 5%, at least 10%, at least 20%, at least 30%, at least 40, at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 90%, or at least 99% or at least 99.5% of the plurality of cells are CSF1R-expressing cells having differential resistance to a CSF1R antagonist. In other embodiments, at least 0.1%, at least 1%, at least 5%, at least 10%, at least 20%, at least 30%, at least 40, at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 90%, or at least 99% or at least 99.5% of the plurality of cells are CSF1R-expressing phagocytes having differential resistance to a CSF1R antagonist.
[0068] The present disclosure features a method of treating a subject. The method comprises administering a CSF1R antagonist to the subject in a quantity sufficient to inhibit a CSF1R signal in a cell of the subject and contacting the subject with a modified CSF1R-expressing cell (e.g., a modified CSF1R-expressing phagocyte) having a differential resistance to a CSF1R antagonist. In other embodiments, the method comprises contacting the subject with a modified CSF1R-expressing cell (e.g., a modified CSF1R-expressing phagocyte) having a differential resistance to a CSF1R antagonist and administering the CSF1R antagonist to the subject in a quantity sufficient to inhibit a CSF1R signal in a cell of the subject. In some embodiments, differential resistance to the CSF1R antagonist is partial resistance or complete resistance to the CSF1R antagonist.
[0069] The modified CSF1R-expressing cells (e.g., modified human CSF1R-expressing cells) described herein may further comprise one or more modifications (e.g., one or more genetic modifications in another gene (e.g., outside of the CSF1R gene). In some embodiments, the modified CSF1R-expressing cell (e.g., a modified CSF1R-expressing phagocyte) expresses a gene product useful to treat, cure, ameliorate, prevent or palliate a neurological disease. In some embodiments, the gene product is not otherwise expressed by the CSF1R-expressing cell (e.g., a modified CSF1R-expressing phagocyte). In other embodiments, the modified CSF1R-expressing cell (e.g., a modified CSF1R-expressing phagocyte) expresses other genetic modifications useful to treat, cure, ameliorate, prevent or palliate a neurological disease. In other embodiments, other genetic modifications (outside of the CSF1R gene) are used to correct a mutated gene to treat a disease caused by mutations in that other gene.
[0070] In some embodiments, the CSF1R signal that is inhibited by the CSF1R antagonist is the proliferation or survival of a CSF1R-expressing cell (e.g., a CSF1R-expressing phagocyte) that is endogenous to the subject. In other embodiments, the CSF1R antagonist is administered to the subject in a quantity sufficient to reduce the proliferation or survival of the endogenous CSF1R-expressing cell (e.g., a CSF1R-expressing phagocyte) of the subject relative to the modified CSF1R-expressing cell (e.g., a modified CSF1R-express phagocyte).
[0071] The present disclosure may also feature a method of treating a subject. The method may comprise contacting the subject with a modified CSF1R-expressing cell (e.g., a modified CSF1R-expressing phagocyte) and differentially altering the proliferation or survival of an unmodified CSF1R-expressing cell (e.g., an unmodified CSF1R-expressing phagocyte) relative to the modified CSF1R-expressing cell (e.g., a modified CSF1R-expressing phagocyte). In some embodiments, the modified CSF1R-expressing cell (e.g., a modified CSF1R-expressing phagocyte) is partially resistant to a CSF1R antagonist. In some embodiments, the step of differentially altering the proliferation or survival of the unmodified CSF1R-expressing cell (e.g., an unmodified CSF1R-expressing phagocyte) comprises administering the CSF1R antagonist to the subject in a quantity sufficient to reduce proliferation or survival of the unmodified CSF1R-expressing cell (e.g., an unmodified CSF1R-expressing phagocyte) relative to the modified CSF1R-expressing cell (e.g., a modified CSF1R-expressing phagocyte).
[0072] The methods described herein may kill about 0.1%, or about 1%, or about 5%, or about 10%, or about 20%, or about 30%, or about 40%, or about 50%, or about 60%, or about 70%, or about 80%, or about 90%, or about 99%, or about 99.5% of endogenous CSF1R-expressing phagocyte within the CNS of the subject. In other embodiments, the methods described herein may kill all the endogenous CSF1R-expressing phagocytes within the CNS of the subject.
[0073] The methods described herein may further allow for the engraftment of about 0.1%, or about 1%, or about 5%, or about 10%, or about 20%, or about 30%, or about 40%, or about 50%, or about 60%, or about 70%, or about 80%, or about 90%, or about 99%, or about 99.5% of the modified CSF1R-expressing phagocyte within the CNS of the subject. In some embodiments, the methods described herein allow for complete engraftment of the modified CSF1R-expressing phagocyte within the CNS of the subject.
[0074] In some embodiments, the methods described herein are directed towards treating, preventing, palliating, or ameliorating a neurological disease by contacting a subject with a modified cell or vector of this disclosure. In some embodiments, a neurological disease comprises a disease of the nervous system. Non-limiting examples of neurological diseases may include but are not limited to dementia, a neurodegenerative disease, a genetic disease, a spinal cord injury, a traumatic brain injury, a disease caused or worsened by exposure to a chemical or other agent, etc.
[0075] The present disclosure may also feature a composition for the treatment of neurological disease, the composition comprising a plurality of modified cells having differential (e.g., increased, decreased, partial or complete) resistance to CSF1R antagonists. In some embodiments, the modified cells are CSF1R-expressing cells.
[0076] The present disclosure may further feature nucleic acid compositions and vectors encoding a modified CSF1R protein exhibiting differential resistance to a CSF1R antagonist as described herein. In some embodiments, the nucleic acid compositions and vectors may include a payload including but not limited to a transgene, a marker or reporter gene, etc. In some embodiments, the expression vector comprises a nucleic acid composition as described herein operably linked to an expression control sequence.
[0077] In some embodiments, the nucleic acid composition comprises a modified CSF1R protein exhibiting differential resistance to a CSF1R antagonist. In some embodiments, the differential resistance to the CSF1R antagonist is partial resistance, complete, increased, or decreased resistance to the CSF1R antagonist.
[0078] In other embodiments, the nucleic acid composition comprises a modified CSF1R protein comprising one or more genetic modifications. In some embodiments, the one or more genetic modifications result in an amino acid substitution which is selected from a group consisting of G795A, G795V, G795C, L785, M637, E633, and V647.
[0079] In some embodiments, the present disclosure features an expression vector comprising a nucleic acid composition comprising a modified CSF1R protein exhibiting differential resistance to a CSF1R antagonist.
[0080] In some embodiments, the expression vectors described herein may be used to modify cultured or endogenous cells. In some embodiments, the expression vectors described herein are used to transfect a cultured cell, such that the culture cell or the progeny of said cell express the polypeptide. In other embodiments, the expression vectors described herein are used to modify an endogenous CSF1R-expressing cell by transducing the nucleic acid (e.g., by infecting with the viral vector to create a CSF1R-antagonist resistant cell in situ).
[0081] Methods and compositions of the present disclosure may advantageously be used in human or veterinary applications whereby a modified cell or a vector or genome-editing-system (e.g, a CRISPR-Cas, TALEN, or ZFN system) configured to introduce a mutation of the instant disclosure and thereby create a modified cell, is used in the prevention, palliation, amelioration or cure of a disease or disorder. In general, these methods will comprise the steps of contacting a subject with a modified cell or a vector or genome editing system configured to generate such a cell and contacting the subject with a CSF1R antagonist.
[0082] Turning first to subjects for whom the methods of this disclosure may be suitable, any subject may be a candidate for treatment according to these methods, but it may be advantageous to treat those subjects who suffer from, or are predicted or predisposed to suffering from, a disease such as a neurological disease that can be prevented, palliated, ameliorated or cured by contacting the subject with a cell of the present disclosure characterized by a differential response to CSF1R antagonists relative to a native or endogenous cell of the subject. Without limiting the foregoing, a neurological disease amenable to treatment by methods of this disclosure may comprise dementia, a neurodegenerative disease, a demyelinating disease, a mood or personality disorder, a traumatic brain injury, a genetic disease, a malignant or benign tumor, a metastatic tumor, or growth, etc.
[0083] A subject can be contacted with a modified cell or a vector of the disclosure at any suitable time and by any suitable route of administration, including without limitation by intravenous, intramuscular, intraperitoneal, intraparenchymal, intrathecal, intercranial, interosseus or other injection or infusion, transdermal administration (for vectors) and/or by surgical implantation or transplantation. Any suitable number of cells or titer of the vector may be administered, e.g., 10.sup.1, 10.sup.2, 10.sup.3, 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, etc. cells, and/or 10.sup.14, 10.sup.13, 10.sup.12, 10.sup.11, 10.sup.10, 10.sup.9, or fewer virions or viral genomes. With respect to modified cells, the cells with which the subject is contacted may be derived from the subject's own cells (autologous cells) or they may be from another donor (allogeneic cells).
[0084] Those of skill in the art will appreciate that the differential sensitivity of modified cells of this disclosure to CSF1R antagonists may be most clearly manifest in the presence of a CSF1R antagonist. Therefore, while the subject may be contacted at any time with a CSF1R antagonist (including without limitation as pre-treatment or conditioning treatment prior to contacting a subject with a modified cell of this disclosure), some embodiments of this disclosure comprise administering a CSF1R antagonist to a subject simultaneously with and/or following the step of contacting the subject with the modified cell or vector. The CSF1R antagonist may be administered continuously or discontinuously, and the initiation or discontinuation of the administration may be scheduled or pre-programmed, or it may be in response to a physiological readout from the subject such as a biomarker concentration, a serum or tissue concentration of a biomarker or a small molecule active ingredient or metabolite thereof, an imaging signal or sign, etc.
[0085] As one non-limiting example, in the case of a modified cell that exhibits reduced sensitivity (i.e., partial or complete resistance) to a CSF1R antagonist, said CSF1R antagonist may be administered to a subject to reduce the proliferation or survival of native cells within a niche occupied by such cells, thereby imparting a selective advantage to modified cells and optionally increasing a rate of engraftment or other behavior of the modified cells relative to that observed in the absence of the CSF1R antagonist. This administration may be initiated—and optionally terminated—prior to, simultaneously, or subsequently to the step of contacting the subject with the modified cell or vector. Without limiting the foregoing, in the case where the modified cell is a microglial cell or microglial progenitor cell, a CSF1R antagonist may be administered to a subject prior to, coincident with, and/or subsequent to the transplantation of modified microglial-lineage cells to limit the proliferation and/or survival of endogenous microglia, thereby imparting an advantage to the modified microglia which may result in a greater degree of engraftment and/or a greater spatial distribution of the modified microglia than might otherwise be observed.
[0086] Alternatively, or additionally, a modified cell of this disclosure may exhibit increased sensitivity to CSF1R antagonists relative to an unmodified cell. In this instance, the CSF1R antagonist is generally (but not necessarily) withheld before and during the step of contacting the subject with the modified cell, and instead is administered after the subject has been contacted with the modified cell or vector, for instance, to limit the proliferation or survival of the modified cells at the conclusion of a course of treatment, in response to a signal from a physiological or pharmacological measurement, and/or in response to an adverse event or a reduction in the efficacy of a therapeutic intervention utilizing the modified cells.
[0087] A modified cell of this disclosure optionally comprises one or more additional modifications relative to a native cell, of the same type. These modifications may include, without limitation, one or more transgenes, or one or more genetic modifications that correct a mutation or reduce or increase the expression of a gene product. Without limiting the foregoing, this disclosure includes a microglial cell engineered to express a CSF1R allele with reduced sensitivity to a CSF1R antagonist, and a secreted transgene such as an enzyme or a binding protein, an RNA such as antisense, miRNA, or siRNA, a cell surface protein such as a chimeric antigen receptor, a membrane-bound immunoglobulin or fragment thereof, an aptamer, etc. The disclosure also comprises vectors and methods of making such cells substantially as described above, and a method of treating a subject using a cell or vector to treat the subject.
[0088] Without wishing to limit the present disclosure to any theory or mechanism, it is believed that a variety of methods could be used to achieve the presently claimed cells that have a differential resistance to a CSF1R antagonist. Described herein are non-limiting methodologies/examples that accomplish this goal. Equivalents or substitutes are within the scope of the present disclosure.
Example
[0089] The following is a non-limiting example of the present invention. It is to be understood that said example is not intended to limit the present invention in any way. Equivalents or substitutes are within the scope of the present invention.
[0090] To facilitate the competitive engraftment of human microglia, macrophages, and monocytes and/or their precursor cells (hematopoietic progenitor cells (HPCs) and hematopoietic stem cells (HSCs), erythromyeloid progenitors (EMPs), or Primitive Macrophage Progenitors (PMPs), several approaches could be used independently or in combination. 1) using the previously published crystal structure of the CSF1R receptor bound to an antagonist (PMID: 31434879) to predict amino acid substitutions that may sterically hinder the binding of CSF1R antagonists while not impairing the normal binding of ATP into the same binding pocket. 2) Using PCR-mediated random mutagenesis to introduce amino acid changes followed by exposure of iPS-microglia to CSF1R antagonists and then sequencing of surviving mutants to identify mutations that confer resistance to CSF1R antagonists, but which do not concurrently induce constitutively active CSF1R signaling. 3) Modifying genes downstream of CSF1R, for example, delete or transiently reduce expression of SHIP1 (INPP5D) to enhance CSF1R signal transduction. 4) Pretreat microglia being transplanted with agonists of CSF1R signaling, could also use a siRNA or microRNA gene delivery approach to modulate and transiently increase CSF1R signaling in transplanted cells to promote resistance to CSF1R antagonist treatments. Below are provided additional details and data related to the first two strategies.
[0091] Strategy 1: A crystal structure of the CSF1R receptor bound to an antagonist (PMID: 31434879) to predict amino acid substitutions that may sterically hinder the binding of CSF1R antagonists while not impairing the normal binding of ATP into the same binding pocket. The crystal structure of PLX5622 bound to human CSF1R was obtained and the ATP binding pocket was examined (
[0092] Further inspection of the crystal structure also presents other positions which, if mutated, could result in a reduction of PLX5622 and/or PLX3397 binding. Examples include L785, M637, E633, and V647 (
[0093] Strategy 2: PCR-mediated random mutagenesis will be used to introduce amino acid changes followed by exposure of iPS-microglia to CSF1R antagonists and then sequencing of surviving mutants to identify mutations that confer resistance to CSF1R antagonists, but which do not concurrently induce constitutively active or suppressed CSF1R signaling. A pool of iPSC or monocyte cell lines will be generated that carry random mutations in the CSF1R gene. This pool will then be differentiated into microglia and the survival of cells monitored in response to either CSF1/IL-34 withdrawal or CSF1R antagonist treatments. Cells that survive for longer under these conditions will be examined via PCR and sequencing to identify CSF1R mutations that may confer resistance to CSF1R antagonists. Counter screens will then be performed to identify those CSF1R mutations that do not also lead to hyperproliferation or significant loss in proliferation. Once optimal mutations are identified iPSC lines carrying these mutations will be expanded and microglia derived from these lines will be examined in vivo in chimeric models to determine resistance to CSF1R antagonists in vivo.
[0094] Resistance to each of the CSF1R inhibitors tested was quantified using a fluorogenic caspase 3/7 detector (Essen BioScience) and time-lapse imaging over 24 hours. WT microglia exhibited significant levels of increased caspase to increasing concentrations of PLX3397 (MedChemExpress), PLX5622 (MedChemExpress), Edicotinib, and BLZ945, as compared to DMSO control treatment over 24 hours of imaging, signifying an increased cell death response to inhibiting the macrophage-colony stimulating factor/colony-stimulating factor 1 receptor (CSF1R). On the other hand, G795A and G795C iPSC-microglia exhibited no significant increase in caspase levels to increasing concentrations of either PLX3397, PLX5622, Edicotinib, or BLZ945, as compared to DMSO control treatment. These results indicate an acquired resistance to PLX treatment as a result of the genetically modified CSF1 receptor (see
[0095] Cell death assay: iPS-microglia were plated at 70K cells per 96-well plate (6 wells per line per condition). At time 0, all microglia were treated with IncuCyte Caspase-3/7 Green Apoptosis Assay Reagent 1:1000. Cells were maintained in the described medium: fresh complete medium+0.1% DMSO, complete media+250 nM PLX3397, complete medium+500 nM PLX3397, complete medium+1 μm PLX3397, complete medium+250 nM PLX5622, complete medium+500 nM PLX5622, complete medium+1 μm PLX5622, complete medium+250 nM Edicotinib, complete medium+500 nM Edicotinib, complete medium+1 μm Edicotinib, complete medium+250 nM BLZ945, complete medium+500 nM BLZ945, complete medium+1 μm BLZ945. Four 20× images per well were collected every hour for 24 hours. Using IncuCyte 2020B software, image masks for phase confluence (visually gated out apoptotic cells) as well as caspase 3/7 signal (green) were generated. Graphs display caspase normalized to phase confluence, completed with 3 lines: WT, G795A, G795C (see
Embodiments
[0096] The following embodiments are intended to be illustrative only and not to be limiting in any way.
[0097] Embodiment 1: A modified human cell exhibiting differential resistance to a CSF1R antagonist.
[0098] Embodiment 2: The cell of embodiment 1, comprising a nucleic acid encoding a modified CSF1R protein exhibiting differential resistance to a CSF1R antagonist.
[0099] Embodiment 3: A modified human cell comprising a nucleic acid encoding a modified CSF1R protein exhibiting differential resistance to a CSF1R antagonist.
[0100] Embodiment 4: The cell of any one of embodiments 1-3, comprising one or more genetic modifications in the CSF1R protein.
[0101] Embodiment 5: The cell of embodiment 4, wherein the one or more genetic modifications results in a change in the amino acid sequence of CSF1R, the change optionally comprising the substitution of an amino acid residue selected from G795, L785, M637, E633, and V647.
[0102] Embodiment 6: The cell of any one of embodiments 1-5, wherein the one or more genetic modifications results in a modified ATP binding pocket.
[0103] Embodiment 7: The cell of embodiment 6, wherein the modified ATP binding pocket has reduced binding space.
[0104] Embodiment 8: The cell of embodiment 7, wherein the modified ATP binding pocket cannot bind a CSF1R antagonist.
[0105] Embodiment 9: The cell of embodiment 6, wherein the modified ATP binding pocket can bind ATP.
[0106] Embodiment 10: The cell of any one of embodiments 1-9, wherein the one or more genetic modifications in the CSF1R protein do not interfere with ATP binding activity of the CSF1R protein.
[0107] Embodiment 11: The cell of any one of embodiments 1-10, wherein the one or more genetic modifications in the CSF1R protein do not induce constitutively active CSF1R signaling.
[0108] Embodiment 12: The cell of embodiment 11, wherein the modified CSF1R protein is activated by a CSF1 ligand.
[0109] Embodiment 13: The cell of embodiment 12, wherein the CSF1 ligand induces phosphorylation of the modified CSF1R protein.
[0110] Embodiment 14: The cell of embodiment 11, wherein the modified CSF1R protein is activated by an IL-34 ligand.
[0111] Embodiment 15: The cell of embodiment 14, wherein the IL-34 ligand induces phosphorylation of the modified CSF1R protein.
[0112] Embodiment 16: The cell of embodiment 4, wherein the one or more genetic modifications are introduced ex vivo.
[0113] Embodiment 17: The cell of embodiment 4, wherein the one or more genetic modifications are induced by transfecting or introducing into the cell a nucleic acid encoding a transgene, or by transduction or introduction of a targeted nuclease, nickase or base-editing effector or ribonucleoprotein complex.
[0114] Embodiment 18: The cell of embodiment 17, wherein introducing the nucleic acid encoding a transgene in a cell comprises contacting the cell with a viral vector.
[0115] Embodiment 19: The cell of any one of embodiments 1-18, wherein the cell comprising a modified CSF1R protein retains a gene expression profile of a cell comprising a wild-type CSF1R protein.
[0116] Embodiment 20: The cell of any one of embodiments 1-19, further comprising one or more modifications in another gene.
[0117] Embodiment 21: A modified human cell according to any one of embodiments 1-20 that is expressing CSF1R.
[0118] Embodiment 22: The cell of embodiment 21, wherein the cell is induced and differentiated to express CSF1R and is selected from a group consisting of pluripotent stem cell, hematopoietic stem cell, an erythromyeloid progenitor, and hematopoietic progenitor cell.
[0119] Embodiment 23: The cell of embodiment 22, wherein the cell is a CSF1R-expressing cell and is selected from a group consisting of microglia, macrophages, monocytes, or other phagocytes.
[0120] Embodiment 24: A composition comprising a CSF1R-expressing cell according to any one of embodiments 20-23.
[0121] Embodiment 25: The composition of embodiment 24, wherein the CSF1R-expressing cell is a CSF1R-expressing cell.
[0122] Embodiment 26: The composition of embodiment 25, comprising a plurality of cells, wherein at least 0.1%, 1%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 99% of the cells are CSF1R expressing cells having differential resistance to a CSF1R antagonist.
[0123] Embodiment 27: A method of treating a subject, the method comprising: (a) administering a CSF1R antagonist to the subject in a quantity sufficient to inhibit a CSF1R signal in a cell of the subject; and (b) contacting the subject with a modified CSF1R-expressing cell having a differential resistance to the CSF1R antagonist.
[0124] Embodiment 28: A method of treating a subject, the method comprising: (a) contacting the subject with a modified CSF1R-expressing cell having a differential resistance to a CSF1R antagonist; and (b) administering the CSF1R antagonist to the subject in a quantity sufficient to inhibit a CSF1R signal in a cell of the subject.
[0125] Embodiment 29: The method of embodiment 27 and embodiment 28, wherein the CSF1R-expressing cell is a CSF1R-expressing cell.
[0126] Embodiment 30: The method of any one of embodiments 27-29, wherein the differential resistance to the CSF1R antagonist is partial resistance or complete resistance to the CSF1R antagonist.
[0127] Embodiment 31: The method of any one of embodiments 27-30, wherein the modified CSF1R-expressing cell retains a gene expression profile of a wild-type CSF1R-expressing cell.
[0128] Embodiment 32: The method of any one of embodiments 27-31, wherein the modified CSF1R-expressing cell expresses a gene product or other genetic modification useful to treat, cure, ameliorate, prevent or palliate a neurological disease.
[0129] Embodiment 33: The method of embodiment 32, wherein the gene product is a transgene that is not otherwise expressed by the CSF1R-expressing cell.
[0130] Embodiment 34: The method of embodiment 33, wherein the CSF1R signal that is inhibited by the CSF1R antagonist is proliferation or survival of a CSF1R-expressing cell that is endogenous to the subject.
[0131] Embodiment 35: The method of any one of embodiments 27-34, wherein the CSF1R antagonist is administered to the subject in a quantity sufficient to reduce the proliferation and/or survival of the endogenous CSF1R-expressing cell relative to the modified CSF1R-expressing cell.
[0132] Embodiment 36: A method of treating a subject, the method comprising: (a) contacting the subject with a modified CSF1R-expressing cell, and (b) differentially altering the proliferation or survival of an unmodified CSF1R-expressing cell relative to the modified CSF1R-expressing cell.
[0133] Embodiment 37: The method of embodiment 36, wherein the modified CSF1R-expressing cell is a CSF1R-expressing phagocyte.
[0134] Embodiment 38: The method of embodiment 36 and embodiment 37, wherein the modified CSF1R-expressing cell is partially resistant to a CSF1R antagonist.
[0135] Embodiment 39: The method of embodiment 36, wherein the step of differentially altering the proliferation or survival of the unmodified CSF1R-expressing cell comprising administering the CSF1R antagonist to the subject in a quantity sufficient to reduce proliferation and/or survival of the unmodified CSF1R-expressing cell relative to the modified CSF1R-expressing cell.
[0136] Embodiment 40: A nucleic acid composition encoding a modified CSF1R protein exhibiting differential resistance to a CSF1R antagonist.
[0137] Embodiment 41: The composition of embodiment 40, wherein the differential resistance to the CSF1R antagonist is partial resistance or complete resistance to the CSF1R antagonist.
[0138] Embodiment 42: The composition of embodiment 40, wherein the differential resistance to the CSF1R antagonist is an increased resistance to the CSF1R antagonist.
[0139] Embodiment 43: The composition of embodiment 40, wherein the differential resistance to the CSF1R antagonist is a decreased resistance to the CSF1R antagonist.
[0140] Embodiment 44: The composition of any one embodiments 40-43, wherein the modified CSF1R protein comprises one or more genetic modifications.
[0141] Embodiment 45: The composition of embodiment 44, wherein the one or more genetic modifications results in a change in the amino acid sequence of CSF1R, the change optionally comprising the substitution of an amino acid residue selected from G795, L785, M637, E633, and V647.
[0142] Embodiment 46: The composition of embodiment 44, wherein the one or more genetic modifications results in a modified ATP binding pocket.
[0143] Embodiment 47: The composition of embodiment 46, wherein the modified ATP binding pocket has reduced binding space.
[0144] Embodiment 48: The composition of embodiment 47, wherein the modified ATP binding pocket cannot bind a CSF1R antagonist.
[0145] Embodiment 49: The composition of embodiment 46, wherein the modified ATP binding pocket can bind ATP.
[0146] Embodiment 50: The composition of embodiment 44, wherein the one or more genetic modifications in the CSF1R protein do not interfere with ATP binding activity of the CSF1R protein.
[0147] Embodiment 51: The composition of embodiment 44, wherein the one or more genetic modifications in the CSF1R protein do not induce constitutively active CSF1R signaling.
[0148] Embodiment 52: The composition of embodiment 51, wherein the modified CSF1R protein is activated by a CSF1 ligand.
[0149] Embodiment 53: The composition of embodiment 52, wherein the CSF1 ligand induces phosphorylation of the modified CSF1R protein.
[0150] Embodiment 54: The composition of embodiment 51, wherein the modified CSF1R protein is activated by an IL-34 ligand.
[0151] Embodiment 55: The cell of embodiment 54, wherein the IL-34 ligand induces phosphorylation of the modified CSF1R protein.
[0152] Embodiment 56: An expression vector comprising the nucleic acid composition of any one of embodiments 40-55 operably linked to an expression control sequence.
[0153] Embodiment 57: A cultured cell transfected with the vector of embodiment 56, or a progeny of said cell, wherein the cultured cells express the polypeptide.
[0154] Embodiment 58: An endogenous cell infected with the vector of embodiment 56, wherein the endogenous cells express the polypeptide.
[0155] As used herein, the term “about” refers to plus or minus 20% of the referenced number.
[0156] Although there has been shown and described the preferred embodiment of the present disclosure, it will be readily apparent to those skilled in the art that modifications may be made thereto which do not exceed the scope of the appended claims. Therefore, the scope of the disclosure is only to be limited by the following claims. In some embodiments, the figures presented in this patent application are drawn to scale, including the angles, ratios of dimensions, etc. In some embodiments, the figures are representative only and the claims are not limited by the dimensions of the figures. In some embodiments, descriptions of the disclosure described herein using the phrase “comprising” includes embodiments that could be described as “consisting essentially of” or “consisting of”, and as such the written description requirement for claiming one or more embodiments of the present disclosure using the phrase “consisting essentially of” or “consisting of” is met.