ANTI-AMYLOID BETA ANTIBODIES AND METHODS OF USING THE SAME
20230203143 · 2023-06-29
Inventors
- Fan Liao (Belmont, MA, US)
- Meha Chhaya (Shrewsbury, MA)
- Andrew J. McCluskey (Holden, MA, US)
- Nathan J. Brown (Wayland, MA, US)
Cpc classification
C12N15/79
CHEMISTRY; METALLURGY
C07K2317/70
CHEMISTRY; METALLURGY
A61P25/28
HUMAN NECESSITIES
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
International classification
C12N15/79
CHEMISTRY; METALLURGY
Abstract
The present inventive concept is related to antibodies, such as recombinant humanized and monoclonal antibodies, methods of making antibodies, and methods of using antibodies, such as antibodies directed toward and capable of specifically binding to and clearing amyloid-beta (Aβ) plaques in the brain that are suitable for use in the treatment of disorders such as Alzheimer's Disease (AD).
Claims
1. An anti-human Aβ.sub.pE3 antibody which comprises (i) a variable heavy chain (vH) comprising 3 CDRs; and (ii) a variable light chain (vL) comprising 3 CDRs, wherein: TABLE-US-00020 (SEQ ID NO: 1) vH CDR1 is GFSLSTSGMGVS; (SEQ ID NO: 2) vH CDR2 is HIYWDDDKRYNPYMKR; (SEQ ID NO: 3) vH CDR3 is RADDYDVGFAY; (SEQ ID NO: 4) vL CDR1 is LASQTIGTWLA; (SEQ ID NO: 5) vL CDR2 is AATSLAD; and (SEQ ID NO: 6) vL CDR3 is QQLYSSPFT.
2. The anti-human Aβ.sub.pE3 antibody of claim 1, wherein the antibody comprises a heavy chain variable region comprising the amino acid sequence set forth as SEQ ID NO:7 and a light chain variable region comprising the amino acid sequence set forth as SEQ ID NO:8.
3. The anti-human Aβ.sub.pE3 antibody of claim 1, wherein the antibody comprises two heavy chains, each heavy chain comprising the amino acid sequence set forth as SEQ ID NO:9, and two light chains, each light chain comprising the amino acid sequence set forth as SEQ ID NO:10.
4. The anti-human Aβ.sub.pE3 antibody of claim 1, wherein the antibody comprises an IgG constant region.
5. The anti-human Aβ.sub.pE3 antibody of claim 4, wherein the antibody comprises a human heavy chain constant region comprising an Fc portion, wherein the Fc portion is a human IgG1, IgG2, IgG3, IgG4, or IgM isotype.
6. The anti-human Aβ.sub.pE3 antibody of claim 5, wherein the antibody comprises a kappa light chain constant region.
7. A composition comprising the anti-human Aβ.sub.pE3 antibody of claim 1.
8. A method for treating a neurodegenerative disorder comprising administering the anti-human Aβ.sub.pE3 antibody of claim 1 to a patient in need thereof.
9. The method of claim 8, wherein the neurodegenerative disorder is Alzheimer's disease (AD).
10. A polynucleotide comprising a nucleotide sequence encoding an anti-human Aβ.sub.pE3 antibody, wherein the antibody comprises (i) a vH chain comprising three CDRs; and (ii) a vL chain comprising three CDRs, wherein: TABLE-US-00021 (SEQ ID NO: 1) vH CDR1 is GFSLSTSGMGVS; (SEQ ID NO: 2) vH CDR2 is HIYWDDDKRYNPYMKR; (SEQ ID NO: 3) vH CDR3 is RADDYDVGFAY; (SEQ ID NO: 4) vL CDR1 is LASQTIGTWLA; (SEQ ID NO: 5) vL CDR2 is AATSLAD; and (SEQ ID NO: 6) vL CDR3 is QQLYSSPFT.
11. A vector comprising the polynucleotide of claim 10.
12. A eukaryotic host cell transformed with the vector of claim 11.
13. The eukaryotic host cell of claim 12, which is a mammalian host cell.
14. A method for producing an anti-human Aβ.sub.pE3 antibody comprising: (a) culturing the mammalian host cell of claim 13 and (b) recovering the anti-human Aβ.sub.pE3 antibody.
15. An anti-human Aβ.sub.pE3 antibody, wherein the antibody comprises two heavy chains, each heavy chain comprising the amino acid sequence set forth as SEQ ID NO: 37 and two light chains, each light chain comprising the amino acid sequence set forth as SEQ ID NO: 10.
Description
6. BRIEF DESCRIPTION OF THE DRAWINGS
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
7. DETAILED DESCRIPTION
[0031] For the purposes of promoting an understanding of the principles of the present disclosure, reference will now be made to various embodiments. It will nevertheless be understood that no limitation of the scope of the disclosure is thereby intended, such alteration and further modifications of the disclosure as illustrated herein, being contemplated as would normally occur to one skilled in the art to which the disclosure relates.
[0032] Articles “a,” “an,” and “the” are used herein to refer to one or to more than one (i.e., at least one) of the grammatical object of the article. By way of example, “an element” means at least one element and can include more than one element. The term “and/or” includes any and all combinations of one, or more, of the associated listed items and may be abbreviated as “/”.
[0033] The term “comprise,” as used herein, in addition to its regular meaning, may also include, and, in some embodiments, may specifically refer to the expressions “consist essentially of” and/or “consist of.” Thus, the expression “comprise” can also refer to embodiments, wherein that which is claimed “comprises” specifically listed elements does not include further elements, as well as embodiments wherein that which is claimed “comprises” specifically listed elements may and/or does encompass further elements, or encompass further elements that do not materially affect the basic and novel characteristic(s) of that which is claimed. For example, that which is claimed, such as a method, kit, system, etc. “comprising” specifically listed elements also encompasses, for example, a method, kit, system, etc. “consisting of,” i.e., wherein that which is claimed does not include further elements, and, for example, a method, kit, system, etc. “consisting essentially of,” i.e., wherein that which is claimed may include further elements that do not materially affect the basic and novel characteristic(s) of that which is claimed.
[0034] “About,” as used herein, is intended to qualify the numerical values which it modifies, denoting such a value as variable within a margin of error. When no particular margin of error, such as a standard deviation to a mean value given in a chart or table of data, is recited, the term “about” should be understood to mean that range which may encompass, for example, ±20%, ±15%, or ±10%, and in some embodiments, ±5%, ±3%, or ±2%, of the recited value and the range is included.
[0035] Unless otherwise defined, all technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs.
[0036] Embodiments of the disclosure relate to antibodies that bind to deposited forms of Aβ in the brain to stimulate an immune response that aids in clearing the protein, and methods of using these antibodies, for example, in the treatment of AD.
[0037] Aβ.sub.pE3 is a form of Aβ that appears to be especially fast-aggregating (Jawhar, Wirths et al. 2011). Given that donanemab, which targets Aβ.sub.pE3, achieved rapid plaque removal from human AD brain and Aβ.sub.pE3 is less prevalent in the cerebral vasculature relative to other forms of Aβ (Kuo, Emmerling et al. 1997), anti-Aβ.sub.pE3 antibodies, such as AC-264713, aiming to achieve rapid plaque removal with a lower risk for ARIA were generated.
[0038] AC-264713 is a recombinant humanized IgG1 kappa mAb that binds to Aβ.sub.pE3. The origin of AC-264713 is a murine mAb that binds to Aβ.sub.pE3. The variable domains of the murine antibody were humanized and then were fused with human IgG1 heavy chain and Ig kappa light constant regions to create AC-264713. It will be appreciated that humanizing, for example, a murine mAb, to provide a humanized mAb, such as the antibodies of the present disclosure, may be accomplished by any method known to one of skill in the art without limitation.
[0039] In some embodiments, the antibody of the disclosure comprises two variable chains, one heavy and one light. On each variable chain, there are three CDRs that allow the antibody to bind to Aβ.sub.pE3. On the heavy and light variable chains, there are a combined total of six different CDRs. Additionally, in an embodiment the antibody contains a human heavy chain constant region including a human Fc of the immunoglobulin class G1 (IgG1). The anti-Aβ.sub.pE3 antibodies described herein can be fucosylated or afucosylated and demonstrate in vitro functionality, immunosafety, and drug-like properties.
[0040] Antibodies according to the disclosure were generated via humanization and liability engineering of an antibody identified in a hybridoma campaign using the human Aβ.sub.pE3-42 fibrils. To prioritize antibodies for humanization, the ability of antibodies to bind fibrillary Aβ.sub.pE3-42 was evaluated. The anti-Aβ.sub.pE3 antibody AC-264713 cross-reacts with human and cynomolgus Aβ.sub.pE3, but does not bind mouse or rat Aβ.sub.pE3.
[0041] As used herein, the term “antibody” (Ab) refers to an immunoglobulin molecule that specifically binds to a particular antigen, e.g., human Aβ.sub.pE3 fibrils. The anti-Aβ.sub.pE3 antibodies of the inventive concept bind to Aβ.sub.pE3 and thereby modulate the immune system. Anti-Aβ.sub.pE3 antibodies of the inventive concept include complementarity determining regions (CDRs), also known as hypervariable regions, in both the light chain and the heavy chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FR). As is known in the art, the amino acid position/boundary delineating a hypervariable region of an antibody can vary, depending on the context and the various definitions known in the art. Some positions within a variable domain may be viewed as hybrid hypervariable positions in that these positions can be deemed to be within a hypervariable region under one set of criteria while being deemed to be outside a hypervariable region under a different set of criteria. One or more of these positions can also be found in extended hypervariable regions. The inventive concept provides antibodies including modifications in these hybrid hypervariable positions. The variable domains of native heavy and light chains each include four FR regions, largely by adopting a β-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the β-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the target binding site of antibodies. See Kabat et al., Sequences of Proteins of Immunological Interest (National Institute of Health, Bethesda, Md. 1987), which can be used to identify and number CDR sequences within a variable domain.
[0042] The antibodies of the disclosure may be monoclonal, genetically engineered, and/or otherwise modified in nature, including but not limited to chimeric antibodies, humanized antibodies, single chain antibodies, etc. In various embodiments, the antibodies include all or a portion of a constant region of an antibody. In some embodiments, the constant region is an isotype selected from: IgA (e.g., IgA1 or IgA2), IgD, IgE, IgG (e.g., IgG1, IgG2, IgG3 or IgG4), and IgM. In specific embodiments, the anti-Aβ.sub.pE3 antibodies described herein include an IgG1. In other embodiments, the anti-Aβ.sub.pE3 antibodies include an IgG2. In yet other embodiments, the anti-Aβ.sub.pE3 antibodies include an IgG4. As used herein, the “constant region” of an antibody includes the natural constant region, allotypes or variants.
[0043] The light constant region of an anti-Aβ.sub.pE3 antibody may be a kappa (κ) light region or a lambda (λ) region. A λ light region can be any one of the known subtypes, e.g., λ1, λ2, λ3, or λ4. In some embodiments, an anti-Aβ.sub.pE3 antibody includes a kappa (κ) light region.
[0044] The term “monoclonal antibody” as used herein is not limited to antibodies produced through hybridoma technology. A monoclonal antibody is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, by any means available or known in the art. Monoclonal antibodies useful with the present inventive concept can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof.
[0045] The term “chimeric” antibody as used herein refers to an antibody having variable sequences derived from a non-human immunoglobulin, such as a rat or a mouse antibody, and human immunoglobulin constant regions, typically chosen from a human immunoglobulin template.
[0046] “Humanized” forms of non-human (e.g., murine) antibodies include substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody can also include at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin consensus sequence.
[0047] Anti-Aβ.sub.pE3 antibodies of the disclosure include full-length (intact) antibody molecules comprising two full-length light chains and two full-length heavy chains.
[0048] Anti-Aβ.sub.pE3 antibodies that include a human IgG4 constant region can include the S228P mutation, which has been reported to prevent Fab arm exchange. See, e.g., Silva, J P et al. Journal of Biological Chemistry, 290(9), 5462-5469 (2015).
[0049] Anti-Aβ.sub.pE3 antibodies with high affinity for Aβ.sub.pE3 may be desirable for therapeutic and diagnostic uses. Accordingly, the present inventive concept contemplates antibodies having a high binding affinity to Aβ.sub.pE3. In specific embodiments, the anti-Aβ.sub.pE3 antibodies bind to Aβ.sub.pE3 with an affinity of at least about 25 nM, but may exhibit higher affinity, for example, at least about 20 nM, 15 nM, 10 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.1 nM, 0.01 nM, or even higher. In some embodiments, the antibodies bind human Aβ.sub.pE3 with an affinity in the range of about 1 pM to about 10 nM, of about 100 pM to about 10 nM, about 100 pM to about 1 nM, about 100 pM to about 2 nM, or an affinity ranging between any of the foregoing values.
[0050] In some embodiments, the disclosure provides a monoclonal anti-Aβ.sub.pE3 antibody with two full-length heavy chains and two full-length light chains, which comprise two sets of six different complementarity-determining regions (CDRs) within two sets of two different variable regions.
[0051] In some embodiments, the antibody is a recombinant, afucosylated, humanized, IgG1 kappa monoclonal antibody that binds to Aβ.sub.pE3.
[0052] In an embodiment, the antibody comprises six CDRs including the following sequences:
TABLE-US-00007 (SEQ ID NO: 1) vH CDR1 is GFSLSTSGMGVS; (SEQ ID NO: 2) vH CDR2 is HIYWDDDKRYNPYMKR; (SEQ ID NO: 3) vH CDR3 is RADDYDVGFAY; (SEQ ID NO: 4) vL CDR1 is LASQTIGTWLA; (SEQ ID NO: 5) vL CDR2 is AATSLAD; and (SEQ ID NO: 6) vL CDR3 is QQLYSSPFT.
[0053] In some embodiments, the antibody of the disclosure comprises a vH CDR1 including or having the amino acid sequence as set forth in SEQ ID NO:1, a vH CDR2 including or having the amino acid sequence as set forth in SEQ ID NO:2; a vH CDR3 including or having the amino acid sequence as set forth in SEQ ID NO:3, a vL CDR1 including or having the amino acid sequence as set forth in SEQ ID NO:4, a vL CDR2 including or having the amino acid sequence as set forth in SEQ ID NO:5; and a vL CDR3 including or having the amino acid sequence as set forth in SEQ ID NO:6.
[0054] In some embodiments, the antibody of the disclosure comprises a heavy chain variable region including or having the amino acid sequence as set forth in SEQ ID NO:7, or a sequence having at least 98% sequence identity to SEQ ID NO:7:
TABLE-US-00008 (SEQ ID NO: 7) EVQLQESGPGLVKPSQTLSLTCTFSGFSLSTSGMGVSWIRQPPGKGLEW LAHIYWDDDKRYNPYMKRRLTISKDTSKNQVSLKISSVTAADTAVYYCA RRADDYDVGFAYWGQGTLVTVSS
[0055] In some embodiments, the antibody of the disclosure comprises a light chain variable region including or having the amino acid sequence as set forth in SEQ ID NO:8, or a sequence having at least 98% sequence identity to SEQ ID NO:8:
TABLE-US-00009 (SEQ ID NO: 8) DIQMTQSPSSVSASVGDRVTITCLASQTIGTWLAWYQQKPGKSPKLLIY AATSLADGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLYSSPFTF GQGTKLEIK
[0056] In some embodiments, the antibody of the disclosure comprises a heavy chain including or having the amino acid sequence as set forth in SEQ ID NO:9, or a sequence having at least 98% sequence identity to SEQ ID NO:9 (constant region is bold; the variable heavy domain is underlined; CDRs are underlined bold italic (as set forth in SEQ ID NOS:1-3, respectively, in order of appearance)):
TABLE-US-00010 (SEQ ID NO: 9) EVQLQESGPGLVKPSQTLSLTCTFS WIRQPPGKGLE WLA
RLTISKDTSKNQVSLKISSVTAADTAVYY CAR
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTA ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV PSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK.
[0057] In some embodiments, the antibody of the disclosure includes a heavy chain having the C-terminal lysine truncated, for example, a heavy chain as set forth in SEQ ID NO:9, with the C-terminal lysine truncated/removed.
[0058] In some embodiments, the antibody of the disclosure comprises a light chain including or having the amino acid sequence as set forth in SEQ ID NO:10, or a sequence having at least 98% sequence identity to SEQ ID NO:10 (constant region is bold; the variable heavy domain is underlined; CDRs are underlined bold italic (as set forth in SEQ ID NOS:4-6, respectively, in order of appearance)):
TABLE-US-00011 (SEQ ID NO: 10) DIQMTQSPSSVSASVGDRVTITC WYQQKPGKSPKLLIY
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC
F GQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV THQGLSSPVTKSFNRGEC.
[0059] Embodiments of the inventive concept also include nucleic acids that encode the heavy chain sequences of SEQ ID NO:9, and nucleic acids that encode the light chain sequence of SEQ ID NO:10. In some embodiments, for example, the mature heavy chain sequence as set forth in SEQ ID NO:9 may be encoded by the nucleic acid sequence set forth in SEQ ID NO:13 (the constant region is encoded by the sequences in bold; the variable heavy domain is encoded by the sequences that are underlined; and the CDRs are encoded by sequences are
TABLE-US-00012 (SEQ ID NO: 13) GAAGTGCAGCTGCAAGAGTCCGGCCCGGGCTTGGTCAAGCCGTCGCAG ACCCTCAGCCAAACAAGCACCAACACG
ATCAGGCAGCCTCCTGGCAAA GGGCTGGAGTGGCTTGCC
CGCCTGACCATCAGCAA GGACACCTCCAAAAACCAAGTCTCGCTGAAGATCTCCTCCGTGACCGC CGCGGATACCGCCGTGTACTACTGCGCCCGG
TGGGGACAGGGGACCCTGGTCACCG TGTCCTCCGCCTCAACTAAGGGACCCAGCGTGTTCCCTCTCGCCCCAT CATCGAAGTCCACTAGTGGCGGGACCGCTGCTCTCGGTTGTCTGGTTA AGGACTACTTCCCGGAACCCGTCACCGTATCATGGAACTCCGGTGCAC TGACATCCGGCGTGCACACCTTCCCGGCCGTGCTGCAAAGCTCCGGAC TGTACTCCCTGTCGAGCGTGGTCACTGTGCCCTCATCAAGCCTGGGTA CTCAGACGTACATTTGCAACGTGAACCACAAGCCGTCCAACACCAAGG TCGACAAGAAAGTGGAGCCGAAGTCCTGCGACAAGACCCATACTTGCC CGCCGTGCCCAGCCCCTGAGCTGCTGGGTGGACCGAGCGTGTTCCTGT TCCCACCTAAACCCAAGGACACCCTGATGATTAGCCGCACCCCCGAAG TGACCTGTGTGGTCGTGGATGTGTCCCACGAAGATCCCGAAGTCAAGT TCAATTGGTACGTGGACGGCGTCGAAGTGCATAACGCCAAGACTAAGC CCCGCGAGGAACAGTACAACAGCACCTACCGGGTGGTGTCCGTGCTCA CTGTCCTGCACCAAGACTGGCTGAACGGAAAGGAGTACAAGTGCAAAG TGTCCAACAAGGCACTGCCAGCGCCCATCGAGAAAACGATCAGCAAGG CCAAGGGCCAGCCGAGAGAACCTCAGGTCTACACCCTGCCGCCATCCC GGGAAGAAATGACCAAGAACCAAGTGTCCCTTACCTGTCTCGTGAAGG GATTCTACCCTTCCGACATCGCCGTGGAGTGGGAGTCCAATGGACAGC CGGAGAACAACTACAAGACTACCCCTCCTGTGCTGGACTCCGATGGAT CTTTCTTCCTGTACTCGAAGCTCACCGTGGATAAGTCGCGGTGGCAAC AGGGGAATGTGTTCAGCTGCTCCGTGATGCACGAAGCTCTGCATAACC ACTACACTCAGAAGTCGCTGTCACTCTCCCCCGGGAAA
[0060] In some embodiments, for example, the mature light chain sequence as set forth in SEQ ID NO:10 may be encoded by the nucleic acid sequence set forth in SEQ ID NO: 14 (the constant region is encoded by the sequences in bold; the variable light domain is encoded by the sequences that are underlined; and the CDRs are encoded by sequences are underlined bold
TABLE-US-00013 (SEQ ID NO: 14) GACATCCAGATGACCCAGTCCCCGTCCTCGGTGTCAGCGTCAGTGGGG GACAGGGTCACGATCACTTGC
TGGTATCAGCAGAAGCCCGGAAAGTCACCG AAGCTGTTGATCTAC
GGCGTGCCCT CGCGGTTCTCCGGTTCCGGGTCGGGAACTGACTTTACCCTGACCATTA GCTCTCTGCAACCTGAGGACTTCGCCACCTACTACTGT
TTCGGACAAGGCACCAAGT TGGAAATCAAGCGGACTGTGGCGGCACCCAGCGTGTTCATCTTTCCTC CATCCGACGAACAGCTGAAGTCCGGTACCGCTAGCGTGGTCTGTCTCC TGAACAACTTCTACCCGCGCGAGGCCAAGGTCCAGTGGAAGGTCGACA ACGCGCTCCAGAGCGGCAACAGTCAGGAATCCGTGACCGAACAGGACT CCAAGGATTCGACCTACTCGCTGTCCTCCACTCTCACCCTGTCCAAAG CCGATTACGAGAAGCACAAAGTGTACGCTTGCGAAGTGACCCATCAAG GCCTTAGCAGCCCCGTGACAAAGTCCTTCAATCGGGGAGAGTGC
[0061] It will be appreciated by one of skill in the art that, as a result of codon degeneracy in the genetic code, nucleic acid sequences that differ from the sequences as set forth in SEQ ID NOS:13, 14, 15, and 16, encoding the heavy chain sequence of SEQ ID NO:9, the light chain sequence of the of SEQ ID NO:10, the heavy chain sequence of SEQ ID NO:11 and the light chain sequence of the of SEQ ID NO:12 respectively, are contemplated without departing from the scope of the inventive concept.
[0062] In some embodiments, the antibody comprises a human heavy chain constant region including human CH1, human hinge, human CH2, and human CH3 domain. In some embodiments, the encoded heavy chain constant region comprises an Fc portion, wherein the Fc portion is a human IgG1, IgG2, IgG3, IgG4, or IgM isotype. In an embodiment, the Fc is an IgG1, and the allotype is z, non-a. In an embodiment, the light chain is a kappa light chain.
Polynucleotides Encoding the Anti-Aβ.SUB.pE3 .Antibodies, Expression Systems and Methods of Making the Antibodies
[0063] The present inventive concept encompasses polynucleotide molecules encoding immunoglobulin light and heavy chain genes for anti-Aβ.sub.pE3 antibodies, vectors including such polynucleotides, and host cells capable of producing the anti-Aβ.sub.pE3 antibodies of the disclosure.
[0064] An anti-Aβ.sub.pE3 antibody of the disclosure can be prepared by recombinant expression of immunoglobulin light and heavy chain genes in a host cell. To express an antibody recombinantly, a host cell is transfected with one or more recombinant expression vectors carrying DNA fragments encoding the immunoglobulin light and heavy chains of the antibody such that the light and heavy chains are expressed in the host cell and, optionally, secreted into the medium in which the host cells are cultured, from which medium the antibodies can be recovered.
[0065] To generate polynucleotides encoding such anti-Aβ.sub.pE3 antibodies, DNA fragments encoding the light and heavy chain variable regions are first obtained. These DNAs can be obtained by amplification and modification of germline DNA or cDNA encoding light and heavy chain variable sequences, for example using the polymerase chain reaction (PCR)
[0066] Once DNA fragments encoding anti-Aβ.sub.pE3 antibody-related VH and VL segments are obtained, these DNA fragments can be further manipulated by standard recombinant DNA techniques, for example to convert the variable region genes to full-length antibody chain genes, to Fab fragment genes or to a scFv gene. In these manipulations, a VL- or VH-encoding DNA fragment is operatively linked to another DNA fragment encoding another protein, such as an antibody constant region or a flexible linker. The term “operatively linked,” as used in this context, is intended to mean that the two DNA fragments are joined such that the amino acid sequences encoded by the two DNA fragments remain in-frame.
[0067] The isolated DNA encoding the VH region can be converted to a full-length heavy chain gene by operatively linking the VH-encoding DNA to another DNA molecule encoding heavy chain constant regions (CH1, CH2, CH3 and, optionally, CH4). The sequences of human heavy chain constant region genes are known in the art (See, e.g., Kabat, E. A., et al., 1991, Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification. The heavy chain constant region can be an IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM or IgD constant region, but in certain embodiments is an IgG1 or IgG4. For a Fab fragment heavy chain gene, the VH-encoding DNA can be operatively linked to another DNA molecule encoding only the heavy chain CH1 constant region.
[0068] The isolated DNA encoding the VL region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the VL-encoding DNA to another DNA molecule encoding the light chain constant region, CL. The sequences of human light chain constant region genes are known in the art (See, e.g., Kabat, et al., 1991, Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification. The light chain constant region can be a kappa or lambda constant region, but in certain embodiments is a kappa constant region.
[0069] To express the anti-Aβ.sub.pE3 antibodies, DNAs encoding partial or full-length light and heavy chains, obtained as described above, are inserted into expression vectors such that the genes are operatively linked to transcriptional and translational control sequences. In this context, the term “operatively linked” is intended to mean that an antibody gene is ligated into a vector such that transcriptional and translational control sequences within the vector serve their intended function of regulating the transcription and translation of the antibody gene. The expression vector and expression control sequences are chosen to be compatible with the expression host cell used. The antibody light chain gene and the antibody heavy chain gene can be inserted into separate vectors or, more typically, both genes are inserted into the same expression vector.
[0070] The antibody genes are inserted into the expression vector by standard methods (e.g., ligation of complementary restriction sites on the antibody gene fragment and vector, or blunt end ligation if no restriction sites are present). Prior to insertion of the anti-Aβ.sub.pE3 antibody-related light or heavy chain sequences, the expression vector can already carry antibody constant region sequences. For example, one approach to converting the anti-Aβ.sub.pE3 monoclonal antibody-related VH and VL sequences to full-length antibody genes is to insert them into expression vectors already encoding heavy chain constant and light chain constant regions, respectively, such that the VH segment is operatively linked to the CH segment(s) within the vector and the VL segment is operatively linked to the CL segment within the vector. Additionally or alternatively, the recombinant expression vector can encode a signal peptide that facilitates secretion of the antibody chain from a host cell. The antibody chain gene can be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the antibody chain gene. The signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide (i.e., a signal peptide from a non-immunoglobulin protein).
[0071] In addition to the antibody chain genes, the recombinant expression vectors of the disclosure carry regulatory sequences that control the expression of the antibody chain genes in a host cell. The term “regulatory sequence” is intended to include promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
[0072] In addition to the antibody chain genes and regulatory sequences, the recombinant expression vectors of the disclosure can carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes. The selectable marker gene facilitates selection of host cells into which the vector has been introduced. For expression of the light and heavy chains, the expression vector(s) encoding the heavy and light chains is transfected into a host cell by standard techniques. The various forms of the term “transfection” are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, lipofection, calcium-phosphate precipitation, DEAE-dextran transfection and the like.
[0073] It is possible to express the antibodies of the disclosure in either prokaryotic or eukaryotic host cells. In certain embodiments, expression of antibodies is performed in eukaryotic cells, e.g., mammalian host cells, of optimal secretion of a properly folded and immunologically active antibody. Exemplary mammalian host cells for expressing the recombinant antibodies of the disclosure include Chinese Hamster Ovary (CHO cells) (including DHFR-CHO cells, described in Urlaub and Chasin, 1980, Proc. Natl. Acad. Sci. USA 77:4216-4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp, 1982, Mol. Biol. 159:601-621), NSO myeloma cells, COS cells and SP2 cells. When recombinant expression vectors encoding antibody genes are introduced into mammalian host cells, the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or secretion of the antibody into the culture medium in which the host cells are grown. Antibodies can be recovered from the culture medium using standard protein purification methods. Host cells can also be used to produce portions of intact antibodies, such as Fab fragments or scFv molecules. It is understood that variations on the above procedure are within the scope of the present disclosure. For example, it can be desirable to transfect a host cell with DNA encoding either the light chain or the heavy chain (but not both) of an anti-Aβ.sub.pE3 antibody of the disclosure.
[0074] Recombinant DNA technology can also be used to remove some or all of the DNA encoding either or both of the light and heavy chains that is not necessary for binding to Aβ.sub.pE3. The molecules expressed from such truncated DNA molecules are also encompassed by the antibodies of the disclosure.
[0075] For recombinant expression of an anti-Aβ.sub.pE3 antibody of the disclosure, the host cell can be co-transfected with two expression vectors of the disclosure, the first vector encoding a heavy chain derived polypeptide and the second vector encoding a light chain derived polypeptide. The two vectors can contain identical selectable markers, or they can each contain a separate selectable marker. Alternatively, a single vector can be used which encodes both heavy and light chain polypeptides.
[0076] Once a polynucleotide encoding one or more portions of an anti-Aβ.sub.pE3 antibody has been obtained, further alterations or mutations can be introduced into the coding sequence, for example to generate polynucleotides encoding antibodies with different CDR sequences, antibodies with reduced affinity to the Fc receptor, e.g., antibodies with LALA mutations, or antibodies of different subclasses. It will be appreciated that further alterations and/or mutations can be introduced into the coding sequence to generate polynucleotides encoding antibodies may be accomplished by any method known to one of skill in the art without limitation, and the polynucleotides generated used to produce, for example, further anti-Aβ.sub.pE3 antibodies, such as anti-Aβ.sub.pE3 antibodies with reduced affinity to the Fc receptor, and/or anti-Aβ.sub.pE3 antibodies of different subclasses.
[0077] The anti-Aβ.sub.pE3 antibodies of the disclosure can also be produced by chemical synthesis or by using a cell-free platform.
Purification of Anti-Aβ.SUB.pE3 .Antibodies
[0078] Once a polypeptide of the disclosure has been produced by recombinant expression, it can be purified by any method known in the art for purification of a protein.
[0079] Once isolated, an anti-Aβ.sub.pE3 antibody can be further purified.
Compositions
[0080] The antibodies of this disclosure may be provided as a composition suitable for administration to a subject. In some embodiments, the antibody composition is a pharmaceutical composition, including an antibody of this disclosure and a pharmaceutically acceptable carrier.
Summary of Properties of Subject Antibodies
[0081] Properties of subject antibodies, exemplified by but not limited to AC-264713, include the following:
[0082] High affinity binding to human Aβ.sub.pE3 fibrils, e.g., EC.sub.50 for human Aβ.sub.pE3-42 fibrils as determined in, for example, by the direct binding ELISA of Example 1 of about 2.5 nM or lower, 2 nM or lower, 1.5 nM or lower, 1 nM or lower, 0.9 nM or lower, 0.8 nM or lower, 0.7 nM or lower, 0.6 nM or lower, about 0.5 nM or lower, 0.4 nM or lower, about 0.3 nM or lower, about 0.2 nM or lower, about 0.1 nM or lower, or about 0.05 nM or lower, or any range of values for EC.sub.50 between about 0.05 nM and about 2.5 nM.
[0083] High specificity binding to human Aβ.sub.pE3 fibrils, e.g., no significant cross-reacting with human Aβ.sub.pE11-40 fibrils, and no significant cross reacting with Aβ.sub.1-40 from all species, including human, monkey, dog, rabbit, rat, and mouse.
[0084] Good immunosafety determined by cytokine release assay.
[0085] In some embodiments, the antibodies of the disclosure may, for example, exhibit binding to AD brains that contain amyloid plaques in a dose-dependent manner with an EC.sub.50 of 0.4 μg/mL, while not binding to non-AD human, rat, or cynomolgus monkey brain tissue where amyloid plaques are not present.
[0086] Data from a study using an APPPS1-21 mouse model that expresses human transgenes for amyloid precursor protein and presenilin 1 indicated that AC-264713 enters the brain and binds to Aβ plaques after a single injection. AC-264713 also binds to amyloid plaques in human brain tissue from donors with AD. Additionally, in vitro data demonstrated that the fragment crystallizable (Fc) portion of AC-264713 has full effector function to trigger plaque removal mediated via hiPSC-derived phagocytes. When evaluated in an acute microhemorrhage model using APPPS1-21 mice, AC-264713 did not induce microhemorrhage. Taken together, the data support that AC-264713, i.e., an anti-human Aβ.sub.pE3 fibril monoclonal antibody with full effector function removes amyloid plaques from an AD brain.
Methods of Use
[0087] In embodiments, the methods described herein involve treating patients who have AD with the anti-Aβ.sub.pE3 antibodies of the disclosure.
[0088] “Inhibiting”, “reducing,” or any variation of these terms in relation to, e.g., treating AD and the development of Aβ plaques related to AD includes any measurable decrease or complete inhibition to achieve a desired result. For example, there may be a decrease (removal) of about, at most about, or at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% of Aβ plaque load, or more, or any range derivable therein, or reduction in development of Aβ plaques in, and the treatment of, a patient with AD.
8. EXAMPLES
[0089] The following examples, which highlight certain features and properties of the exemplary embodiments of the inventive concept described herein are provided for purpose of illustration.
Example 1: Panel of Identified Recombinant Hybridoma mAbs Binding to Recombinant Aβ Proteins
[0090] Direct binding ELISA was employed to assess the ability of identified and recombinantly expressed panel of mAbs for binding to human Aβ.sub.pE3-42 fibrils and their cross-reactivity to human Aβ.sub.1-40, human Aβ.sub.1-42 or human Aβ.sub.pE11-40. Due to 100% sequence identity between human, monkey, dog, and rabbit; binding studies were done with human Aβ.sub.1-40 and Aβ.sub.1-42 as representative for these other species. Recombinant human Aβ proteins were diluted in 0.2 M carbonate-bicarbonate buffer. Aβ proteins were diluted from 0.1 mM/0.2 mM stock solution to a working concentration of 1 μg/mL, and 50 μL per well (50 ng/well) was added to 96-well half area high-binding ELISA plates. The plates were incubated overnight at 4° C. shaking at 100 rpm. Following coating, the plates were washed four times with 190 μL/well of 1×PBS using an automated plate washer. The plates were blocked with 190 μL/well of 2% BSA in DPBS and incubated for 1 hr. at room temperature (RT). Reagents for ELISA were diluted in 0.25% BSA in DPBS.
TABLE-US-00014 List of Ap peptides tested in ELISA Peptide Sequence Sequence Aβ.sub.pE3-42 (Pyr-E)FRHDSGYEV SEQ ID NO: 17 fibrils HHQKLVFFAE DVGSNKGAII GLMVGGVVIA Aβ.sub.pE11-40 (Pyr-E)VHHQKLVFF SEQ ID NO: 18 fibrils AEDVGSNKGA IIGLMVGGVV Aβ 3-42 EFRHDSGYEV HHQKLVFFAE SEQ ID NO: 19 monomer DVGSNKGAII GLMVGGVVIA Aβ 3-42 EFRHDSGYEV HHQKLVFFAE SEQ ID NO: 19 fibrils DVGSNKGAII GLMVGGVVIA Aβ 1-40 DAEFRHDSGY EVHHQKLVFF SEQ ID NO: 20 fibrils AEDVGSNKGAIIGLMVGGVV Aβ 1-42 DAEFRHDSGY EVHHQKLVFF SEQ ID NO: 21 fibrils AEDVGSNKGAIIGLMVGGVV IA Mouse/Rat DAEFGHDSGF EVRHQKLVFF SEQ ID NO: 22 Aβ 1-40 AEDVGSNKGAIIGLMVGGVV
[0091] Dilutions for the panel of mAbs were prepared in dilution plates from stock solutions to a working 1× initial concentration of either 67 nM or 100 nM, and an 8-point 5× dilution series for each mAb was performed. After incubation for blocking, plates were washed four times with 190 μL/well of 1×PBS using automated plate washer. Anti-mouse IgG-HRP at a 1:10,000 dilution was prepared for detection and 50 μL was added to each well. The plates were incubated for 30 min at RT. After four washes with 1×PBS, 50 μL of TMB substrate (Life Technology, 002023) was added into each well, and the plates were incubated at RT for about 5-10 min until color developed. The reaction was stopped by adding 50 μL per well of 2N sulfuric acid. Plates were read on a plate reader to obtain the absorbance at 450 nm (OD.sub.450). Binding (EC.sub.50) of mAbs to Aβ proteins was calculated using nonlinear regression (4-parameter dose-response curve model: Y=Bottom+(TopBottom)/(1+10{circumflex over ( )}((Log IC50−X)*Hillslope))) in GraphPad Prism 8.4.3.
[0092] Monoclonal antibody (mAb) AC-233661 showed specificity and selectivity for the Aβ.sub.pE3-42 species and was selected for humanization. AC-264713 is the humanized version of AC-233661.
[0093] In some cases, AC-264713 is characterized using a comparator antibody. Amino acid sequences for antibodies included in experiments for comparison purposes are described below:
TABLE-US-00015 Antibody Comparator Ab1 Heavy Chain SEQ ID NO: 23 Light Chain SEQ ID NO: 24 Comparator Ab2 Heavy Chain SEQ ID NO: 25 Light Chain SEQ ID NO: 26 Mouse precursor antibody Heavy Chain SEQ ID NO: 11 (AC-233661) Light Chain SEQ ID NO: 12
Example 2: Binding Specificity and Epitope Identification
[0094] A. Binding Specificity to Human Aβ.sub.pE3-42 Fibrils
[0095] Binding of AC-264713 against human Aβ.sub.pE3-42 fibrils was assessed using the methods as described in Example 1, except that anti-human IgG-HRP was used for detection instead of anti-mouse IgG-HRP. The EC.sub.50 value for binding of AC-264713 against human Aβ.sub.pE3-42 fibrils is 0.7 nM.
[0096] B. Epitope Identification
[0097] Ten biotinylated peptides from N-terminal 3-16 amino acid length with glycine point positional changes substituting each amino acid starting from amino acid three were generated with biotin at the C-terminus as listed below.
TABLE-US-00016 List of glycine positional mutated Ap peptides Peptide Sequence SEQ ID NO: pE3-16 Pyr-EFRHDSGYEVHHQK-Biotin SEQ ID NO: 27 4-16-FRHDSGYEVHHQK-Biotin SEQ ID NO: 28 5-16-RHDSGYEVHHQK-Biotin SEQ ID NO: 29 E3-16-EFRHDSGYEVHHQK-Biotin SEQ ID NO: 30 pEG4 Pyr-E RHDSGYEVHHQK-Biotin SEQ ID NO: 31 mpE3 16-Pyr-EF
HDSGFEVHHQK-Biotin SEQ ID NO: 32 pEG6 Pyr EFR
DSGYEVHHQK-Biotin SEQ ID NO: 33 pEG7 Pyr EFRH
SGYEVHHQK-Biotin SEQ ID NO: 34 pEG8 Pyr EFRHD
GYEVHHQK-Biotin SEQ ID NO: 35 pEF10 Pyr EFRHDSG
EVHHQK-Biotin SEQ ID NO: 36 Aβ = amyloid-beta; The amino acids mutated to glycine are highlighted and bolded and underlined
[0098] The ability of AC-264713 to bind to the peptides was assessed by direct binding ELISA. Loss in binding indicates that the residue is required by AC-264713 to bind Aβ.sub.pE3-42 fibrils. Recombinant human Aβ biotinylated peptides were diluted in distilled water. Aβ peptides were diluted to a working concentration of 2 μg/mL, and 50 μL per well (100 ng/well) was added to 96-well half area high-binding ELISA plates. The plates were incubated overnight at 4° C. shaking at 100 rpm. Following coating, the plates were washed four times with 190 μL/well of 1×PBS using an automated plate washer. The plates were blocked with 190 μL/well of 2% BSA in DPBS and incubated for 1 hr. at RT. Reagents for ELISA were diluted in 0.25% BSA in DPBS.
[0099] Dilutions for AC-264713 were prepared in dilution plates from stock solutions to a working 1× initial concentration of either 67 or 100 nM, and an 8-point 5× dilution series for mAb was performed. After incubation for blocking, plates were washed four times with 190 μL/well of 1×PBS using automated plate washer. Anti-human IgG-HRP at a 1:10,000 dilution was prepared for AC-264713 detection and 50 μL was added to each well. The plates were incubated for 30 min at RT. After four washes with PBS, 50 μL of TMB substrate was added into each well, and the plates were incubated at RT for about 5-10 min until color developed. The reaction was stopped by adding 50 μL per well of 2N sulfuric acid. Plates were read on a ClarioStar plate reader to obtain the absorbance at 450 nm (OD.sub.450). Binding (EC.sub.50) of AC-264713 to Aβ proteins was calculated using nonlinear regression (4-parameter dose-response curve model: Y=Bottom+(TopBottom)/(1+10{circumflex over ( )}((Log IC50−X)*Hillslope))) in GraphPad Prism 8.4.3. Three independent experiments were performed.
[0100] The results are summarized in the table below.
TABLE-US-00017 Epitope Finder ELISA EC.sub.50 Values - Glycine Positional Mutated Aβ Peptide Binding EC.sub.50 Values for AC-264713 EC.sub.50 (nM) Peptide (SEQ ID NO:) (average ± SD) pE3-16 (SEQ ID NO: 27) 0.3 ± 0.1 4-16 (SEQ ID NO: 28) NB 5-16 (SEQ ID NO: 29) NB E3-16 (SEQ ID NO: 30) 0.9 ± 0.1 pEG4 (SEQ ID NO: 31) NB mpE3-16 (SEQ ID NO: 32) NB pEG6 (SEQ ID NO: 33) 0.5 ± 0.1 pEG7 (SEQ ID NO: 34) 0.4 ± 0.1 pEG8 Pyr (SEQ ID NO: 35) 0.4 ± 0.03 pEF10 (SEQ ID NO: 36) 0.5 ± 0.1
[0101] Binding analysis of AC-264713 to glycine mutant peptides indicates the residues pyro 3, 4 and 5 are important for binding. Interestingly, AC-264713 binds to E3-16 but with 3-fold reduced binding potency as compared to pE3-16, which could be due to spontaneous conversion of glutamate to pyroglutamate in the recombinant Aβ peptide preparation.
Example 3 Binding of AC-264713 to Amyloid Plaques in AD Brain Tissue
[0102] Unfixed, 20 μm tissue sections were prepared from cerebral cortex of human cadaver AD brain using a cryostat and were thaw-mounted onto glass slides. The tissue sections were then incubated in Tris-buffered saline (TBS) containing 0.3% H.sub.2O.sub.2 for 10 minutes. After three washes with TBS, the sections were incubated in TBS containing 3% milk for 30 minutes. Then biotinylated AC-264713 was added to the samples and incubated at 4° C. overnight. After three washes with TBS, the immunoreactivity was visualized by incubation in 1:400 ABC Elite for one hour followed by DAB for five minutes.
[0103] The images were acquired from all the samples using a slide scanner. The IR of biotinylated AC-264713 in the AD samples (n=6) were quantified using the Area Quantification module in HALO™ image analysis software v3.1.1076.423. Using the software, the gray matter was outlined, and the “threshold” was determined by an observer who was blind to the staining conditions. The threshold was set so that the DAB signal was recognized by the software and the background/non-specific staining was excluded from the analysis. Once an appropriate threshold was set, the software measured the percentage of the area of interest containing the positive signal.
[0104] A nonlinear regression analysis was carried out using Prism Version 9.1.0 (Graph Pad Software). A variable slope model, % area covered by IR=Bottom+(X.sup.HillSlope)*(Top−Bottom)/(X.sup.HillSlope+EC.sub.50.sup.HillSlope), was used, where Bottom was fixed to zero, and Top was fixed to 10% as the typical total area covered by plaques. Data for all six donors were analyzed in a combined data fit.
[0105] In AD brain tissue (n=6), AC-264713 binds the plaques in a concentration-dependent manner in the range of 0.5-100 μg/mL (
[0106]
Example 4 Stimulated Amyloid Plaque Removal from Unfixed APPPS1-21 Brain Tissue by hiPSC-derived Phagocytes
Assay Protocol
[0107] Unfixed, 20 m coronal brain tissue sections were prepared from 21 months old APPPS1-21 mice on a cryostat and were thaw-mounted onto 12 mm poly-D-lysine-coated glass coverslips. Dried tissue sections were washed briefly with PBS and incubated overnight with 0, or with dose a, dose b or dose c (wherein 0 μg/ml<dose a<dose b<dose c) of AC-264713 in PBS at 4° C. Immediately before addition of human induced pluripotent stem cell (hiPSC)-derived phagocytes, tissue sections were washed three times with PBS.
[0108] hiPSC-derived phagocytes were generated as described previously (van Wilgenburg, Browne et al. 2013, Haenseler, Sansom et al. 2017). Briefly, dissociated hiPSCs were aggregated into hematopoietic embryoid bodies (EBs) in EB differentiation medium [mTeSR-1 supplemented with Revitacell, 50 ng/ml human VEGF, 50 ng/ml human BMP-4 (Peprotech), and 20 ng/ml SCF (R&D Systems)]. EBs were maintained in T75 culture flasks containing EB maintenancemedium [X-VIVO 15 supplemented with 100 U/ml penicillin, 100 μg/ml streptomycin (Thermo-Fisher), 2 mM Glutamax, 55 μM 2-mercaptoethanol, 100 ng/mL recombinant human M-CSF, and 25 ng/mL recombinant human IL-3]. Phagocyte suspensions were harvested from EB flasks and cultured directly onto antibody-treated APPPS1-21 tissue sections at a density of 0.4×10.sup.6 cells/0.5 ml for 72 hours at 37° C./5% Co.sub.2 in phagocyte culture medium [Advanced DMEM/F12 supplemented with 100 U/ml penicillin/100 μg/ml streptomycin (Thermo-Fisher), 2 mM Glutamax, 55 μM 2-mercaptoethanol, N-2 supplement (Thermo-Fisher), and 100 ng/ml recombinant human M-CSF].
[0109] Following co-culture with iPSC-derived phagocytes, tissue sections were fixed in 4% paraformaldehyde and fibrillar plaques were labelled with 0.025% thioflavin S. Fluorescent images were acquired using a slide scanner and analyzed using HALO Image Analysis Software v3.1.1076.423. For measurement of fibrillar plaque area, fluorescent images from control-treated tissue sections were thresholded to highlight dense plaques, and subsequent tissue sections were thresholded with identical parameters. Data are reported as the measured area occupied by dense plaques (thresholded area) expressed as a percentage of total tissue area per section.
[0110] Statistical analysis was carried out using Prism Version 8.4.3 (Graph Pad Software). Dense plaque area measurements were analyzed by one-way ANOVA followed by a Dunnett's multiple comparisons test, comparing the means of each AC-264713 treatment group (dose a, dose b, and dose c) to the mean of the control group (0 μg/ml). n=6 tissue sections per group. As shown in
Example 5 In Vivo AC-264713 Exposure and Target Binding (PK/TB) in APPPS1-21 Mice
[0111] An antibody exposure and target binding in vivo study in APPPS1-21 animals was conducted to determine the brain and serum distribution as well as the in vivo plaque binding potential following AC-264713 administration.
Animals
[0112] 8.5 to 12.5 months old APPPS1-21 (B6.Cg-Tg(Thy1-APPSw,Thy1-PSEN1*L166P)21Jckr)) (Radde, Bolmont et al. 2006) were used for the PK/TB study. The original breeder mice were obtained by the lab of Mathias Jucker under license agreement with Fa. Koesler (Germany). Mice were bred at Charles River Laboratories (Sulzfeld, Germany) and delivered to the vivarium at AbbVie Deutschland GmbH and aged for the execution of the experiments. Animal health and comfort were veterinary-controlled. Mice were in temperature- and humidity-controlled rooms with a 12:12 hour dark/light cycle with ad libitum access to water and food.
In Vivo Methods
[0113] For this study AC-264713 as well as comparator antibody Ab1 were tested in a range of doses 1 to 4, and dosed intravenously via the tail vein. Three female animals were used for each dose. The investigated timepoint was 72 hours p.a. At study termination, blood was drawn at 72 h by cardiac puncture, and serum isolated. The animals were subsequently perfused with cold PBS with 1000 U/L Heparin for 10 min, and the brain dissected, cut in half mid-sagittally, and the right brain hemisphere prepared for immunohistochemistry. The left cortex, the rest of the forebrain and the cerebellum were isolated, flash frozen separately in liquid nitrogen and the left cortex used for quantification of AC-264713 with ELISA.
Tissue Processing, Immunohistochemistry and Analysis of Target Binding
[0114] The right hemispheres, employed for immunohistochemistry, were drop-fixed in 10% formalin for 24 hours and then switched to 70% ethanol. Tissue was trimmed and samples dehydrated using a standard ethanol series, followed by xylene and paraffin embedding (ASP300, Leica). Brain hemispheres were randomized based on test article and dose, and paraffin blocks, containing 4 randomized hemispheres, were generated. 4 μm paraffin sections were prepared and processed on an automated stainer, using citrate-buffer-based heat-induced antigen retrieval solution and 3,3′-Diaminobenzidine (DAB)-based detection. For detection of the in vivo-dosed AC-264713 and comparator antibody Ab1, a biotinylated donkey anti-human F(ab′).sub.2 fragment detecting human IgG (H+L) (Jackson Immuno) was used at a concentration of at 3.7 μg/mL. The Aβ.sub.pE3 target area was determined by applying AC-264713 at 0.35 μg/mL or comparator antibody Ab1 at a concentration of 0.26 μg/mL for immunostaining.
[0115] Images were collected with a P1000 scanner. To quantify the binding to Aβ.sub.pE3 for each molecule, the area occupied by AC-264713 or comparator antibody Ab1 was normalized by defining a total target area of Aβ.sub.pE3 based on AC-264713 or comparator antibody Ab1 IR, respectively, in the plaques from an adjacent section. For that, three matched sections per brain were analyzed using the Area Quantification module in HALO™ image analysis software. For each section, the cortex was outlined. Using the software, the “threshold” was determined by an observer who was blind to the treatment of the animals. The threshold was set so that the positive brown DAB stain of the hIgG or AC-264713 or comparator antibody Ab1 immunoreactivity was recognized by the software and the background/non-specific staining was excluded from the analysis. Once an appropriate threshold was set, the software measured the percentage of the area of interest (cortex) containing the positive immunoreactivity for hIgG or AC-264713 or comparator antibody Ab1. The hIgG IR area in the cortex was then normalized to the AC-264713 IR or Ab1 IR and the values plotted and analyzed in GraphPadPrism (version 8, GraphPad Software). Data was expressed as mean±SEM and analyzed by 1-way ANOVA followed by Kruskal-Wallis multiple comparison test).
Evaluation of AC-264713 Levels in the Serum and the Brain
[0116] Serum and brain samples were analyzed for AC-264713 and comparator antibody Ab1 using an electrochemiluminescence immunoassay detecting human IgG1. Briefly, serum was diluted with PBS or PBS containing the appropriate concentration of sample matrix to achieve a final concentration of 1% serum in all samples. The dilution factor was chosen according to expected analyte levels. Samples were measured in three dilutions from which at least two dilutions were in the accepted measurement range. The diluted samples were loaded on a streptavidin plate pre-coated with biotinylated antibody ab99757 (0.5 μg/mL) capturing human IgG1. Plates were incubated for 1 hour, washed with TTBS (Tris Tween Buffered Saline), and human IgG1 was detected with sulfo-tagged EB89 antibody (1 μg/mL)).
[0117] For the analysis of brain samples, general assay procedures remained the same. Before the experiment, brain tissue was homogenized 1:5 in homogenization buffer (50 mM Tris (pH 7.5), 150 mM NaCl, 1 mM NaF, 1 mM Na.sub.2VO.sub.4, 1 mM EDTA (pH 7.5), 0.25% Na Deoxycholate, 1% NP-40 and 1× protease inhibitor tablet). For the analysis, dilution factors were adjusted appropriately, and were 1:40 for CSF samples, and 1:4 for brain homogenate.
[0118] AC-264713 or Ab1 was used for the construction of the respective standard curves and control samples which included the same concentration of biological matrix as the test samples. For the analysis of serum samples, the standard curve was based on seven standard points covering a concentration range from 31 to 7500 ng/mL. For CSF and brain, eleven standard points were used to generate the standard curve covering a concentration range from 0.023 to 1330 ng/mL. The LLOQ for serum was 31 ng/mL, and for brain 0.152 ng/g, respectively for both analytes.
Data Analysis for In Vivo Potency for Target Binding
[0119] A nonlinear regression analysis of normalized IR signal as a function of Cortex antibody concentrations was carried out using Prism Version 9.1.0 (Graph Pad Software). A variable slope model, % area covered by immunoreactivity [norm.]=Bottom+X*(Top−Bottom)/(X+EC50), was used, where Top was fixed to 100%.
[0120] Image analysis of the hIgG stained sections revealed a dose dependent increase and localization to plaques of the test article AC-264713 and comparator antibody Ab1 in the cortex. Analysis of Aβ.sub.pE3 immunoreactive plaques and normalization of hIgG IR to Ab1 IR or AC-264713 IR in the cortex also showed a dose dependent increase in plaque coverage of AC-264713 as well as comparator antibody Ab1 (
[0121] All concentrations measured were within the limit of quantification. The concentration increased dose-dependently in both cortex and serum at all doses tested and averaged concentrations of AC-264713 ranged between 0.0016 to 0.29 μg/g in cortex and 4.5 to 352 μg/mL in serum. The tissue to serum ratio (T/S) was between 0.03% and 0.08%.
[0122] Correlating observed individual animal brain concentrations and target binding as quantified by IR (
Example 6 Evaluation of AC-264713 in an Acute Microhemorrhage Model Using APPPS1-21 Mice
[0123] An in vivo study was conducted to determine whether an AC-264713 mouse precursor antibody induces microhemorrhages in an acute microhemorrhage model using APPPS1-21 mice.
Animals
[0124] 15-17 months old APPPS1-21 mice were used in the microhemorrhage study. Mice were breed at Charles River Laboratories (Wilmington, USA) and delivered to the vivarium at the AbbVie Bioresearch Center and aged and transferred to the Cambridge Research Center (CRC) vivarium for the execution of the experiments. Mice were in temperature- and humidity-controlled rooms with a 12:12 hour dark/light cycle with ad libitum access to water and food. Animals in the CRC vivarium were group housed in individually ventilated cages with 12 h:12 h light-dark cycle and ad lib access to food and water. Mice were allowed to acclimate for at least 72 hours before dosing.
In Vivo Methods
[0125] The microhemorrhage study was performed in model described previously (Janssens, Hermans et al. 2021) with some modifications. At the age of 15 months, Aβ.sub.pE3 is detectable in the cerebral vasculature but is not as abundant as some other N-terminal Aβ species in APPPS1-21 mice. Mice (n=4, mixed gender) were given a single dose of AC-233661, or via intraperitoneal injection. A mouse IgG was used as negative control (n=4, mixed gender) and a comparator antibody Ab2 with mu IgG2a/k that caused ARIA in patients with AD was used as positive control (n=5). Both the negative and positive control were administered via intraperitoneal injection. Three days after injection, or as soon as severe adverse effects were observed (whichever came first), mice were euthanized with sodium pentobarbital, perfused with PBS, and the brains were quickly removed.
Histology Analysis for Microhemorrhage
[0126] The right hemispheres of the brain were then drop-fixed in 10% formalin for 24 hours and then switched to PBS containing 30% sucrose. Serial coronal sections at 50 m thickness were collected from the rostral to the caudal end of each brain hemisphere using a freezing sliding microtome.
[0127] For red blood cell quantification, every 12.sup.th section was mounted on glass slides, counterstained with hematoxylin.
[0128] The hemosiderin deposits were stained via Prussian Blue staining. Every 12.sup.th section was mounted on glass slides. Then the sections were rehydrated in PBS and permeabilized in PBS containing 0.25% Triton-X-100. After incubation in 80% ethanol containing saturated NaCl and 0.01M NaOH, the sections were incubated in 80% ethanol containing saturated NaCl, 0.01M NaOH and 0.5% Congo Red. Then the slides were washed in 80% ethanol and normal saline followed by incubation in 2% potassium ferrocyanide in 0.12 M HCl. After washing in PBS, the slides were dehydrated, cover-slipped and scanned.
[0129] Once scanned using a slide scanner, the brain sections were analyzed using the Area Quantification module in HALO™ image analysis software. Using the software, the entire sections were outlined, and the “threshold” was determined by an observer who was blind to the treatment of the animals. The threshold was set so that the red blood cells or the Prussian Blue signal was recognized by the software and the background/non-specific staining was excluded from the analysis. Once an appropriate threshold was set, the software measured the percentage of the area of interest (entire section) containing the positive signal. For each animal, the mean value from the set of serial sections with a 600 μm interval was calculated.
[0130] The comparator antibody Ab2 induced significant microhemorrhage within three days. In contrast, the mouse precursor antibody of AC-264713 treated APPPS1-21 mice remained healthy during this period, and the red blood cell and hemosiderin deposits were comparable to the negative control mIgG2a/k antibody (
Summary of Examples
[0131] AC-264713 binds to human Aβ.sub.pE3-42 fibrils with an EC.sub.50 of 0.7 nM in direct binding ELISA. AC-264713 did not cross-react with another human pyroglutamate-modified Aβ species, Aβ.sub.pE11-40. AC-264713 also did not cross-react with A01-40 from all species including human, monkey, dog, rabbit, rat, and mouse. Additionally, amino acid residues pyro, 3, 4 and 5 may be critical for AC-264713 binding to Ab.sub.pE3-42. The immunostaining on unfixed brain tissue demonstrated that AC-264713 binds to AD brains that contains amyloid plaques in a dose-dependent manner with an EC.sub.50 of 0.4 μg/ml, while it does not bind to non-AD human, rat or cynomolgus monkey brain tissue where the amyloid plaques do not present. When AC-264713 was tested in an ex vivo phagocytosis assay at concentrations a to c, it activated hiPSC-derived phagocytes to remove plaques. Three days after AC-264713 was systemically injected into APPPS1-21 mice after a single IV injection, it was detected in brain and serum with dose-dependent increase in exposure, and bound the plaques in a dose-dependent manner. In an acute microhemorrhage model using APPPS1-21 mice, AC-264713 mouse precursor antibody did not cause microhemorrhage within 3 days after a single IP injection. Taken together, the in vitro and in vivo data illustrate the proposed mode of action of AC-264713, i.e., an anti Aβ.sub.pE3 monoclonal antibody with full effector function that can bind the amyloid plaques in the brain after peripheral administration and activate microglial phagocytosis. The foregoing indicates the suitability of AC-264713 for use to treat Alzheimer's disease by removing the amyloid plaques from an AD brain.
9. EXEMPLARY EMBODIMENTS
[0132] While various specific embodiments have been illustrated and described, some are represented below. It will be appreciated that various changes can be made without departing from the spirit and scope of the inventive concept(s).
[0133] 1. An anti-human Aβ.sub.pE3 antibody which comprises (i) a variable heavy chain (vH) including 3 CDRs; and (ii) a variable light chain (vL) including 3 CDRs, wherein:
TABLE-US-00018 (SEQ ID NO: 1) vH CDR1 is GFSLSTSGMGVS; (SEQ ID NO: 2) vH CDR2 is HIYWDDDKRYNPYMKR; (SEQ ID NO: 3) vH CDR3 is RADDYDVGFAY; (SEQ ID NO: 4) vL CDR1 is LASQTIGTWLA; (SEQ ID NO: 5) vL CDR2 is AATSLAD; and (SEQ ID NO: 6) vL CDR3 is QQLYSSPFT.
[0134] 2. The anti-human Aβ.sub.pE3 antibody of embodiment 1, wherein the antibody comprises a heavy chain variable region including the amino acid sequence set forth as SEQ ID NO:7 and a light chain variable region including the amino acid sequence set forth as SEQ ID NO:8.
[0135] 3. The anti-human Aβ.sub.pE3 antibody of embodiment 1, wherein the antibody comprises a heavy chain including the amino acid sequence set forth as SEQ ID NO:9 and a light chain including the amino acid sequence set forth as SEQ ID NO:10.
[0136] 4. The anti-human Aβ.sub.pE3 antibody of embodiment 1, wherein the antibody comprises an IgG constant region.
[0137] 5. The anti-human Aβ.sub.pE3 antibody of embodiment 4, wherein the antibody comprises a human heavy chain constant region including an Fc portion, wherein the Fc portion is a human IgG1, IgG2, IgG3, IgG4, or IgM isotype.
[0138] 6. The anti-human Aβ.sub.pE3 antibody of embodiment 5, wherein the antibody comprises a kappa light chain constant region.
[0139] 7. A composition including the anti-human Aβ.sub.pE3 antibody of embodiment 1.
[0140] 8. A method for treating a neurodegenerative disorder including administering the anti-human Aβ.sub.pE3 antibody of embodiment 1 to a patient in need thereof.
[0141] 9. The method of embodiment 8, wherein the neurodegenerative disorder is Alzheimer's disease (AD).
[0142] 10. A polynucleotide including a nucleotide sequence encoding an anti-human Aβ.sub.pE3 antibody, wherein the antibody comprises (i) a vH chain including three CDRs; and (ii) a vL chain including three CDRs, wherein:
TABLE-US-00019 (SEQ ID NO: 1) vH CDR1 is GFSLSTSGMGVS; (SEQ ID NO: 2) vH CDR2 is HIYWDDDKRYNPYMKR; (SEQ ID NO: 3) vH CDR3 is RADDYDVGFAY; (SEQ ID NO: 4) vL CDR1 is LASQTIGTWLA; (SEQ ID NO: 5) vL CDR2 is AATSLAD; and (SEQ ID NO: 6) vL CDR3 is QQLYSSPFT.
[0143] 11. A vector including the polynucleotide of embodiment 10.
[0144] 12. A eukaryotic host cell transformed with the vector of embodiment 11.
[0145] 13. The eukaryotic host cell of embodiment 12, which is a mammalian host cell.
[0146] 14. A method for producing an anti-human Aβ.sub.pE3 antibody including: (a) culturing the eukaryotic host cell of embodiment 13 and (b) recovering the anti-human Aβ.sub.pE3 antibody.
[0147] 15. An anti-human Aβ.sub.pE3 antibody, wherein the antibody comprises two heavy chains, each heavy chain comprising the amino acid sequence set forth as SEQ ID NO: 37 and two light chains, each light chain comprising the amino acid sequence set forth as SEQ ID NO: 10.
[0148] One skilled in the art will readily appreciate that the present inventive concept is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. The particular embodiments described herein are intended to be representative and exemplary and are not intended as limitations on the scope of the invention. Changes therein and other uses will be apparent to those skilled in the art which are encompassed within the spirit of the invention as defined by the scope of the claims.
REFERENCES
[0149] Aisen, P. S., J. Cummings, R. Doody, L. Kramer, S. Salloway, D. J. Selkoe, J. Sims, R. A. Sperling and B. Vellas (2020). “The Future of Anti-Amyloid Trials.” J Prev Alzheimers Dis 7(3): 146-151. [0150] Greenberg, S. M., B. J. Bacskai, M. Hernandez-Guillamon, J. Pruzin, R. Sperling and S. J. van Veluw (2020). “Cerebral amyloid angiopathy and Alzheimer disease—one peptide, two pathways.” Nat Rev Neurol 16(1): 30-42. [0151] Haenseler, W., S. N. Sansom, J. Buchrieser, S. E. Newey, C. S. Moore, F. J. Nicholls, S. Chintawar, C. Schnell, J. P. Antel, N. D. Allen, M. Z. Cader, R. Wade-Martins, W. S. James and S. A. Cowley (2017). “A Highly Efficient Human Pluripotent Stem Cell Microglia Model Displays a Neuronal-Co-culture-Specific Expression Profile and Inflammatory Response.” Stem Cell Reports 8(6): 1727-1742. [0152] Janssens, J., B. Hermans, M. Vandermeeren, E. Barale-Thomas, M. Borgers, R. Willems, G. Meulders, C. Wintmolders, D. Van den Bulck, A. Bottelbergs, L. Ver Donck, P. Larsen, D. Moechars, W. Edwards, M. Mercken and B. Van Broeck (2021). “Passive immunotherapy with a novel antibody against 3pE-modified Abeta demonstrates potential for enhanced efficacy and favorable safety in combination with BACE inhibitor treatment in plaque-depositing mice.” Neurobiol Dis 154: 105365. [0153] Jawhar, S., O. Wirths and T. A. Bayer (2011). “Pyroglutamate amyloid-beta (Abeta): a hatchet man in Alzheimer disease.” J Biol Chem 286(45): 38825-38832. [0154] Kuo, Y. M., M. R. Emmerling, A. S. Woods, R. J. Cotter and A. E. Roher (1997). “Isolation, chemical characterization, and quantitation of A beta 3-pyroglutamyl peptide from neuritic plaques and vascular amyloid deposits.” Biochem Biophys Res Commun 237(1): 188-191. [0155] Penninkilampi, R., H. M. Brothers and G. D. Eslick (2017). “Safety and Efficacy of Anti-Amyloid-β Immunotherapy in Alzheimer's Disease: A Systematic Review and Meta-Analysis.” J Neuroimmune Pharmacol 12(1): 194-203. [0156] Radde, R., T. Bolmont, S. A. Kaeser, J. Coomaraswamy, D. Lindau, L. Stoltze, M. E. Calhoun, F. Jaggi, H. Wolburg, S. Gengler, C. Haass, B. Ghetti, C. Czech, C. Holscher, P. M. Mathews and M. Jucker (2006). “Abeta42-driven cerebral amyloidosis in transgenic mice reveals early and robust pathology.” EMBO Rep 7(9): 940-946. [0157] Selkoe, D. J. and J. Hardy (2016). “The amyloid hypothesis of Alzheimer's disease at 25 years.” EMBO Mol Med 8(6): 595-608. [0158] Sperling, R. A., C. R. Jack, Jr., S. E. Black, M. P. Frosch, S. M. Greenberg, B. T. Hyman, P. Scheltens, M. C. Carrillo, W. Thies, M. M. Bednar, R. S. Black, H. R. Brashear, M. Grundman, E. R. Siemers, H. H. Feldman and R. J. Schindler (2011). “Amyloid-related imaging abnormalities in amyloid-modifying therapeutic trials: recommendations from the Alzheimer's Association Research Roundtable Workgroup.” Alzheimers Dement 7(4): 367-385. [0159] van Dyck, C. H. (2018). “Anti-Amyloid-beta Monoclonal Antibodies for Alzheimer's Disease: Pitfalls and Promise.” Biol Psychiatry 83(4): 311-319. [0160] van Dyck, C. H. (2018). “Anti-amyloid-β monoclonal antibodies for Alzheimer's disease: pitfalls and promise.” Biol Psychiatry 83(4): 311-319. [0161] van Wilgenburg, B., C. Browne, J. Vowles and S. A. Cowley (2013). “Efficient, long-term production of monocyte-derived macrophages from human pluripotent stem cells under partly-defined and fully-defined conditions.” PLoS One 8(8): e71098.