METHODS AND COMPOSITION FOR NEUTRALIZATION OF INFLUENZA
20170360931 · 2017-12-21
Inventors
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
International classification
Abstract
Provided herein are compositions useful for neutralization of influenza virus, and methods of use and manufacture thereof. In particular, compositions comprising antibodies that are cross-reactive with multiple influenza strains are provided, as well as methods of treatment and prevention of influenza infection therewith.
Claims
1. A binding agent comprising: (a) a polypeptide comprising a region having at least 70% sequence identity with a polypeptide encoded by one of SEQ ID NOs. 1-3 and 33; and (b) a polypeptide comprising a region having at least 70% sequence identity with a polypeptide encoded by one of SEQ ID NOs. 4-6 and 34; wherein the binding agent exhibits similar influenza epitope-binding characteristics to an antibody comprising a heavy and light chain variable regions with 100% sequence identity to those encoded by one of SEQ ID NOs: 1:4, 2:5, 3:6, or 33:34, respectively.
2. The binding agent of claim 1, wherein the polypeptide of (a) and the polypeptide of (b) comprise first and second polypeptides.
3. The binding agent of claim 2, wherein the binding agent is a monoclonal antibody or monobody.
4. The binding agent of claim 2 wherein the binding agent is an antibody fragment.
5. The binding agent of claim 1, wherein the polypeptide of (a) and the polypeptide of (b) are a single polypeptide chain.
6. The binding agent of claim 1, comprising binding affinity for an epitope displayed on two or more different virus strains.
7. The binding agent of claim 6, wherein the two or more different virus strains are influenza strains.
8. The binding agent of claim 7, wherein a first influenza strain is an H7 strain.
9. The binding agent of claim 8, wherein the first influenza strain is an H7N9 strain.
10. The binding agent of claim 8, wherein a second influenza strain is an H1 or H3 strain.
11. The binding agent of claim 10, wherein the second influenza strain is an H1N1 strain.
12. The binding agent of claim 10, wherein the second influenza strain is an H3N2 strain.
13. The binding agent of claim 1 comprising: (a) a polypeptide comprising a region having at least 70% sequence identity with a polypeptide encoded by SEQ ID NO. 1; and (b) a polypeptide comprising a region having at least 70% sequence identity with a polypeptide encoded by SEQ ID NO. 4; and wherein the binding agent exhibits similar influenza epitope-binding characteristics to an antibody comprising a heavy and light chain variable regions with 100% sequence identity to those encoded by SEQ ID NO. 1 and SEQ ID NO. 4, respectively.
14. The binding agent of claim 1 comprising: (a) a polypeptide comprising a region having at least 70% sequence identity with a polypeptide encoded by SEQ ID NO. 2; and (b) a polypeptide comprising a region having at least 70% sequence identity with a polypeptide encoded by SEQ ID NO. 5; and wherein the binding agent exhibits similar influenza epitope-binding characteristics to an antibody comprising a heavy and light chain variable regions with 100% sequence identity to those encoded by SEQ ID NO. 2 and SEQ ID NO. 5, respectively.
15. The binding agent of claim 1 comprising: (a) a polypeptide comprising a region having at least 70% sequence identity with a polypeptide encoded by SEQ ID NO. 3; and (b) a polypeptide comprising a region having at least 70% sequence identity with a polypeptide encoded by SEQ ID NO. 6; and wherein the binding agent exhibits similar influenza epitope-binding characteristics to an antibody comprising a heavy and light chain variable regions with 100% sequence identity to those encoded by SEQ ID NO. 3 and SEQ ID NO. 6, respectively.
16. The binding agent of claim 1 comprising: (a) a polypeptide comprising a region having at least 70% sequence identity with a polypeptide encoded by SEQ ID NO. 33; and (b) a polypeptide comprising a region having at least 70% sequence identity with a polypeptide encoded by SEQ ID NO. 34; and wherein the binding agent exhibits similar influenza epitope-binding characteristics to an antibody comprising a heavy and light chain variable regions with 100% sequence identity to those encoded by SEQ ID NO. 33 and SEQ ID NO. 34, respectively.
17. A polynucleotide comprising a potion with 70% or greater sequence identity with one or more of SEQ ID NOs: 1-6 and 33-34.
18. A polynucleotide or polynucleotides encoding a binding agent of one of claim 1-17.
19. A pharmaceutical preparation comprising a binding agent of one of claim 1-17.
20. A method comprising administering a therapeutic dose of the pharmaceutical preparation of claim 19 to a subject.
21. The method of claim 20, wherein the subject is human.
22. The method of claim 20, wherein the subject is infected with influenza.
23. The method of claim 22, wherein the subject is infected with at least one H7 strain of influenza.
24. The method of claim 20, wherein the subject is at risk of influenza infection.
25. The method of claim 20, wherein said binding agent is co-administered with one or more additional therapeutic agents.
26. The method of claim 25, wherein said one or more additional therapeutic agents are selected from the group consisting of antivirals, immunologic agents, antibiotics, and agents for relieving symptoms of influenza infection.
27. A method of treating or preventing an H7 influenza virus infection comprising administering to a first subject an antibody generated by vaccination of a second subject with a vaccine against an H1 and/or H3 infection.
28. The method of claim 27, wherein the antibody is a monoclonal antibody.
29. The method of claim 27, wherein the antibody is an antibody fragment.
30. The method of claim 27, wherein the antibody is produced by hybridoma, recombinant technology, and/or chemical synthesis.
31. The method of claim 27, wherein the antibody administered to the first subject is a modified version of the antibody generated by vaccination of the second subject.
32. A binding agent that neutralizes infection of an H7 strain of influenza A virus and an H1 or H3 strain of influenza and binds the same epitope as one of: (i) the heavy chain variable sequence set forth in SEQ ID NO: 7, and the light chain variable sequence set forth in SEQ ID NO: 10; or (ii) the heavy chain variable sequence set forth in SEQ ID NO: 8, and the light chain variable sequence set forth in SEQ ID NO: 11; or (iii) the heavy chain variable sequence set forth in SEQ ID NO: 9, and the light chain variable sequence set forth in SEQ ID NO: 12; or (iv) the heavy chain variable sequence set forth in SEQ ID NO: 35, and the light chain variable sequence set forth in SEQ ID NO: 36.
33. The binding agent of claim 31, wherein the binding agent has an affinity for the epitope of at least 10.sup.7 M.sup.−1.
34. A binding agent that neutralizes infection of an H7 strain of influenza A virus and an H1 or H3 strain of influenza an binds the same epitope as one of: (i) the heavy chain CDR1, CDR2 and CDR3 sequences as set forth in SEQ ID NOs: 13, 14 and 15, respectively, and the light chain CDR1, CDR2, and CDR3 sequences as set forth in SEQ ID NOs: 22, 23 and 24, respectively; or (ii) the heavy chain CDR1, CDR2 and CDR3 sequences as set forth in SEQ ID NOs: 16, 17 and 18, respectively, and the light chain CDR1, CDR2, and CDR3 sequences as set forth in SEQ ID NOs: 25, 26 and 27, respectively; or (iii) the heavy chain CDR1, CDR2 and CDR3 sequences as set forth in SEQ ID NOs: 19, 20 and 21, respectively, and the light chain CDR1, CDR2, and CDR3 sequences as set forth in SEQ ID NOs: 28, 29 and 30, respectively; or (iv) the heavy chain CDR1, CDR2 and CDR3 sequences as set forth in SEQ ID NOs: 37, 38 and 39, respectively, and the light chain CDR1, CDR2, and CDR3 sequences as set forth in SEQ ID NOs: 40, 41 and 42, respectively.
35. The binding agent of claim 34, wherein the binding agent has an affinity for the epitope of at least 10.sup.7 M.sup.−1.
36. A binding agent comprising: (a) a polypeptide comprising a region having at least 70-% sequence identity with one of SEQ ID NOs. 7-9 and 35; and (b) a polypeptide comprising a region having at least 70% sequence identity with one of SEQ ID NOs. 10-12 and 36; wherein the binding agent exhibits similar influenza epitope-binding characteristics to an antibody comprising a heavy and light chain variable regions with 100% sequence identity to those encoded by one of SEQ ID NOs: 7:10, 8:11, 9:12, or 35:36, respectively.
37. The binding agent of claim 36, comprising an HCDR1 of one or SEQ ID NOs: 13, 16, 19, or 37; an HCDR2 of one of SEQ ID NOs: 14, 17, 20, or 38; an HCDR3 of one of SEQ ID NOs: 15, 18, 21, 39; a KCDR1 of one or SEQ ID NOs: 22, 25, 28, or 40; a KCDR2 of one of SEQ ID NOs: 23, 26, 29, or 41; and a KCDR3 of one of SEQ ID NOs: 24, 27, 30, or 42.
38. The binding agent of claim 36, wherein said binding agent is not a natural antibody.
39. A binding agent comprising: an HCDR1 of SEQ ID NO: 13; an HCDR2 of SEQ ID NO: 14; an HCDR3 of SEQ ID NO: 15; a KCDR1 of SEQ ID NO: 22; a KCDR2 of SEQ ID NO: 23; and a KCDR3 of SEQ ID NO: 24.
40. A binding agent comprising: an HCDR1 of SEQ ID NO: 16; an HCDR2 of SEQ ID NO: 17; an HCDR3 of SEQ ID NO: 18; a KCDR1 of SEQ ID NO: 25; a KCDR2 of SEQ ID NO: 26; and a KCDR3 of SEQ ID NO: 27.
41. A binding agent comprising: an HCDR1 of SEQ ID NO: 19; an HCDR2 of SEQ ID NO: 20; an HCDR3 of SEQ ID NO: 21; a KCDR1 of SEQ ID NO: 28; a KCDR2 of SEQ ID NO: 29; and a KCDR3 of SEQ ID NO: 30.
42. A binding agent comprising: an HCDR1 of SEQ ID NO: 37; an HCDR2 of SEQ ID NO: 38; an HCDR3 of SEQ ID NO: 39; a KCDR1 of SEQ ID NO: 40; a KCDR2 of SEQ ID NO: 41; and a KCDR3 of SEQ ID NO: 42.
43. An antigen binding agent comprising complementarity determining regions (CDRs) of the variable region of the heavy chain comprising at least 70% sequence identity to the following amino acid sequences: an HCDR1 of SEQ ID NO: 13; an HCDR2 of SEQ ID NO: 14; an HCDR3 of SEQ ID NO: 15; and comprising CDRs of the variable region of the light chain comprising at least 70% sequence identity to the following amino acid sequences: a KCDR1 of SEQ ID NO: 22; a KCDR2 of SEQ ID NO: 23; and a KCDR3 of SEQ ID NO: 24.
44. An antigen binding agent comprising complementarity determining regions (CDRs) of the variable region of the heavy chain comprising at least 70% sequence identity to the following amino acid sequences: an HCDR1 of SEQ ID NO: 16; an HCDR2 of SEQ ID NO: 17; an HCDR3 of SEQ ID NO: 18; and comprising CDRs of the variable region of the light chain comprising at least 70% sequence identity to the following amino acid sequences: a KCDR1 of SEQ ID NO: 25; a KCDR2 of SEQ ID NO: 26; and a KCDR3 of SEQ ID NO: 27.
45. An antigen binding agent comprising complementarity determining regions (CDRs) of the variable region of the heavy chain comprising at least 70% sequence identity to the following amino acid sequences: an HCDR1 of SEQ ID NO: 18; an HCDR2 of SEQ ID NO: 19; an HCDR3 of SEQ ID NO: 20; and comprising CDRs of the variable region of the light chain comprising at least 70% sequence identity to the following amino acid sequences: a KCDR1 of SEQ ID NO: 28; a KCDR2 of SEQ ID NO: 29; and a KCDR3 of SEQ ID NO: 30.
46. An antigen binding agent comprising complementarity determining regions (CDRs) of the variable region of the heavy chain comprising at least 70% sequence identity to the following amino acid sequences: an HCDR1 of SEQ ID NO: 37; an HCDR2 of SEQ ID NO: 38; an HCDR3 of SEQ ID NO: 39; and comprising CDRs of the variable region of the light chain comprising at least 70% sequence identity to the following amino acid sequences: a KCDR1 of SEQ ID NO: 40; a KCDR2 of SEQ ID NO: 41; and a KCDR3 of SEQ ID NO: 42.
47. An antigen binding agent comprising complementarity determining regions (CDRs) having at least 70% sequence identity to the following amino acid sequences: a first CDR1 of SEQ ID NO: 13; a first CDR2 of SEQ ID NO: 14; a first CDR3 of SEQ ID NO: 15, a second CDR1 of SEQ ID NO: 22; a second CDR2 of SEQ ID NO: 23; and a second CDR3 of SEQ ID NO: 24.
48. An antigen binding agent comprising complementarity determining regions (CDRs) of having at least 70% sequence identity to the following amino acid sequences: a first CDR1 of SEQ ID NO: 16; a first CDR2 of SEQ ID NO: 17; a first CDR3 of SEQ ID NO: 18, a second CDR1 of SEQ ID NO: 25; a second CDR2 of SEQ ID NO: 26; and a second CDR3 of SEQ ID NO: 27.
49. An antigen binding agent comprising complementarity determining regions (CDRs) having at least 70% sequence identity to the following amino acid sequences: a first CDR1 of SEQ ID NO: 18; a first CDR2 of SEQ ID NO: 19; a first CDR3 of SEQ ID NO: 20, a second CDR1 of SEQ ID NO: 28; a second CDR2 of SEQ ID NO: 29; and a second CDR3 of SEQ ID NO: 30.
50. An antigen binding agent comprising complementarity determining regions (CDRs) having at least 70% sequence identity to the following amino acid sequences: a first CDR1 of SEQ ID NO: 37; a first CDR2 of SEQ ID NO: 38; a first CDR3 of SEQ ID NO: 39, a second CDR1 of SEQ ID NO: 40, a second CDR2 of SEQ ID NO: 41, and a second CDR3 of SEQ ID NO: 42.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
DEFINITIONS
[0046] As used herein, the term “subject” broadly refers to any animal, including but not limited to, human and non-human animals (e.g., dogs, cats, cows, horses, sheep, poultry, fish, crustaceans, etc.). As used herein, the term “patient” typically refers to a subject that is being treated for a disease or condition.
[0047] As used herein, the term “antibody” refers to a whole antibody molecule or a fragment thereof (e.g., fragments such as Fab, Fab′, and F(ab′).sub.2), it may be a polyclonal or monoclonal antibody, a chimeric antibody, a humanized antibody, a human antibody, etc.
[0048] A native antibody typically has a tetrameric structure. A tetramer typically comprises two identical pairs of polypeptide chains, each pair having one light chain (in certain embodiments, about 25 kDa) and one heavy chain (in certain embodiments, about 50-70 kDa). In a native antibody, a heavy chain comprises a variable region, V.sub.H, and three constant regions, C.sub.H1, C.sub.H2, and C.sub.H3. The V.sub.H domain is at the amino-terminus of the heavy chain, and the C.sub.H3 domain is at the carboxy-terminus. In a native antibody, a light chain comprises a variable region, V.sub.L, and a constant region, C.sub.L. The variable region of the light chain is at the amino-terminus of the light chain. In a native antibody, the variable regions of each light/heavy chain pair typically form the antigen binding site. The constant regions are typically responsible for effector function.
[0049] In a native antibody, the variable regions typically exhibit the same general structure in which relatively conserved framework regions (FRs) are joined by three hypervariable regions, also called complementarity determining regions (CDRs). The CDRs from the two chains of each pair typically are aligned by the framework regions, which may enable binding to a specific epitope. From N-terminus to C-terminus, both light and heavy chain variable regions typically comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The CDRs on the heavy chain are referred to as H1, H2, and H3, while the CDRs on the light chain are referred to as L1, L2, and L3. Typically, CDR3 is the greatest source of molecular diversity within the antigen-binding site. H3, for example, in certain instances, can be as short as two amino acid residues or greater than 26. The assignment of amino acids to each domain is typically in accordance with the definitions of Kabat et al. (1991) Sequences of Proteins of Immunological Interest (National Institutes of Health, Publication No. 91-3242, vols. 1-3, Bethesda, Md.); Chothia, C., and Lesk, A. M. (1987) J. Mol. Biol. 196:901-917; or Chothia, C. et al. Nature 342:878-883 (1989). In the present application, the term “CDR” refers to a CDR from either the light or heavy chain, unless otherwise specified.
[0050] As used herein, the term “heavy chain” refers to a polypeptide comprising sufficient heavy chain variable region sequence to confer antigen specificity either alone or in combination with a light chain.
[0051] As used herein, the term “light chain” refers to a polypeptide comprising sufficient light chain variable region sequence to confer antigen specificity either alone or in combination with a heavy chain.
[0052] As used herein, when an antibody or other entity “specifically recognizes” or “specifically binds” an antigen or epitope, it preferentially recognizes the antigen in a complex mixture of proteins and/or macromolecules, and binds the antiegen or epitope with affinity which is substantially higher than to other entities not displaying the antigen or epitope. In this regard, “affinity which is substantially higher” means affinity that is high enough to enable detection of an antigen or epitope which is distinguished from entities using a desired assay or measurement apparatus. Typically, it means binding affinity having a binding constant (K.sub.a) of at least 10.sup.7 M.sup.−1 (e.g., >10.sup.7 M.sup.−1, >10.sup.8 M.sup.−1, >10.sup.9 M.sup.−1, >10.sup.10 M.sup.−1, >10.sup.11 M.sup.−1, >10.sup.12 M.sup.−1, >10.sup.13 M.sup.−1, etc.). In certain such embodiments, an antibody is capable of binding different antigens so long as the different antigens comprise that particular epitope. In certain instances, for example, homologous proteins from different species may comprise the same epitope.
[0053] As used herein, the term “anti-influenza antibody” refers to an antibody which specifically recognizes an antigen and/or epitope presented by one or more strains of influenza virus. A “cross-reactive influenza antibody” refers to an antibody which specifically recognizes an antigen and/or epitope presented by more than one strain of influenza virus. For example, an “H3/H7 cross-reactive influenza antibody” or “H3/H7 cross-reactive antibody” specifically recognizes an antigen and/or epitope presented by H3 and H7 strains of influenza.
[0054] As used herein, the term “monoclonal antibody” refers to an antibody which is a member of a substantially homogeneous population of antibodies that specifically bind to the same epitope. In certain embodiments, a monoclonal antibody is secreted by a hybridoma. In certain such embodiments, a hybridoma is produced according to certain methods known to those skilled in the art. See, e.g., Kohler and Milstein (1975) Nature 256: 495-499; herein incorporated by reference in its entirety. In certain embodiments, a monoclonal antibody is produced using recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). In certain embodiments, a monoclonal antibody refers to an antibody fragment isolated from a phage display library. See, e.g., Clackson et al. (1991) Nature 352: 624-628; and Marks et al. (1991) J. Mol. Biol. 222: 581-597; herein incorporated by reference in their entireties. The modifying word “monoclonal” indicates properties of antibodies obtained from a substantially-homogeneous population of antibodies, and does not limit a method of producing antibodies to a specific method. For various other monoclonal antibody production techniques, see, e.g., Harlow and Lane (1988) Antibodies: A Laboratory Manual (Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.); herein incorporated by reference in its entirety.
[0055] As used herein, the term “antibody fragment” refers to a portion of a full-length antibody, including at least a portion antigen binding region or a variable region. Antibody fragments include, but are not limited to, Fab, Fab′, F(ab′).sub.2, Fv, scFv, Fd, diabodies, and other antibody fragments that retain at least a portion of the variable region of an intact antibody. See, e.g., Hudson et al. (2003) Nat. Med. 9:129-134; herein incorporated by reference in its entirety. In certain embodiments, antibody fragments are produced by enzymatic or chemical cleavage of intact antibodies (e.g., papain digestion and pepsin digestion of antibody). produced by recombinant DNA techniques, or chemical polypeptide synthesis.
[0056] For example, a “Fab” fragment comprises one light chain and the C.sub.H1 and variable region of one heavy chain. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule. A “Fab′” fragment comprises one light chain and one heavy chain that comprises additional constant region, extending between the C.sub.H1 and C.sub.H2 domains. An interchain disulfide bond can be formed between two heavy chains of a Fab′ fragment to form a “F(ab′).sub.2” molecule.
[0057] An “Fv” fragment comprises the variable regions from both the heavy and light chains, but lacks the constant regions. A single-chain Fv (scFv) fragment comprises heavy and light chain variable regions connected by a flexible linker to form a single polypeptide chain with an antigen-binding region. Exemplary single chain antibodies are discussed in detail in WO 88/01649 and U.S. Pat. Nos. 4,946,778 and 5,260,203; herein incorporated by reference in their entireties. In certain instances, a single variable region (e.g., a heavy chain variable region or a light chain variable region) may have the ability to recognize and bind antigen.
[0058] Other antibody fragments will be understood by skilled artisans.
[0059] As used herein, the term “chimeric antibody” refers to an antibody made up of components from at least two different sources. In certain embodiments, a chimeric antibody comprises a portion of an antibody derived from a first species fused to another molecule, e.g., a portion of an antibody derived from a second species. In certain such embodiments, a chimeric antibody comprises a portion of an antibody derived from a non-human animal fused to a portion of an antibody derived from a human. In certain such embodiments, a chimeric antibody comprises all or a portion of a variable region of an antibody derived from a non-human animal fused to a constant region of an antibody derived from a human.
[0060] A “humanized” antibody refers to a non-human antibody that has been modified so that it more closely matches (in amino acid sequence) a human antibody. A humanized antibody is thus a type of chimeric antibody. In certain embodiments, amino acid residues outside of the antigen binding residues of the variable region of the non-human antibody are modified. In certain embodiments, a humanized antibody is constructed by replacing all or a portion of a complementarity determining region (CDR) of a human antibody with all or a portion of a CDR from another antibody, such as a non-human antibody, having the desired antigen binding specificity. In certain embodiments, a humanized antibody comprises variable regions in which all or substantially all of the CDRs correspond to CDRs of a non-human antibody and all or substantially all of the framework regions (FRs) correspond to FRs of a human antibody. In certain such embodiments, a humanized antibody further comprises a constant region (Fc) of a human antibody.
[0061] The term “human antibody” refers to a monoclonal antibody that contains human antibody sequences and does not contain antibody sequences from a non-human animal. In certain embodiments, a human antibody may contain synthetic sequences not found in native antibodies. The term is not limited by the manner in which the antibodies are made. For example, in various embodiments, a human antibody may be made in a transgenic mouse, by phage display, by human B-lymphocytes, or by recombinant methods.
[0062] As used herein, the term “natural antibody” refers to an antibody in which the heavy and light chains of the antibody have been made and paired by the immune system of a multicellular organism. For example, the antibodies produced by the antibody-producing cells isolated from a first animal immunized with an antigen are natural antibodies. Natural antibodies contain naturally-paired heavy and light chains. The term “natural human antibody” refers to an antibody in which the heavy and light chains of the antibody have been made and paired by the immune system of a human subject.
[0063] Native human light chains are typically classified as kappa and lambda light chains. Native human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. IgG has subclasses, including, but not limited to, IgG1, IgG2, IgG3, and IgG4. IgM has subclasses including, but not limited to, IgM1 and IgM2. IgA has subclasses including, but not limited to, IgA1 and IgA2. Within native human light and heavy chains, the variable and constant regions are typically joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 more amino acids. See, e.g., Fundamental Immunology (1989) Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y.); herein incorporated by reference in its entirety.
[0064] The term “neutralizing antibody” or “antibody that neutralizes” refers to an antibody that reduces at least one activity of a polypeptide comprising the epitope to which the antibody specifically binds. In certain embodiments, a neutralizing antibody reduces an activity in vitro and/or in vivo. In some embodiments, by neutralizing the polypeptide comprising the epitope, the neutralizing antibody inhibits the capacity of the organism (or virus) displaying the epitope. For example, an “influenza neutralizing antibody” reduces the capacity of one or more strains of influenza to infect a subject.
[0065] The term “antigen-binding site” refers to a portion of an antibody capable of specifically binding an antigen. In certain embodiments, an antigen-binding site is provided by one or more antibody variable regions.
[0066] The term “epitope” refers to any polypeptide determinant capable of specifically binding to an immunoglobulin or a T-cell receptor. In certain embodiments, an epitope is a region of an antigen that is specifically bound by an antibody. In certain embodiments, an epitope may include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl groups. In certain embodiments, an epitope may have specific three dimensional structural characteristics (e.g., a “conformational” epitope) and/or specific charge characteristics.
[0067] An epitope is defined as “the same” as another epitope if a particular antibody specifically binds to both epitopes. In certain embodiments, polypeptides having different primary amino acid sequences may comprise epitopes that are the same. In certain embodiments, epitopes that are the same may have different primary amino acid sequences. Different antibodies are said to bind to the same epitope if they compete for specific binding to that epitope.
[0068] As used herein, the term “artificial” refers to compositions and systems that are designed or prepared by man, and are not naturally occurring. For example, an artificial polypeptide (e.g., antibody or antibody fragment) or nucleic acid is one comprising a non-natural sequence (e.g., a polypeptide without 100% identity with a naturally-occurring protein or a fragment thereof).
[0069] The term “amino acid” refers to natural amino acids, unnatural amino acids, and amino acid analogs, all in their D and L stereoisomers, unless otherwise indicated, if their structures allow such stereoisomeric forms.
[0070] Natural amino acids include alanine (Ala or A), arginine (Arg or R), asparagine (Asn or N), aspartic acid (Asp or D), cysteine (Cys or C), glutamine (Gln or Q), glutamic acid (Glu or E), glycine (Gly or G), histidine (His or H), isoleucine (Ile or I), leucine (Leu or L), Lysine (Lys or K), methionine (Met or M), phenylalanine (Phe or F), proline (Pro or P), serine (Ser or S), threonine (Thr or T), tryptophan (Trp or W), tyrosine (Tyr or Y) and valine (Val or V).
[0071] Unnatural amino acids include, but are not limited to, azetidinecarboxylic acid, 2-aminoadipic acid, 3-aminoadipic acid, beta-alanine, naphthylalanine (“naph”), aminopropionic acid, 2-aminobutyric acid, 4-aminobutyric acid, 6-aminocaproic acid, 2-aminoheptanoic acid, 2-aminoisobutyric acid, 3-aminoisbutyric acid, 2-aminopimelic acid, tertiary-butylglycine (“tBuG”), 2,4-diaminoisobutyric acid, desmosine, 2,2′-diaminopimelic acid, 2,3-diaminopropionic acid, N-ethylglycine, N-ethylasparagine, homoproline (“hPro” or “homoP”), hydroxylysine, allo-hydroxylysine, 3-hydroxyproline (“3Hyp”), 4-hydroxyproline (“4Hyp”), isodesmosine, allo-isoleucine, N-methylalanine (“MeAla” or “Nime”), N-alkylglycine (“NAG”) including N-methylglycine, N-methylisoleucine, N-alkylpentylglycine (“NAPG”) including N-methylpentylglycine. N-methylvaline, naphthylalanine, norvaline (“Norval”), norleucine (“Norleu”), octylglycine (“OctG”), ornithine (“Orn”), pentylglycine (“pG” or “PGly”), pipecolic acid, thioproline (“ThioP” or “tPro”), homoLysine (“hLys”), and homoArginine (“hArg”).
[0072] The term “amino acid analog” refers to a natural or unnatural amino acid where one or to more of the C-terminal carboxy group, the N-terminal amino group and side-chain functional group has been chemically blocked, reversibly or irreversibly, or otherwise modified to another functional group. For example, aspartic acid-(beta-methyl ester) is an amino acid analog of aspartic acid; N-ethylglycine is an amino acid analog of glycine; or alanine carboxamide is an amino acid analog of alanine. Other amino acid analogs include methionine sulfoxide, methionine sulfone, S-(carboxymethyl)-cysteine, S-(carboxymethyl)-cysteine sulfoxide and S-(carboxymethyl)-cysteine sulfone.
[0073] As used herein, the term “artificial polypeptide”, “artificial antibody”, or “artificial binding agent”, consistent with the definition of “artificial” above, refers to a polypeptide, antibody, or binding agent having a distinct amino acid sequence or chemical makeup from those found in natural polypeptides, antibodies, and binding agents. An artificial polypeptide or antibody is not a subsequence of a naturally occurring protein, either the wild-type (i.e., most abundant) or mutant versions thereof. An “artificial polypeptide”, “artificial antibody”, or “artificial binding agent”, as used herein, may be produced or synthesized by any suitable method (e.g., recombinant expression, chemical synthesis, enzymatic synthesis, purification from whole animal, etc.).
[0074] As used herein, a “conservative” amino acid substitution refers to the substitution of an amino acid in a peptide or polypeptide with another amino acid having similar chemical properties, such as size or charge. For purposes of the present disclosure, each of the following eight groups contains amino acids that are conservative substitutions for one another: [0075] 1) Alanine (A) and Glycine (G); [0076] 2) Aspartic acid (D) and Glutamic acid (E); [0077] 3) Asparagine (N) and Glutamine (Q); [0078] 4) Arginine (R) and Lysine (K); [0079] 5) Isoleucine (I), Leucine (L), Methionine (M), and Valine (V); [0080] 6) Phenylalanine (F), Tyrosine (Y), and Tryptophan (W); [0081] 7) Serine (S) and Threonine (T); and [0082] 8) Cysteine (C) and Methionine (M).
[0083] Naturally occurring residues may be divided into classes based on common side chain properties, for example: polar positive (histidine (H), lysine (K), and arginine (R)); polar negative (aspartic acid (D), glutamic acid (E)); polar neutral (serine (S), threonine (T), asparagine (N), glutamine (Q)); non-polar aliphatic (alanine (A), valine (V), leucine (L), isoleucine (I), methionine (M)); non-polar aromatic (phenylalanine (F), tyrosine (Y), tryptophan (W)); proline and glycine; and cysteine. As used herein, a “semi-conservative” amino acid substitution refers to the substitution of an amino acid in a peptide or polypeptide with another amino acid within the same class.
[0084] In some embodiments, unless otherwise specified, a conservative or semi-conservative amino acid substitution may also encompass non-naturally occurring amino acid residues that have similar chemical properties to the natural residue. These non-natural residues are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include, but are not limited to, peptidomimetics (e.g., chemically modified peptides, peptoids (side chains are appended to the nitrogen atom of the peptide backbone, rather than to the α-carbons), β-peptides (amino group bonded to the β carbon rather than the α carbon), etc.) and other reversed or inverted forms of amino acid moieties. Embodiments herein may, in some embodiments, be limited to natural amino acids, non-natural amino acids, and/or amino acid analogs.
[0085] Non-conservative substitutions may involve the exchange of a member of one class for a member from another class.
[0086] As used herein, the term “sequence identity” refers to the degree to which two polymer sequences (e.g., peptide, polypeptide, nucleic acid, etc.) have the same sequential composition of monomer subunits. The term “sequence similarity” refers to the degree with which two polymer sequences (e.g., peptide, polypeptide, nucleic acid, etc.) have similar polymer sequences. For example, similar amino acids are those that share the same biophysical characteristics and can be grouped into the families (see above). The “percent sequence identity” (or “percent sequence similarity”) is calculated by: (1) comparing two optimally aligned sequences over a window of comparison (e.g., the length of the longer sequence, the length of the shorter sequence, a specified window, etc.), (2) determining the number of positions containing identical (or similar) monomers (e.g., same amino acids occurs in both sequences, similar amino acid occurs in both sequences) to yield the number of matched positions, (3) dividing the number of matched positions by the total number of positions in the comparison window (e.g., the length of the longer sequence, the length of the shorter sequence, a specified window), and (4) multiplying the result by 100 to yield the percent sequence identity or percent sequence similarity. For example, if peptides A and B are both 20 amino acids in length and have identical amino acids at all but 1 position, then peptide A and peptide B have 95% sequence identity. If the amino acids at the non-identical position shared the same biophysical characteristics (e.g., both were acidic), then peptide A and peptide B would have 100% sequence similarity. As another example, if peptide C is 20 amino acids in length and peptide D is 15 amino acids in length, and 14 out of 15 amino acids in peptide D are identical to those of a portion of peptide C, then peptides C and D have 70% sequence identity, but peptide D has 93.3% sequence identity to an optimal comparison window of peptide C. For the purpose of calculating “percent sequence identity” (or “percent sequence similarity”) herein, any gaps in aligned sequences are treated as mismatches at that position.
[0087] Any polypeptides described herein as having a particular percent sequence identity or similarity (e.g., at least 70%) with a reference sequence ID number, may also be expressed as having a maximum number of substitutions (or terminal deletions) with respect to that referene sequence. For example, a sequence “having at least 70% sequence identity with SEQ ID NO:8” may have up to 37 substitutions relative to SEQ ID NO:8, and may therefore also be expressed as “having 37 or fewer substitutions relative to SEQ ID NO:8.” Further, a sequence “having at least 90% sequence similarity with SEQ ID NO:7” may have up to 11 non-conservative substitutions relative to SEQ ID NO:7, and may therefore also be expressed as “having 11 or fewer non-conservative substitutions relative to SEQ ID NO:7.”
[0088] The term “effective dose” or “effective amount” refers to an amount of an agent, e.g., a neutralizing antibody, that results in the reduction of symptoms in a patient or results in a desired biological outcome. In certain embodiments, an effective dose or effective amount is sufficient to reduce or inhibit the infectivity of one or more strains of influenza.
[0089] As used herein, the terms “administration” and “administering” refer to the act of giving a drug, prodrug, or other agent, or therapeutic to a subject or in vivo, in vitro, or ex vivo cells, tissues, and organs. Exemplary routes of administration to the human body can be through space under the arachnoid membrane of the brain or spinal cord (intrathecal), the eyes (ophthalmic), mouth (oral), skin (topical or transdermal), nose (nasal), lungs (inhalant), oral mucosa (buccal), ear, rectal, vaginal, by injection (e.g., intravenously, subcutaneously, intratumorally, intraperitoneally, etc.) and the like.
[0090] The term “treatment” encompasses both therapeutic and prophylactic/preventative measures unless otherwise indicated. Those in need of treatment include, but are not limited to, individuals already having a particular condition (e.g., influenza infecgtion) as well as individuals who are at risk of acquiring a particular condition or disorder (e.g., those needing prophylactic/preventative measures, those at risk of influenza exposure, those at risk of having particularly bad outcomes from influenza infection, etc.). The term “treating” refers to administering an agent to a subject for therapeutic and/or prophylactic/preventative purposes.
[0091] A “therapeutic agent” refers to an agent that may be administered in vivo to bring about a therapeutic and/or prophylactic/preventative effect.
[0092] A “therapeutic antibody” refers to an antibody that may be administered in vivo to bring about a therapeutic and/or prophylactic/preventative effect.
[0093] As used herein, the terms “co-administration” and “co-administering” refer to the administration of at least two agent(s) or therapies to a subject. In some embodiments, the co-administration of two or more agents or therapies is concurrent. In other embodiments, a first agent/therapy is administered prior to a second agent/therapy. Those of skill in the art understand that the formulations and/or routes of administration of the various agents or therapies used may vary. The appropriate dosage for co-administration can be readily determined by one skilled in the art. In some embodiments, when agents or therapies are co-administered, the respective agents or therapies are administered at lower dosages than appropriate for their administration alone. Thus, co-administration is especially desirable in embodiments where the co-administration of the agents or therapies lowers the requisite dosage of a potentially harmful (e.g., toxic) agent(s), and/or when co-administration of two or more agents results in sensitization of a subject to beneficial effects of one of the agents via co-administration of the other agent.
[0094] As used herein, the term pharmaceutical composition” refers to the combination of an active agent (e.g., binding agent) with a carrier, inert or active, making the composition especially suitable for diagnostic or therapeutic use in vitro, in vivo or ex vivo.
[0095] The terms “pharmaceutically acceptable” or “pharmacologically acceptable,” as used herein, refer to compositions that do not substantially produce adverse reactions, e.g., toxic, allergic, or immunological reactions, when administered to a subject.
[0096] As used herein, the term “pharmaceutically acceptable carrier” refers to any of the standard pharmaceutical carriers including, but not limited to, phosphate buffered saline solution, water, emulsions (e.g., such as an oil/water or water/oil emulsions), and various types of wetting agents, any and all solvents, dispersion media, coatings, sodium lauryl sulfate, isotonic and absorption delaying agents, disintigrants (e.g., potato starch or sodium starch glycolate), and the like. The compositions also can include stabilizers and preservatives. For examples of carriers, stabilizers and adjuvants, see, e.g., Martin, Remington's Pharmaceutical Sciences, 15th Ed., Mack Publ. Co., Easton, Pa. (1975), incorporated herein by reference in its entirety.
DETAILED DESCRIPTION
[0097] Provided herein are compositions useful for neutralization of influenza virus, and methods of use and manufacture thereof. In particular, compositions comprising antibodies that are cross-reactive with multiple influenza strains (e.g., H7/H1, H7/H3, etc.) are provided, as well as methods of treatment and prevention of influenza infection therewith. Some embodiments described herein relate to antibodies, and antigen binding fragments thereof, that specifically bind to epitopes in an H7 strain of influenza. Embodiments also relate to nucleic acids that encode, immortalized B cells and cultured single plasma cells that produce, and to epitopes that bind, to such antibodies and antibody fragments. In addition, described herein is the use of the antibodies, antibody fragments, and epitopes in screening methods as well as in the diagnosis, treatment and prevention of influenza virus infection. In some embodiments, antibodies and antibody fragments provided herein bind in the stalk region of influenza hemagglutinin (e.g., of an influenza H7 strain and one or more of H1 and H3 strains) and neutralize the influenza virus.
[0098] With H7 strains currently posing a threat to human health, experiments were conducted during development of embodiments described herein to determine whether there is cross-protection generated from group 2 influenza virus vaccinations. Human antibodies were generated from plasmablasts of volunteers vaccinated with the seasonal influenza virus vaccine (Wrammert et al. J Exp Med. 2011; 208(1):181-93; Wrammert et al. Nature. 2008; 453(7195):667-71; herein incorporated by reference in their entireties). Because plasmablasts are activated during an ongoing immune response, this allows for the determination if prior vaccination, especially with H3N2 strains, induced cross-reactive antibodies that neutralize H7 strains. Given the lack of a vaccine against novel H7 viruses, the isolation and characterization of monoclonal antibodies with neutralizing activity can direct vaccine design and also provide a therapeutic resource.
[0099] Experiments conducted during development of embodiments described herein demonstrate that at the monoclonal antibody level, a small subset of H3 hemagglutinin-reactive antibodies that were tested neutralized H7N9 viruses and protected mice against homologous challenge. The antibodies bind to the HA stalk domain, but differ in breadth of reactivity to influenza subtypes. Viral escape mutation mapping indicate that these antibodies bind at least two different epitopes on the stalk region. These broadly neutralizing antibodies contribute to the development of therapies against H7N9 strains and are effective against pathogenic H7 strains.
[0100] Experiments were conducted during development of embodiments described herein to utilize an antibody microarray and subsequent functional assays to identify and characterize antibodies that neutralize the emerging H7N9 influenza virus strain and protect subjects from infection. In some embodiments, provided herein are H7/H1 (e.g., H7N9/H1N1) and/or H7/H3 (e.g., H7N9/H3N2) cross-reactive antibodies (e.g., induced by vaccination with influenza A H1N1 and/or H3N2). It has been shown that broadly reactive antibodies binding to the HA stalk region are relatively rare (Corti et al. J Clin Invest. 2010; 120(5):1663-73; herein incorporated by reference in its entirety), but they were preferentially induced by exposure to the highly unique 2009 pandemic H1N1 strain (Wrammert et al. J Exp Med. 2011; 208(1):181-93; Li et al. Proc Natl Acad Sci USA. 2012; 109(23):9047-52; Thomson et al. Frontiers in immunology. 2012; 3(87); herein incorporated by reference in their entireties). It is contemplated that exposure to this pandemic strain, which has a globular head domain that is highly divergent from pre-pandemic seasonal H1N1 strains, was activating cross-reactive memory B cells reactive with conserved epitopes (e.g. in the stalk region) that the virus shared with previous seasonal strains (Kaur et al. Trends in immunology. 2011; 32(11):524-31. Wilson & Andrews. Nature reviews Immunology. 2012; 12(10):709-19; herein incorporated by reference in their entireties). Indeed, one of the H7N9 neutralizing antibodies (045-051310-2B06) identified in experiments conducted during development of embodiments described herein was induced by vaccination with this pandemic influenza strain. Two other neutralizing antibodies, and three H7 cross-reactive antibodies that bound without neutralizing activity, were primed by H3N2 seasonal strains. While it has been shown that H3N2 infection/vaccination can induce HA stalk reactive antibodies, the design of past studies could not predict the frequency at which the H3 stalk epitopes are targeted (Ekiert et al. Nature. 2012; 489(7417):526-32; Margine et al. J Virol. 2013; 87(8):4728-37; herein incorporated by reference in their entireties). Experiments were conducted during development of embodiments described herein that demonstrate the presence of group 2 cross-reactive antibodies following vaccination with seasonal H3N2 strains. Results indicate that prior immunity against the H7N9 strain and other novel strains are boosted with a vaccine eliciting cross-reactive memory B cells. Indeed, as recently demonstrated in mice, immunization with a chimeric HA protein expressing the H3 stalk domain induces broad protection against divergent H3N2 and H7 viruses infection (Margine et al. J Virol. 2013; 87(19):10435-46; Krammer et al. J Virol. 2014; 88(4):2340-3; herein incorporated by reference in their entireties).
[0101] Booster immunizations with divergent influenza strains in the general human population can lead to universal protection against most influenza strains. A better understanding of epitopes targeted by broadly neutralizing antibodies benefits the design and development of new influenza vaccines. The escape viral mutations identified in experiments conducted during development of embodiments described herein (e.g., at residue 384 (I384N for 045-051310-2B06 and I384T for S6-B01)) are located in the epitope targeted by the CR9114 antibody (VH1-69 gene segment), and the binding patterns of the antibodies (CR9114 and 045-051310-2B06; CR9114 and S6-B01) to the HA variants from escape mutants are identical. These antibodies target the same or considerably overlapping epitopes on the stalk region. The differences in the sensitivity to epitope mutations between the two neutralizing antibodies are explained by the fact that different antibodies have unique modes of binding. The approach angle of an antibody to an HA stalk region explains diversity in antibody potency (Friesen et al. Proc Natl Acad Sci USA. 2014; 111(1):445-50; herein incorporated by reference in its entirety). The antibody 042-100809-2F04 is encoded by VH3-23 (Table 1). This antibody only binds and neutralizes group 2 strains and does not bind to the 045-051310-2B06 and S6-B01 escape mutants. Furthermore, the R364K mutation is located in the epitope targeted by the CR8020 antibody (Ekiert et al. Science. 2011; 333(6044):843-50; herein incorporated by reference in its entirety). 042-100809-2F04 also has a similar binding pattern to HA variants as CR8020, indicating that both antibodies have overlapping binding sites on the HA stalk region, but target a different epitope than the group 1 and 2 broadly neutralizing antibodies.
TABLE-US-00001 TABLE 1 Repertoire of the protective antibodies. Heavy chain (V/J) Light chain (V/J) 045051310-2B06 VH1-18/JH6 VK3-11/JK5 042100809-2F04 VH3-23/JH5 VK4-1/JK4 S6-B01 VH1-18/JH6 VK3-20/JK2
[0102] The binding of the antibody S6-B01 to the escape mutant HA was not altered by the mutations occurring in the stalk region, despite viral escape and growth. This is the first demonstration of viral escape without the ablation of antibody binding. This mechanism provides a distinct selective advantage to the resulting virus, as B cell memory to this epitope are now non-protective, allowing immune evasion in an original antigenic sin fashion.
[0103] All three neutralizing viruses developed not only mutations in the stalk region, but also amino acid substitutions in the globular head domain of HA. Due to the distance between the mutations in the stalk domain and these in the globular head domain, and the fact that the mutations in the stalk domain were sufficient to strongly interfere with binding to the HA, the mutations in the globular head domain are not directly impacting the binding of 042-100809-2F04, 045-051310-2B06 and S6-B01. Elucidating the binding requirements of 042-100809-2F04 in the context of an in vitro infection, clearly demonstrates that 042-100809-2F04 is binding to the stalk domain regardless of the head mutations. Instead, the globular head mutations compensate for the loss of structural integrity caused by escape mutations in the stalk. Escape from neutralization with stalk-reactive antibodies comes with a fitness loss for the virus, which was observed in mice for all three escape mutant viruses. In addition, these head mutations cause other effects, such as enhanced avidity to cellular receptors or increased in structural stability, which facilitates escape from neutralizing antibodies (O'Donnell et al. MBio. 2012; 3(3); herein incorporated by reference in its entirety).
[0104] In an exemplary embodiment, an antibody, or an antibody fragment thereof, is provided that is specific for influenza A virus subtype H7 and H3 (e.g. H7N9 and H3N2); H7 and H1 (e.g. H7N9 and H1N1); or H7, H1, and H3 (e.g. H7N9, H1N1, and H3N2). In some embodiments, antibodies and antibody fragments are specific for any of H1, H3, H5, H7 and H9 (e.g. H1N1, H3N2, H5N1, H7N1, H7N7, H9N2, etc.). Other exemplary combinations of subtypes of influenza A virus are also provided.
[0105] In some embodiments, an antibody or antibody fragment comprises a heavy chain variable region having an amino acid sequence that is about 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical (or any ranges therein) to the sequence recited in any one of SEQ ID NOs: 7, 8, 9, or 35. In some embodiments, an antibody or antibody fragment comprises a heavy chain variable region having >50%, >60%, >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100% sequence similarity (or any ranges therein) to one of SEQ ID NOs: 7, 8, 9, or 35. In another embodiment, an antibody or antibody fragment of the invention comprises a light chain variable region having an amino acid sequence that is about 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical (or any ranges therein) to the sequence recited in SEQ ID NOs: 10, 11, 12, or 36. In some embodiments, an antibody or antibody fragment comprises a light chain variable region having >50%, >60%, >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100% sequence similarity (or any ranges therein) to one of SEQ ID NOs: 10, 11, 12, or 36.
[0106] In some embodiments, an antibody or antibody fragment comprises a heavy chain variable region having an amino acid sequence that has about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% sequence similarity (or any ranges therein) to a sequence recited in any one of SEQ ID NOs: 7, 8, 9, or 35. In some embodiments, an antibody or antibody fragment comprises a heavy chain variable region having >50%, >60%, >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100% sequence similarity (or any ranges therein) to one of SEQ ID NOs: 7, 8, 9, or 35. In another embodiment, an antibody or antibody fragment of the invention comprises a light chain variable region having an amino acid sequence that is about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% sequence similarity (or any ranges therein) to a sequence recited in SEQ ID NOs: 10, 11, 12, or 36. In some embodiments, an antibody or antibody fragment comprises a light chain variable region having >50%, >60%, >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100% sequence similarity (or any ranges therein) to one of SEQ ID NOs: 10, 11, 12, or 36.
[0107] In some embodiments, an antibody or antibody fragment exhibits all or a portion of the epitope binding affinity of one of 045-051310-2B06, S6-B01, 042-100809-2F04, or 41 5E04. In some embodiments, an antibody or antibody fragment binds the same epitope as one of 045-051310-2B06, S6-B01, 042-100809-2F04, 41 5E04. In some embodiments, an antibody or antibody fragment exhibits the influenza neutralizing activity of one of 045-051310-2B06, S6-B01, 042-100809-2F04, 41 5E04. In some embodiments, an antibody or antibody fragment neutralizes the same influenza strains as one of 045-051310-2B06, S6-B01, 042-100809-2F04, 41 5E04. In some embodiments, an antibody is not a natural antibody. In some embodiments, an antibody is not a natural human antibody.
[0108] The CDRs of the antibody heavy chains are referred to as CDRH1 (or HCDR1), CDRH2 (or HCDR2) and CDRH3 (or HCDR3), respectively. Similarly, the CDRs of the antibody light chains are referred to as CDRK1 (or KCDR1), CDRK2 (or KCDR1) and CDRK3 (or KCDR1), respectively. In some embodiments, antibodies or antibody fragments are provided with heavy chain CDRs corresponding to one of SEQ ID NOs: 13-15, 16-18, 19-21, or 37-39. In some embodiments, antibodies or antibody fragments are provided with heavy chain CDR1 corresponding to one of SEQ ID NOs: 13, 16, 19, or 37. In some embodiments, antibodies or antibody fragments are provided with heavy chain CDR2 corresponding to one of SEQ ID NOs: 14, 17, 20, 38. In some embodiments, antibodies or antibody fragments are provided with heavy chain CDR3 corresponding to one of SEQ ID NOs: 15, 18, 21, 39. In some embodiments, antibodies or antibody fragments are provided with light chain CDRs corresponding to one or SEQ ID NOs: 22-24, 25-27, 28-30, or 40-42. In some embodiments, antibodies or antibody fragments are provided with light chain CDR1 corresponding to one of SEQ ID NOs: 22, 25, 28, or 40. In some embodiments, antibodies or antibody fragments are provided with light chain CDR2 corresponding to one of SEQ ID NOs: 23, 26, 29, or 41. In some embodiments, antibodies or antibody fragments are provided with light chain CDR3 corresponding to one of SEQ ID NOs: 24, 27, 30, or 42. In some embodiments, CDRs are provided having at least 70% sequence identity (e.g., 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, 100%, and any ranges with such endpoints (e.g., 70-100%, 80-100%, 85-99%, 90-99%, etc.)) with one of SEQ ID NOs: 13-30 and 37-42. In some embodiments, CDRs are provided having at least 50% sequence similarity (e.g., 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, 100%, and any ranges with such endpoints (e.g., 50-100%, 80-100%, 85-99%, 90-99%, etc.)) with one of SEQ ID NOs: 13-30 and 37-42. In some embodiments, CDRs (or a combination thereof) are provided that recognize the same HA epitopes as 045-051310-2B06, S6-B01, 042-100809-2F04, or 41 5E04.
[0109] In certain embodiments, an antibody or antigen binding fragment comprises all of the CDRs of antibody 045-051310-2B06 (SEQ ID NOs: 16-18 and 25-27), and neutralizes influenza A virus infection (e.g., in H1N1, H3N2, H7N9, and H15N9 strains). In some embodiments, an antibody or antigen binding fragment comprises CDRs with at least 70% sequence identity (e.g., >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100%, and ranges therein) and/or at least 50% sequence similarity (e.g., >50%, >60%, >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100%, and ranges therein) with the CDRs of antibody 045-051310-2B06 (SEQ ID NOs: 16-18 and 25-27), binds the epitope(s) of antibody 045-051310-2B06, and/or neutralizes influenza A virus infection (e.g., in H1N1, H3N2, H7N9, and H15N9 strains).
[0110] In certain embodiments, an antibody or antigen binding fragment comprises all of the CDRs of antibody S6-B01 (SEQ ID NOs: 19-21 and 28-30), and neutralizes influenza A virus infection (e.g., in H5N1, H3N2, H7N9, and H15N9 strains). In some embodiments, an antibody or antigen binding fragment comprises CDRs with at least 70% sequence identity (e.g., >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100%, and ranges therein) and/or at least 50% sequence similarity (e.g., >50%, >60%, >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100%, and ranges therein) with the CDRs of antibody S6-B01 (SEQ ID NOs: 19-21 and 28-30), binds the epitope(s) of antibody S6-B01, and/or neutralizes influenza A virus infection (e.g., in H5N1, H3N2, H7N9, and H15N9 strains).
[0111] In certain embodiments, an antibody or antigen binding fragment comprises all of the CDRs of antibody 042-100809-2F04 (SEQ ID NOs: 13-15 and 22-24), and neutralizes influenza A virus infection (e.g., in H3N2, H7N9, and H15N9 strains). In some embodiments, an antibody or antigen binding fragment comprises CDRs with at least 70% sequence identity (e.g., >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100%, and ranges therein) and/or at least 50% sequence similarity (e.g., >50%, >60%, >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100%, and ranges therein) with the CDRs of antibody 042-100809-2F04 (SEQ ID NOs: 13-15 and 22-24), binds the epitope(s) of antibody 042-100809-2F04, and/or neutralizes influenza A virus infection (e.g., in H3N2, H7N9, and H15N9 strains).
[0112] In certain embodiments, an antibody or antigen binding fragment comprises all of the CDRs of antibody 41 5E04 (SEQ ID NOs: 37-39 and 40-42), and neutralizes influenza A virus infection (e.g., in H5N1, H3N2, H7N9, and H15N9 strains). In some embodiments, an antibody or antigen binding fragment comprises CDRs with at least 70% sequence identity (e.g., >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100%, and ranges therein) and/or at least 50% sequence similarity (e.g., >50%, >60%, >70%, >75%, >80%, >85%, >90%, >95%, >97%, >98%, >99% or 100%, and ranges therein) with the CDRs of antibody 41 5E04 (SEQ ID NOs: 37-39 and 40-42), binds the epitope(s) of antibody 41 5E04, and/or neutralizes influenza A virus infection (e.g., in H5N1, H3N2, H7N9, and H15N9 strains).
[0113] The invention further comprises an antibody, or fragment thereof, that binds to the same epitope as an antibody described herein (e.g., 045-051310-2B06, S6-B01, 042-100809-2F04, or 41 5E04), or an antibody that competes with an antibody or antigen binding fragment described herein.
[0114] Antibodies within the scope described herein may also include hybrid antibody molecules that comprise one or more CDRs from an antibody described herein (e.g., 045-051310-2B06, S6-B01, 042-100809-2F04, or 41 5E04) and one or more CDRs from another antibody to the same epitope. In one embodiment, such hybrid antibodies comprise three CDRs from an antibody described herein and three CDRs from another antibody to the same epitope. Exemplary hybrid antibodies comprise: (i) the three light chain CDRs from an antibody described herein and the three heavy chain CDRs from another antibody to the same epitope, or (ii) the three heavy chain CDRs from an antibody described herein and the three light chain CDRs from another antibody to the same epitope.
[0115] Variant antibodies are also included within the scope herein. Thus, variants of the sequences recited in the application are also included within the scope herein. Such variants include natural variants generated by somatic mutation in vivo during the immune response or in vitro upon culture of immortalized B cell clones. Alternatively, variants may arise due to the degeneracy of the genetic code, or may be produced due to errors in transcription or translation.
[0116] Further variants of the antibody sequences having improved affinity and/or potency may be obtained using methods known in the art and are included within the scope herein.
[0117] For example, amino acid substitutions may be used to obtain antibodies with further improved affinity. Alternatively, codon optimization of the nucleotide sequence may be used to improve the efficiency of translation in expression systems for the production of the antibody. Further, polynucleotides comprising a sequence optimized for antibody specificity or neutralizing activity by the application of a directed evolution method to any of the nucleic acid sequences here are also within the scope included herein.
[0118] In some embodiments, variant antibody sequences may share 70% or more (e.g., 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or more, or ranges therein) amino acid sequence identity with the sequences recited herein (e.g., SEQ ID NOs: 7-30 and 35-42). In some embodiments, variant antibody sequences may share 50% or more (e.g., 55%, 60%, 65%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or more, or ranges therein) amino acid sequence similarity with the sequences recited herein (e.g., SEQ ID NOs: 7-30 and 35-42).
[0119] In one embodiment, nucleic acid sequences described herein include nucleic acid sequences having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% identity to the nucleic acid encoding a heavy or light chain of an antibody described herein (e.g., SEQ ID NOs: 7-12 and 35-36). In another embodiment, a nucleic acid sequence has the sequence of a nucleic acid encoding a heavy or light chain CDR of an antibody of the invention (e.g., SEQ ID NOs: 13-30, and 37-42).
[0120] In some embodiments, provided herein are modified antibodies and/or modified antibody fragments (e.g., antibodies and antibody fragments comprising non-natural amino acids, substituents, bonds, moieties, connections, etc.). For example, modifications may comprise the introduction of disulfide bonds, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling or therapeutic agent. Modifications may also include the substitution of natural amino acids for amino acid analogs (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art.
[0121] In some embodiments, an antibody finding use in embodiments herein is a non-natural immunogenic agent, such as: an antibody fragment, a non-natural antibody comprising the CDRs herein, a modified antibody, a monoclonal antibody, a humanized antibody, a chimeric antibody, and non-natural combinations thereof.
[0122] Further included within the scope of the invention are vectors, for example, expression vectors, comprising a nucleic acid sequence described herein. Cells transformed with such vectors are also included. Examples of such cells include but are not limited to, eukaryotic cells, e.g. yeast cells, animal cells or plant cells. In one embodiment the cells are mammalian, e.g. human, CHO, HEK293T, PER.C6, NS0, myeloma or hybridoma cells.
[0123] Embodiments within the scope of this disclosure include methods of preventing or treating influenza infections comprising administering a therapeutically-effective or prophylactically effective amount of a monoclonal antibody having specificity for an epitope in an H7 influenza and one or more additional strains of influenza (e.g., H1, H2, H3, H5, and/or H9 strains). In some embodiments, an antibody recognizes (e.g., has affinity and/or specificity for) epitopes having at least 90%, at least 92%, at least 95%, at least 97%, at least 98%, or at least 99% homology to epitope(s) recognized by (e.g., has affinity and/or specificity for) the cross-reactive (e.g., H1/H7, H3/H7, etc.) antibodies described herein.
[0124] In some embodiments, a pharmaceutical composition comprising the antibodies disclosed herein includes an acceptable carrier and is formulated into a suitable dosage form according to administration modes. Pharmaceutical preparations suitable for administration modes are known, and generally include surfactants that facilitate transport across the membrane. Such surfactants may be derived from steroids, or may be cationic lipids such as N-[1-(2,3-dioleyloxy)propyl]-N,N,N-trimethylammonium chloride (DOTMA), or various compounds such as cholesterol hemisuccinate and phosphatidyl glycerol.
[0125] For oral administration, the pharmaceutical composition may be presented as discrete units, for example, capsules or tablets; powders or granules; solutions, syrups or suspensions (edible foam or whip formulations in aqueous or non-aqueous liquids); or emulsions.
[0126] For parenteral administration, the pharmaceutical composition may include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation substantially isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents. Excipients available for use in injectable solutions include, for example, water, alcohol, polyols, glycerin, and vegetable oils. Such a composition may be presented in unit-dose (single dose) or multiple dose (several doses) containers, for example, sealed ampoules and vials, and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets.
[0127] The pharmaceutical composition may include antiseptics, solubilizers, stabilizers, wetting agents, emulsifiers, sweeteners, colorants, odorants, salts, buffering agents, coating agents, or anti-oxidants.
[0128] Compositions may comprise, in addition to the antibody or antibodies described herein, a therapeutically active agent (e.g., drug), additional antibodies (e.g., against influenza or another target), etc.
[0129] The present composition may be formulated into dosage forms for use in humans or veterinary use. The composition comprising the antibodie(s) may be administered to influenza-infected or highly susceptible humans and livestock, such as cows, horses, sheep, swine, goats, camels, and antelopes, in order to prevent or treat the incidence of influenza. When a subject is already infected, the present antibodie(s) may be administered alone or in combination with another antiviral treatment.
[0130] The antibody composition may be administered in a pharmaceutically effective amount in a single- or multiple-dose. The pharmaceutical composition may be administered via any of the common routes, as long as it is able to reach the desired tissue. Thus, the present composition may be administered via oral or parenteral (e.g., subcutaneous, intramuscular, intravenous, or intradermal administration) routes, and may be formulated into various dosage forms. In one embodiment, the formulation is an injectable preparation. Intravenous, subcutaneous, intradermal, intramuscular and dropping injectable preparations are possible.
[0131] Antibodies may be coupled to a drug for delivery to a treatment site or coupled to a detectable label to facilitate imaging of a site comprising cells of interest, such as cells infected with influenza A virus. Methods for coupling antibodies to drugs and detectable labels are well known in the art, as are methods for imaging using detectable labels. Labeled antibodies may be employed in a wide variety of assays, employing a wide variety of labels. Detection of the formation of an antibody-antigen complex between an antibody of the invention and an epitope of interest (an influenza A virus epitope) can be facilitated by attaching a detectable substance to the antibody. Suitable detection means include the use of labels such as radionuclides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material is luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin; and examples of suitable radioactive material include .sup.125I, .sup.131I, .sup.35S, or .sup.3H. Such labeled reagents may be used in a variety of well-known assays, such as radioimmunoassays, enzyme immunoassays, e.g., ELISA, fluorescent immunoassays, and the like.
[0132] An antibody may be conjugated to a therapeutic moiety. Such antibody conjugates can be used for modifying a given biological response; the drug moiety is not to be construed as limited to classical chemical therapeutic agents. For example, the drug moiety may be a protein or polypeptide possessing a desired biological activity. Techniques for conjugating such therapeutic moiety to antibodies are well known. See, for example, Arnon et al. (1985) “Monoclonal Antibodies for Immunotargeting of Drugs in Cancer Therapy,” in Monoclonal Antibodies and Cancer Therapy, ed. Reisfeld et al. (Alan R. Liss, Inc.), pp. 243-256; ed. Hellstrom et al. (1987) “Antibodies for Drug Delivery,” in Controlled Drug Delivery, ed. Robinson et al. (2d ed; Marcel Dekker, Inc.), pp. 623-653; Thorpe (1985) “Antibody Carriers of Cytotoxic Agents in Cancer Therapy: A Review,” in Monoclonal Antibodies '84: Biological and Clinical Applications, ed. Pinchera et al. pp. 475-506 (Editrice Kurds, Milano, Italy, 1985); “Analysis, Results, and Future Prospective of the Therapeutic Use of Radiolabeled Antibody in Cancer Therapy,” in Monoclonal Antibodies for Cancer Detection and Therapy, ed. Baldwin et al. (Academic Press, New York, 1985), pp. 303-316; and Thorpe et al. (1982) Immunol. Rev. 62:119-158; herein incorporated by reference in their entireties.
[0133] Alternatively, an antibody, or antibody fragment thereof, can be conjugated to a second antibody, or antibody fragment thereof, to form an antibody heteroconjugate as described in U.S. Pat. No. 4,676,980; herein incorporated by reference in its entirety. In addition, linkers may be used between the labels and the antibodies of the invention (e.g. U.S. Pat. No. 4,831,175; herein incorporated by reference in its entirety).
[0134] Antibodies of the invention may also be attached to a solid support. Additionally, antibodies of the invention, or functional antibody fragments thereof, can be chemically modified by covalent conjugation to a polymer to, for example, increase their circulating half-life. In some embodiments the polymers may be selected from polyoxyethylated polyols and polyethylene glycol (PEG). PEG is soluble in water at room temperature and has the general formula: R(O—CH.sub.2—CH.sub.2).sub.nO—R where R can be hydrogen, or a protective group such as an alkyl or alkanol group.
[0135] Water-soluble polyoxyethylated polyols may also be employed. They include polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG), and the like. Another drug delivery system that can be used for increasing circulatory half-life is the liposome.
[0136] Antibodies may be provided in purified form. Typically, the antibody will be present in a composition that is substantially free of other polypeptides e.g. where less than 90% (by weight), usually less than 60% and more usually less than 50% of the composition is made up of other polypeptides.
[0137] Antibodies of the invention can be of any isotype (e.g. IgA, IgG, IgM (e.g., an alpha, gamma or mu heavy chain). Within the IgG isotype, antibodies may be IgG1, IgG2, IgG3 or IgG4 subclass. Antibodies may have a kappa or a lamda light chain.
EXPERIMENTAL
Example 1
Materials and Methods
Cells, Viruses and Recombinant Hemagglutinin Proteins
[0138] 293T and MDCK cells were obtained from the American Type Culture Collection (ATCC). H7N9 virus expressing the HA and NA of A/Shanghai/1/13 and the internal genes from A/Puerto Rico/8/34 was rescued as previously described (40). All influenza virus stocks used for the assays were freshly grown in SPF eggs, purified and titered. Recombinant HA proteins derived from influenza A virus strains A/Uruguay/716/2007 (H3N2), A/Wisconsin/57/05 (H3N2), A/Perth/16/2009 (H3N2), A/Victoria/361/2011 (H3N2), A/Canada/rv444/2004 (H7N3) and A/Netherlands/219/2003 (H7N7) were obtained from BEI resources. Recombinant HA proteins derived from influenza A virus strains A/Panama/2007/99 (H3N2), A/Hong Kong/1/1968 (H3N2), A/chicken/Jalisco/12283/12 (H7N3), A/Anhui/1/13 (H7N9), A/Shanghai/1/13 (H7N9), A/rhea/North Carolina/39483/93 (H7N1), A/shearwater/West Australia/2576/79 (H15N9), A/California/04/09 (H1N1) and A/South Carolina/1/18 (H1N1) were expressed with a C-terminal trimerization domain and a hexahistidine tag in the baculovirus expression system as described before (Margine et al. Journal of visualized experiments:JoVE. 201381):e51112; herein incorporated by reference in its entirety). A chimeric HA made of the stalk region of A/Shanghai/1/13 (H7N9) and the globular head domain of A/duck/Czechoslovakia/1956 (H4N6) was expressed as well using the same system (Krammer et al. Clinical and vaccine immunology:CVI. 2014; herein incorporated by reference in its entirety).
Antibody Microarray
[0139] Eighty-three H3N2 reactive antibodies were diluted in Protein Printing Buffer (Arraylt) to 250 μg/ml and printed in triplicate on SuperEpoxy glass slides using the SpotBot® 3 microarrayer (Arraylt). Before use, slides were washed with PBS 0.05% Tween-20 and then treated with BlockIt® blocking buffer (Arraylt) for 1 h at room temperature (RT). Slides were washed three times with protein microarray wash buffer between each step and all the reactions were done at room temperature in protein microarray reaction buffer (Arraylt). To detect and normalize antibody signals, the slides were incubated for 1 h with Cy3-conjugated goat anti-human IgG, Fc-fragment specific antibody (Jackson ImmunoResearch). Recombinant HA proteins were biotinylated with EZ-Link Maleimide-PEG2-Biotin (Pierce) and excess free biotin was removed using Zeba Desalting Columns (Pierce). Slides were incubated with 40 μg/ml of each recombinant HA for 1 h and then with Alexa-Fluor 647-conjugated Streptavidin (Invitrogen) for 1 h. Signals were quantified using a GenePix 4000B microarray scanner and analyzed with GenePix Pro 6.0 software (Molecular Devices). Microarray data have deposited in the MIAME-compliant public database. The accession GEO numbers are GSE63249 and GPL19411.
ELISA Assays
[0140] Plates were coated with recombinant HAs at various concentrations depending on the HA (from 0.5 to 5 μg/ml) in PBS overnight at 4° C. After blocking, antibodies were incubated (starting concentration 10 μg/ml) for 1 h at 37° C. Horseradish peroxidase (HRP)-conjugated goat anti-human IgG antibody (Jackson ImmunoResearch) was used to detect binding of the mAbs, followed by development with Super Aquablue ELISA substrate (eBiosciences). Absorbance was measured at 405 nm on a microplate spectrophotometer (BioRad). To standardize the assays, high-affinity antibodies with known binding characteristics were included on each plate and the plates were developed when the absorbance of these controls reached 3.0±0.1 OD units.
[0141] Competition ELISAs were performed by inhibition of binding of each biotinylated antibody of interest at the half-maximal binding concentration with a 10-fold molar excess of competitor antibody. HRP-conjugated streptavidin (Southern Biotech) was used for detection. The absorbance value of each antibody against itself is scored at 100% inhibition and comparison of different antibodies was done as a percentage of this 100% inhibition.
Memory B-Cell Assay and ELISPOT
[0142] PBMC were plated at 5.10.sup.5 cells/well in media supplemented with pokeweed mitogen extract (PWM), phosphothiolated CpG ODN-2006 (Sigma) and Staphylococcus aureus Cowan (SAC) (Sigma), as previously described (42). After 6 days, cells were washed and plated on 96-well filter plates (Millipore) coated with 2 μg/ml of various HAs. Cells were incubated overnight at 37° C., plates were washed and then incubated with an anti-human IgG-biotin antibody (Mabtech) followed by streptavidin alkaline phosphatase (Southern Biotech). Plates were developed using NBT/BCIP (Thermo Scientific).
Hemagglutination Inhibition Assay (HAI)
[0143] Viruses were diluted to 8 HA units/50 μl and 25 μl was combined in duplicate wells with an equal volume of antibody serially diluted in PBS. 50 μl of 0.5% Turkey red blood cells (Lampire Biological) was then added and incubated for 1 h at RT. Minimum effective concentrations were read based on the final dilution for which hemagglutination was observed.
Microneutralization Assay
[0144] MDCK cells were maintained in minimum essential medium (MEM) supplemented with 10% fetal calf serum (FCS) at 37° C. Three-fold serially diluted antibody (starting concentration 300 μg/ml) in serum free MEM with TPCK-treated trypsin (Sigma) was mixed with an equal volume of virus (˜1000 TCID50) and incubated 1 h at 37° C. Confluent MDCK cells in 96-well format were washed twice with PBS, the mixture antibody/virus was added to the cells and incubated for 1 h at 37° C. Then the antibody/virus mixture was removed and cells were cultured for 20 hours at 37° C. with serum-free MEM containing TPCK-treated trypsin and the antibody at the appropriate concentration. Then cells were washed twice with PBS, fixed with 80% ice cold acetone at −20° C. for 1 h, washed 3 times with PBS, blocked for 30 min with 5% milk-PBS and then treated 30 min with 2% H.sub.2O.sub.2. An anti-NP antibody (EVS) diluted in 3% BSA-PBS was incubated for 1 h at RT. An HRP anti-mouse antibody (Santa Cruz Biotechnology) was used for detection, the plates were developed using SigmaFast OPD (Sigma) and the absorbance was measured at 490 nm. The final concentration of antibody that reduced infection to 50% (IC.sub.50) was determined using GraphPad Prism software.
Plaque Assay and PRNT.SUB.50 .Assay
[0145] Plaque assay was done as previously published (Wrammert et al. J Exp Med. 2011; 208(1):181-93; herein incorporated by reference in its entirety) except that cells were incubated 48 h with the agar overlay. Plaques were counted and the final concentration of antibody that reduced plaques to 50% (PRNT.sub.50) was determined using GraphPad Prism software.
[0146] Evaluation of the Prophylactic and Therapeutic Efficacy in Mice
[0147] Groups of 5 female BALB/c mice (Jackson laboratories) aged 6-8 weeks received a dose of 1.5, 5 or 15 mg/kg of purified antibody intraperitoneally. Control mice received purified human polyclonal IgG (Sigma) or a non-H7 binding H3N2 neutralizing monoclonal antibody (011-10069 2C01) at a 15 mg/kg dose. Two hours post treatment, mice were deeply anesthetized using a ketamine/xylazine mixture and infected with 7.5 LD.sub.50 (3975 TCID.sub.50) of A/Shanghai/1/2013 (H7N9) viruses diluted in PBS (pH 7.4). In a therapeutic setting, mice received a 15 mg/kg dose of each antibody individually 24 hours or 72 hours post-infection (h.p.i.). The mice were monitored daily for survival and weight loss until day 14 post-infection. Animals that lost more than 25% of their initial body weight were euthanized.
Evaluation of the Pathogenicity of the Escape Mutant Viruses in Mice and Determination of the LD.SUB.50
[0148] Mice were challenged with escalating doses, ranging from 100-100,000 plaque forming units (PFU), of the A/Shanghai/1/2013 H7N9 wild-type virus, the 045-051310-2B06 escape mutant virus, the 042-100809-2F04 escape mutant virus, or the S6-B01 escape mutant virus. The mice were monitored daily for survival and weight loss until day 14 post-infection. Animals that lost more than 25% of their initial body weight were euthanized. The LD.sub.50 were determined using GraphPad Prism software.
Generation of Escape Mutants
[0149] A/Shanghai/1/2013 virus was diluted in serum free MEM media and was incubated with MDCK cells in 24 well plates for 45 minutes. After the incubation, TPCK-treated trypsin containing MEM media supplemented with antibody (045-051310-2B06, 042-100809-2F04 or S6-B01) at a concentration equivalent to one IC.sub.50 was added to the wells. Positive control wells (virus only) and negative control wells (no virus) were overlayed with TPCK-treated trypsin containing MEM media only. Twenty-four hours post-infection, supernatants were harvested and used to infect fresh cells that were again overlayed with TPCK-treated trypsin containing MEM media, with or without one IC.sub.50 of the respective antibody. After six passages, the antibody concentration was increased to two IC.sub.50. Three IC.sub.50 concentrations were used for passage 7 and 8. Viruses from passage 8 were plaque purified and 4 clones of each virus were picked and grown in ten-day old embryonated chicken eggs for 48 hours. The presence of virus was confirmed using an HA assay. RNA was extracted from allantoic fluid using TriZol reagent (Invitrogen), cDNA was generated using Superscript III reverse transcriptase (Invitrogen) and HA segments were subjected to Sanger sequencing.
Generation of A/Shanghai/1/2013 with 042-100809-2F04 Escape Mutant Point Mutations
[0150] A/Shanghai/1/2013 WT was amplified with the following primers: TCGACCTCCGAAGTTGGGGGGGAGCAAAAGCAGGGGAAAATAAAAACAACCAA AATGAACACTCAAATCCTGGTATTCGCTCTGATTG (H7 HA forward; SEQ ID NO: 31) or TTTTGGGCCGCCGGGTTATTAGTAGAAACAAGGGTGTTTTTCCTCATA TTTCTGAAATTCTAATCTTATATACAAATAGTGCACCGCATGTTTCCATTCT (H7 HA reverse; SEQ ID NO: 32). Point mutations, corresponding to 042-100809-2F04 escape mutant amino acid substitutions, were introduced to the A/Shanghai/1/2013 (H7N9) virus HA segment through site-directed mutagenesis via mutagenizing primers with regions of overlap. Alongside PCR fragments coding for 042-100809-2F04 point mutations, A/Shanghai/1/2013 WT PCR fragments were generated with similar primers lacking the nucleotide substitutions. PCR amplification with H7 HA forward and H7 HA reverse, along with combinations of these PCR fragments, allowed for generation of the four full length HA segments, leading to the generation and isolation of the following gene segments: A/Shanghai/1/2013 HA R364K, A/Shanghai/1/2013 HA G63E/G234D, A/Shanghai/1/2013 HA G63E, and A/Shanghai/1/2013 HA G234D. The HA gene segments were then subcloned into the ambisense expression vector pDZ (Quinlivan et al. J Virol. 2005; 79(13):8431-9; herein incorporated by reference in its entirety) via In-Fusion HD Plus cloning kit (Clontech). Virus was rescued via a reverse genetics system, as previously described (44, 45) with minor modifications to generate 6:2 reassortants. Individually, each pDZ plasmid coding for the HA segment was transfected with seven other plasmids, coding for A/Shanghai/1/2013 NA and the remaining six segments from A/Puerto Rico/8/1934, into 293T cells. Twenty-four hours post-transfection, supernatant/cell mixture was propagated in embryonated chicken eggs, as previously described. Rescued virus pools were dilution purified and sequence confirmed.
Immunofluorescence Assay
[0151] MDCK cells were infected with A/Shanghai/1/2013 wild type virus, the escape mutants (045-051310-2B06, 042-100809-2F04 or S6-B01 mutants), or with the single point mutation viruses (A/Shanghai/1/2013 HA R364K, A/Shanghai/1/2013 HA G63E/G234D, A/Shanghai/1/2013 HA G63E, or A/Shanghai/1/2013 HA G234D) at an MOI of 3 in the absence of trypsin overnight. The cell monolayer was fixed with PBS containing 0.5% parafortnaldehyde for 30 minutes and then blocked with PBS containing 5% non-fat milk for another 30 minutes at RT. Monoclonal antibodies (045-051310-2B06, 042-100809-2F04 or S6-B01) were diluted to 5 μg/ml in PBS 1% BSA and incubated for two hours at RT. Cells were then washed three times with PBS. A goat anti-human IgG Alexa Fluor 488 conjugated antibody (Life Technologies, Inc.) was used for detection. Binding was visualized using an Olympus IX70 inverted fluorescence microscope. The mouse mAb E10 (anti-M2 antibody, Center for Therapeutic Antibody Development at Icahn School of Medicine at Mount Sinai) at 5 μg/ml or polyclonal serum, from a serially 147-immunized mouse were used as a positive infection control and a goat anti-mouse IgG Alexa Fluor 488 conjugated antibody (Life Technologies, Inc.) was used for detection.
Expression of HA Mutant Recombinant Proteins and Binding Analysis by ELISA
[0152] The HA segments of the escape mutants were cloned into baculovirus transfer vectors as described above. Additionally, hybrids with the head domain of the wild type HA A/Shanghai/1/2013 and the stalk domains (demarcation line cysteins 52 and 277, H3 numbering) of the escape mutants were generated by PCR and cloned into baculovirus transfer vectors as well. HA proteins were then expressed as described above and the binding of each antibody was assessed by ELISA using Ni2.sup.+-plates (Qiagen). These plates were chosen specifically to ensure optimal structural integrity of the proteins. Briefly, plates were coated with recombinant HAs at 2 μg/ml in PBS overnight at 4° C. After blocking, antibodies were incubated (starting concentration 30 μg/ml) for 1 h at 37° C. An HRP-labeled anti-human (Sigma) or HRP-labeled anti-mouse (Santa Cruz) was used for detection, the plates were developed using SigmaFast OPD (Sigma) and the absorbance was measured at 490 nm.
Example 2
Cross-Reactive Antibodies
[0153] Cross-Reactive Antibodies React with Novel Pathogenic H7N9 Strains
[0154] To identify H7 binding antibodies, antibody microarray technology was developed that allows high-throughput screening for cross-reactivity to influenza HA proteins (
[0155] To more comprehensively assess the frequency of cross-reactive immunity within the vaccinated population, the frequency of H3/H7 reactive memory cells 14 days post-seasonal vaccination was analyzed by ELISPOT for 13 individuals. Since cross-reactive antibodies typically bind to conserved epitopes on the stalk domain, the percentage of H7 stalk reactive memory cells was determined using a chimeric HA, comprised of the stalk domain of the A/Shanghai/1/2013 (H7N9) strain and the globular head domain of an H4 strain (A/duck/Czechoslovakia/1956 H4N6), to which humans are naïve (Krammer et al. Clinical and vaccine immunology:CVI. 2014; herein incorporated by reference in its entirety). Two control HAs were used: one comprising the globular head region of the H4 strain and one comprising the globular head region of the A/Shanghai/1/2013 (H7N9) strain. The reactivity of memory cells to H3 was assessed using commercially available H3 HAs. Using this method, 9% (median 9.3%, range 4.9-15.9%) of H3N2 HA-reactive IgG memory cells bound to the H7 stalk. This indicates that out of the H3N2 specific memory cells generated from seasonal vaccinations, 9% are group 2 cross-reactive (
Three of the Cross-Reactive Antibodies Neutralize Pathogenic H7N9 Strains In Vitro and Protect Mice from Lethal Infection
[0156] To determine the functional capacity of H7 cross-reactive antibodies, the ability of the antibodies to neutralize the A/Shanghai/1/2013 virus was assessed in a standard microneutralization assay. Three of the 6 cross-reactive antibodies neutralized H7N9 virus in vitro: 045-051310-2B06, 042-100809-2F04 and S6-B01, whereas a human IgG control antibody did not (
TABLE-US-00002 TABLE 2 Information on the strain and year of influenza vaccination vaccine strain 45051310-2B06 Pandemic H1N1 2009 A/California/07/2009 042100809-2F04 TIV 2009/2010 A/Uruguay/716/2007 (H3N2) S6-B01 TIV 2006/2007 A/Wisconsin/67/2005 (H3N2)
[0157] Because in vitro neutralization is not always predictive of in vivo potency (Dreyfus et al. Science. 2012; 337(6100):1343-8; herein incorporated by reference in its entirety), the protective efficacy of the three H7N9 neutralizing antibodies was tested in a mouse model. Mice were treated prophylactically with 1.5, 5 or 15 mg/kg of each antibody intraperitoneally and then challenged with a lethal dose (7.5 LD.sub.50) of A/Shanghai/1/2013 virus (H7N9). In this model, the three antibodies showed comparable efficacy as they conferred protection at the lowest dose of 1.5 mg/kg, with all mice in each group surviving infection. Although mice were protected from mortality at a dose of 1.5 mg/kg of 042-100809-2F04, one out of the five mice treated with 5 mg/kg of antibody showed weight loss of about 25%. Untreated control mice and those treated with 15 mg/kg of polyclonal human IgG lost weight and succumbed to infection by day 8-9. Furthermore, mice treated with an H3N2 neutralizing antibody that did not bind H7 (011-10069 2C01) did not survive past day 8-9 (
The Cross-Reactive Antibodies Neutralize Various Influenza Strains
[0158] The H7 neutralizing antibodies bind to epitopes conserved among a wide variety of influenza strains. Therefore cross-reactivity to multiple influenza A group 1 (H1 and H5) and group 2 (H3, H7 and H15) recombinant HAs was assessed. 045-051310-2B06, 042-100809-2F04, and S6-B01 bound at low concentration to various H3N2 and H7 strains as well as the H15N9 strain, confirming their cross-reactivity within group 2 (
[0159] To assess the breadth of neutralization capacity of these antibodies, plaque reduction assays were performed with various influenza virus strains (
The Neutralizing Cross-Reactive Antibodies Bind to Conserved but Distinct Epitopes on the HA-Stalk Domain
[0160] The majority of neutralizing antibodies generated after exposure to influenza viruses are strain-specific, binding the highly variable loops on the globular head domain of HA. On the other hand, broadly neutralizing monoclonal antibodies (group 1 and 2) often bind conserved epitopes on the HA stalk domain. Antibodies that bind the head generally have hemagglutination inhibition (HI) activity, whereas antibodies that bind to the stalk domain of HA do not but neutralize by post-entry mechanisms of inhibition (21, 22). The H7N9 neutralizing antibodies herein showed no HI activity against any tested strain (data not shown). Moreover, competitive inhibition using CR9114, a previously described stalk-reactive antibody (Dreyfus et al. Science. 2012; 337(6100):1343-8; herein incorporated by reference in its entirety), indicated that the epitopes targeted by the three antibodies are within the stalk domain of HA (
[0161] To further map the epitopes targeted by the three neutralizing antibodies, escape mutants of the A/Shanghai/1/2013 (H7N9) virus were generated. It is postulated that under antibody pressure, viruses undergo mutations at sites that are targeted by the antibody and that allows the identification of the binding site. Four escape mutants wwre sequenced for each antibody and the mutations were analyzed. The same virus passaged in absence of antibody was used as a control. All four clones for each antibody displayed the same mutations. None of the mutations were found with the virus passaged without antibody suggesting that the mutations were a result of the antibody pressure. A total of three amino acid substitutions were identified for each antibody in the HA segment (table 3). Interestingly, mutations both in the stalk and the head domains were observed. The escape mutant generated with the antibody 045-051310-2B06 displayed two mutations in the stalk region, V318I and I384N (H7 numbering starting with methionine), and one in the globular head region, G195E. The escape mutant generated with the antibody S6-B01 displayed one mutation in the stalk region, I384T. This mutation arose at the same residue as the escape mutant generated by 045-051310-2B06 but the substitution was different. Both mutations at this residue were located in the conserved epitope targeted by CR9114 (19). Two mutations in the globular head, A198E and G214E, were also found. Finally, the escape mutant generated with the antibody 042-100809-2F04 displayed one mutation in the stalk region, R364K, and two in the globular head region, G63E and G234D. The stalk mutation was located in the conserved epitope targeted by CR8020, a group 2 neutralizing antibody (Ekiert et al. Science. 2011; 333(6044):843-50; herein incorporated by reference in its entirety).
TABLE-US-00003 TABLE 3 Mutations displayed by the escape mutants Head mutations Stalk mutations 045-051310-2B06 G195E V318I I384N 042-100809-2F04 G63E R364K G234D S6-B01 A198E 1384T G214E
Example 3
Escape Mutants
Escape-Mediated Loss of Binding is Complete for 045-051310-2B06 and 042-100809-2F04 but not for S6-B01
[0162] To test the effect of the mutations on antibody binding, MDCK cells were infected with the original virus (A/Shanghai/1/2013) or the different escape mutant viruses, and the binding of each antibody to the cells was assessed by immunofluorescence. MDCK cells were infected with the different escape mutant viruses (045-051310-2B06, 042-100809-2F04 or 56-B01) or the wild type A/Shanghai/1/2013 virus, and incubated with the neutralizing antibodies, individually, at 5 μg/ml. A mouse anti-M2 protein antibody (E10) was used as a positive control of infection for each virus variants. Binding was visualized using an anti-IgG Alexa Fluor 488 conjugated antibody under an Olympus IX70 inverted fluorescence microscope. The magnification was 100λ. 045-051310-2B06 had no detectable binding when the cells were infected with its corresponding escape mutant, suggesting that the mutations affect antigenicity (Hensley et al. Science. 2009; 326(5953):734-6; herein incorporated by reference in its entirety). There was also no binding for 045-051310-2B06 to the escape mutant generated from S6-B01. Interestingly, for the S6-B01 antibody, binding to both of these escape mutants was only partially lost. Finally, the 042-100809-2F04 antibody lost binding to its own escape mutant, but not to the escape mutants generated from the other two antibodies. These results confirm that the neutralizing cross-reactive antibodies bind to two different epitopes on the HA-stalk domain.
[0163] To determine the role of the head versus stalk domain mutations, different variants of the mutated recombinant HAs were expressed. For each of the three escape mutants, two HAs were generated and assessed antibody binding by ELISA; the first HA incorporated the mutations in both the head and the stalk domains while the second HA incorporated only the stalk mutations with a wild type globular head domain. Reduced binding to both mutated HAs for the antibody 045-051310-2B06 was observed (
Escape Mutant Viruses have Diminished Pathogenicity In Vivo
[0164] To evaluate the importance of the stalk mutations in the loss of viral fitness, infectious reassortant viruses with these mutations were generated for each of the three antibodies and the LD.sub.50 of the different viruses in mice was determined. Experiments were conducted with different challenge doses, ranging from 100 to 100,000 PFU per mouse. Although the 045-051310-2B06 and S6-B01 escape mutants probably share the same epitope, the lethality of the two mutants compared to the parental A/Shanghai H7N9 strain were quite different. The 045-051310-2B06 escape mutant was highly attenuated (LD.sub.50>1.10.sup.5) compared to the wild-type A/Shanghai H7N9 strain (LD.sub.50=4.6.10.sup.3), and none of the mice succumbed to infection. In contrast, the S6-B01 escape mutant closely mimicked the parental strain and all mice challenged with 100,000 PFU succumbed to infection. However, the LD.sub.50 of the S6-B01 mutant (LD.sub.50=3.2.10.sup.4) was still higher that of the wild-type A/Shanghai H7N9 strain. The 042-100809-2F04 escape mutant was moderately attenuated (LD.sub.50=5.2.10.sup.4) (
The Loss of Binding Observed for 042-100809-2F04 is Only Mediated by Escape Mutations in the HA-Stalk Domain
[0165] It was demonstrated that the phenotype of the 045-051310-2B06 escape mutant was dependent on the stalk mutations (complete loss of binding and loss of viral fitness). Results also demonstrate that 045-051310-2B06 and S6-B01 bind to the same epitope on the stalk region. For the 042-100809-2F04 escape mutant, the loss of binding was more dramatic when the head and stalk mutations were combined. In addition, the pathogenicity of the escape mutant viruses was moderate. In order to confirm that the mutations in the stalk domain are responsible for antibody binding, infectious reassortant viruses were generated with individual head and stalk mutations. Immunofluorescence was used to characterize antibody binding to four 042-100809-2F04 point-mutant viruses: R364K (stalk mutation), G63E/G234D (head mutations), G63E, and G234D. 042-100809-2F04 bound to the wild type A/Shanghai H7N9 virus and to all combinations of the head domain mutations reassortants (G63E/G234D, G63E and G234D). MDCK cells were infected with viruses containing different combinations of point-mutations (R364K (stalk mutation), G63E/G234D (head mutations), G63E, and G234D), the full escape mutant (G63E/G234D/R364K), or the wild type A/Shanghai/1/2013 virus, then incubated with 042-100809-2F04 antibody at 5 μg/ml. A polyclonal serum was used as a positive control of infection for each virus variant. The antibody 6F12 was used as a negative control. Binding was visualized using an anti-IgG Alexa Fluor 488 conjugated antibody under an Olympus IX70 inverted fluorescence microscope. Magnification was 100×. Binding to the stalk escape mutant (R364K) was lost, as well as binding to the control full escape mutant (G63E/G234D/R364K).
[0166] To further characterize these point-mutant viruses, viral replication was observed under the presence of antibody pressure (042-100809-2F04) in vitro via a microneutralization assay. In line with the above results, the full 042-100809-2F04 escape mutant (G63E/G234D/R364K) evaded antibody neutralization, as well as virus with the stalk mutation alone (R364K). In contrast, all combinations of mutations on the head domain failed to evade antibody neutralization. 042-100809-2F04 neutralized the wild type A/Shanghai H7N9 virus (
Example 4
Antibody 41-5E04
[0167] Antibody 41-5E04 was isolated from plasmablasts at day 7 after an inactivated virus vaccine H7N9. The individual had received two doses of a live attenuated cold-adapted influenza A/Anhui/1/2013 (H7N9) vaccine and then boosted 12 weeks later with an inactivated virus vaccine based on the closely related Shanghai/2/2013 (H7N9) strain. Plasmablasts were isolated 7 days after administration of the inactivated vaccine, then single-cell sorted and antibodies were cloned as previously described (Smith et al., 2009; Wrammert et al., 2008; herein incorporated by reference in their entireties).
[0168] 41-5E04 binds to both group 1 and 2 HA proteins and neutralizes viruses in vitro (
[0169] 6-8 week old female BALB/c mice were treated prophylactically with 0.3, 1, or 5 mg/kg of 41-5E04 intraperitoneally and then challenged with a lethal dose (7.5 LD50) of A/Shanghai/1/2013 (H7N9) virus (
[0170] All publications and patents provided herein are incorporated by reference in their entireties. Various modifications and variations of the described compositions and methods of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the relevant fields are intended to be within the scope of the present invention.
Sequences
[0171] The following sequences are references throughout by their corresponding SEQ ID NOs.
TABLE-US-00004 DY-2F04H SEQ ID NO: 1 GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTC CCTGAGACTCTCCTGTGTAGCCTCTGGATTCACCTTTAGTACTCCTTGGA TGACGTGGATCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTGGCCCAC ATAAAGCAGGATGGAAGTGAGACATACTATGTGGACTCTGTGAAGGGCCG ATTCACCATCTCCAGAGACAACGCCAAGAACTCACTGTATCTGCAAATGA ACAGCCTGAAAGCCGAGGACACGGCTTTATATTACTGTGCGAGAATGACG CGGGAATCATCAGAAAACTACTGGGGCCAGGGAACCCTGGTCACCGTCTC CTCAG MP-2B06H SEQ ID NO: 2 CAGGTGCAGCTGGTGCAGTCTGGACCTGAGATGAAGAAGCCTGGGGCCTC AGTGAAGGTCTCCTGCAAGACTTCTGGTTACAGGTTTACCAGATATGGGA TCAGTTGGGTGCGGCAGGCCCCTGGACGGGGGCTGGAGTGGCTGGGGTGG ATCAGCGCATACAGTGGAGACACATATTATGGACAGAAATTCCAGGACAG AGTCACCATGACTACAGACAGAGCCACGAGTACAGCCTATATGGAGTTGC GGAACCTGGGATCTGACGACTCGGCCGTTTATTTCTGTGCGAGAGATCAC GTCCAAGGGGAAGTGAGCATATATTATTATGCCATGGACGTCTGGGGCGA AGGGACCACGGTCACCGTCTCCTCA 1B01H SEQ ID NO: 3 CAGGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCCGGGGCCTC AGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACGTTTAACAGCTATGGAA TCAGTTGGGTGCGACAGGCCCCCGGACAAGGGCTTGAGTGGATGGGATGG ATCAGCGCTTACACTGGCGACACAAAGTTTGCACAGAATGTGCAGGGCAG AGTCACCATGACCATAGACACATCCACGAGTACCGCCTACATGGAACTGA GGAGCCTGAGATCTGACGACACGGCCGTATATTACTGTGCGAGACATTAC CTCCAAGGGGTAGTAGTGGTTGACCCCTACTCCCACGCTATGGACGTCTG GGGCCAAGGGACCACGGTCACCGTCTCCTCA DY2F04K SEQ ID NO: 4 GATGTTGTGATGACTCAGTCTCCACTCTCCTTGCCCGTCACCCTTGGCCA GCCGGCCTCCATCTCCTGCAGGTCTAGTCAAAGCCTCGTATACAGTGATG GAGACACCTTCCTGGAATGGTTTCAGCAGAGGCCAGGCCAATCTCCAAGG CGCCTAATTTATAAGGTTTCTAACCGGGATTCTGGGGTCCCAGACAGATT CAGCGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGG AGGCTGAGGATGTTGGGCTTTATTACTGCATGCAACATACACACTGGCCG CACACTTTTGGCCAGGGGACCAAGGTGGAGATCAAAC MP-2B06K SEQ ID NO: 5 GAAATTGTGTTGACACAGTCTCCAGCCACCCTGTCTTTGTCTCCAGGAGA AAGAGTCACCCTCTCCTGCAGGGCCAGTGAGAGTGTTGGCAACAAGTTAG CCTGGTTCCAACAGAGGCCTGGCCAGGCTCCCAGGCTCCTCATTTATAAT GCATCCAACAGGGCCACTGACATCCCAGCCAGGTTCAGTGGCAGTGGGTC TGGGACAGACTTCACTCTCACCATCAGCAGCCTGCAGCCTGAAGATTTTG CAGTTTATTACTGTCAGCAGCGTGGCACGTGGCCTCGGGGCCTCATCACC TTCGGCCAAGGGACACGACTGGAGATTAAAC 1B01K SEQ ID NO: 6 GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGTCTTTCTTTCCAGGGGA AAGAGCCACCCTCTCCTGCAGGGCCAGTCAAACTATTAACAGCAGATTCT TAGCCTGGTATCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTAT GGTGCATCCAGCCGGGCCACTGGCATCCCGGACAGGTTCAGTGGCCGTGG GTCTGGGACAGACTTCACTCTCGCCATCAGCAGACTGGAGCCTGAGGATT TTGCAGTGTATTACTGTCAGTTGTATGGTAGCTCACGGACGACTTTTGGC CAGGGGACCAAGGTGGAGATCAAAC DY-2F04H SEQ ID NO: 7 EVQLVESGGGLVQPGGSLRLSCVASGFTFSTPWMTWIRQAPGKGLEWVAH IKQDGSETYYVDSVKGRFTISRDNAKNSLYLQMNSLKAEDTALYYCARMT RESSENYWGQGTLVTVSS MP-2B06H SEQ ID NO: 8 QVQLVQSGPEMKKPGASVKVSCKTSGYRFTRYGISWVRQAPGRGLEWLGW ISAYSGDTYYGQKFQDRVTMTTDRATSTAYMELRNLGSDDSAVYFCARDH VQGEVSIYYYAMDVWGEGTTVTVSS 1B01H SEQ ID NO: 9 QVQLVQSGAEVKKPGASVKVSCKASGYTFNSYGISWVRQAPGQGLEWMGW ISAYTGDTKFAQNVQGRVTMTIDTSTSTAYMELRSLRSDDTAVYYCARHY LQGVVVVDPYSHAMDVWGQGTTVTVSS DY2F04K SEQ ID NO: 10 DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGDTFLEWFQQRPGQSPR RLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGLYYCMQHTHWP HTFGQGTKVEIK MP-2B06K SEQ ID NO: 11 EIVLTQSPATLSLSPGERVTLSCRASESVGNKLAWFQQRPGQAPRLLIYN ASNRATDIPARFSGSGSGTDFTLTISSLQPEDFAVYYCQQRGTWPRGLIT FGQGTRLEIK 1B01K SEQ ID NO: 12 EIVLTQSPGTLSFFPGERATLSCRASQTINSRFLAWYQQKPGQAPRLLIY GASSRATGIPDRFSGRGSGTDFTLAISRLEPEDFAVYYCQLYGSSRTTFG QGTKVEIK DY2F04 HCDR1 SEQ ID NO: 13 GFTFSTPW DY2F04 HCDR2 SEQ ID NO: 14 IKQDGSET DY2F04 HCDR3 SEQ ID NO: 15 ARMTRESSENY MP-2B06 HCDR1 SEQ ID NO: 16 GYRFTRYG MP-2B06 HCDR2 SEQ ID NO: 17 ISAYSGDT MP-2B06 HCDR3 SEQ ID NO: 18 ARDHVQGEVSIYYYAMDV HCDR1 SEQ ID NO: 19 GYTFNSYG 1B01 HCDR2 SEQ ID NO: 20 ISAYTGDT 1B01 HCDR3 SEQ ID NO: 21 ARHYLQGVVVVDPYSHAMDV DY2F04 KCDR1 SEQ ID NO: 22 QSLVYSDGDTF DY2F04 KCDR2 SEQ ID NO: 23 KVS DY2F04 KCDR3 SEQ ID NO: 24 MQHTHWPHT MP-2B06 KCDR1 SEQ ID NO: 25 ESVGNK MP-2B06 KCDR2 SEQ ID NO: 26 NAS MP-2B06 KCDR3 SEQ ID NO: 27 QQRGTWPRGLIT 1B01 KCDR1 SEQ ID NO: 28 QTINSRF 1B01 KCDR2 SEQ ID NO: 29 GAS 1B01 KCDR3 SEQ ID NO: 30 QLYGSSRTT 5E04H SEQ ID NO: 33 GAGGTGCAGCTGGTGGAGTCTGGAGGAGGCTTGATAAACCCTGGGGGGTC CCTGAGACTCTCCTGTGCAGCCTCTGGTTTCAACATCGATAACAACCAAA TGATTTGGGTCCGCCAGGCTCCAAAGAAGGGCCTGGAGTGGGTCTCACTT ATTTATAGCGGTGGTTCTACATATTCCGCAGACACCGTGAAGGGCCGATT CACCATCTCCAGAGACAATTCCAAGAACACAGTGTATCTTCACATGAACA GTCTGCGAGCCGAGGACACGGCCGTGTATTATTGTGCGAGAGATTTTCTC AGGGGACCAATACATGATTACTTTTTCTACATGGACGTCTGGGGCAAGGG GACCACGGTCACCGTCTCCTCA 5E04K SEQ ID NO: 34 GAAATTGTGTTGACACAGTCTCCAGCCTCCCTGTCTTTGTCTCCAGGGGA AAGAGCCACCCTCTCCTGCAGGGCCAGTCAGAGGGTTGACAGCTCCATAG GCTGGTACCGACACAAACCTGGTCAGGCTCCCAGGCTCCTCATCTATGAT GCAATTAAAAGGGCCACTGGCATCCCAGCCAGATTCAGTGGCAGTGGATA TGGGACAGACTTCACTCTTACCATCAGCCGCCTAGAGGCTGAAGATTTTG CAGTTTATTACTGTCAGCAGCGTAGCACCTGGCCCACTTTCGGCCCTGGG ACCAAAGTGGATATCAAAC 5E04H SEQ ID NO: 35 EVQLVESGGGLINPGGSLRLSCAASGFNIDNNQMIWVRQAPKKGLEWVSL IYSGGSTYSADTVK GRFTISRDNSKNTVYLHMNSLRAEDTAVYYCARDFLRGPIHDYFFYMDVW GKGTTVTVSS 5E04K SEQ ID NO: 36 EIVLTQSPASLSLSPGERATLSCRASQRVDSSIGWYRHKPGQAPRLLIYD AIKRATGIPARFSGSGYGTDFTLTISRLEAEDFAVYYCQQRSTWPTFGPG TKVDIK 5E04-HCDR1 SEQ ID NO: 37 GFNIDNNQ 5E04-HCDR2 SEQ ID NO: 38 IYSGGST 5E04-HCDR3 SEQ ID NO: 39 ARDFLRGPIHDYFFYMDV 5E04-KCDR1 SEQ ID NO: 40 QRVDSS 5E04-KCDR2 SEQ ID NO: 41 DAT 5E04-KCDR3 SEQ ID NO: 42 QQRSTWPT
REFERENCES
[0172] The following references are herein incorporated by reference in their entireties. [0173] Shaw M L and Palese P. Orthomyxoviruses. In: Knipe D M, Howley P M, eds. Fields Virology. Philadelphia, Pa., USA: Lippincott Williams and Wilkins; 2013. [0174] Kaur K, Sullivan M, and Wilson P C. Targeting B cell responses in universal influenza vaccine design. Trends in immunology. 2011; 32(11):524-31. [0175] Air G M. Sequence relationships among the hemagglutinin genes of 12 subtypes of influenza A virus. Proc Natl Acad Sci USA. 1981; 78(12):7639-43. [0176] Medina R A, and Garcia-Sastre A. Influenza A viruses: new research developments. Nat Rev Microbiol. 2011; 9(8):590-603. [0177] Hirst M, Astell C R, Griffith M, Coughlin S M, Moksa M, Zeng T, Smailus D E, Holt R A, Jones S, Marra M A, et al. Novel avian influenza H7N3 strain outbreak, British Columbia. Emerg Infect Dis. 2004; 10(12):2192-5. [0178] Fouchier R A, Schneeberger P M, Rozendaal F W, Broekman J M, Kemink S A, Munster V, Kuiken T, Rimmelzwaan G F, Schutten M, Van Doornum G J, et al. Avian influenza A virus (H7N7) associated with human conjunctivitis and a fatal case of acute respiratory distress syndrome. Proc Natl Acad Sci USA. 2004; 101(5):1356-61. [0179] Gao R, Cao B, Hu Y, Feng Z, Wang D, Hu W, Chen J, Jie Z, Qiu H, Xu K, et al. Human infection with a novel avian-origin influenza A (H7N9) virus. N Engl J Med. 2013; 368(20):1888-97. [0180] Belser J A, Gustin K M, Pearce M B, Maines T R, Zeng H, Pappas C, Sun X, Carney P J, Villanueva J M, Stevens J, et al. Pathogenesis and transmission of avian influenza A (H7N9) virus in ferrets and mice. Nature. 2013. [0181] Watanabe T, Kiso M, Fukuyama S, Nakajima N, Imai M, Yamada S, Murakami S, Yamayoshi S, Iwatsuki-Horimoto K, Sakoda Y, et al. Characterization of H7N9 influenza A viruses isolated from humans. Nature. 2013. [0182] Morens D M, Taubenberger J K, and Fauci A S. H7N9 Avian Influenza A Virus and the Perpetual Challenge of Potential Human Pandemicity. MBio. 2013; 4(4). [0183] Hu Y, Lu S, Song Z, Wang W, Hao P, Li J, Zhang X, Yen H L, Shi B, Li T, et al. Association between adverse clinical outcome in human disease caused by novel influenza A H7N9 virus and sustained viral shedding and emergence of antiviral resistance. Lancet. 2013; 381(9885):2273-9. [0184] Zhang Q, Shi J, Deng G, Guo J, Zeng X, He X, Kong H, Gu C, Li X, Liu J, et al. H7N9 influenza viruses are transmissible in ferrets by respiratory droplet. Science. 2013; 341(6144):410-4. [0185] Xu R, de Vries R P, Zhu X, Nycholat C M, McBride R, Yu W, Paulson J C, and Wilson I A. Preferential recognition of avian-like receptors in human influenza A H7N9 viruses. Science. 2013; 342(6163):1230-5. [0186] Ramos I, Krammer F, Hai R, Aguilera D, Bernal-Rubio D, Steel J, Garcia-Sastre A, and Femandez-Sesma A. H7N9 influenza viruses interact preferentially with alpha2,3-linked sialic acids and bind weakly to alpha2,6-linked sialic acids. The Journal of general virology. 2013; 94(Pt 11):2417-23. [0187] Hai R, Schmolke M, Leyva-Grado V H, Thangavel R R, Margine I, Jaffe E L, Krammer F, Solorzano A, Garcia-Sastre A, Palese P, et al. Influenza A(H7N9) virus gains neuraminidase inhibitor resistance without loss of in vivo virulence or transmissibility. Nature communications. 2013; 4(2854. [0188] Wrammert J, Koutsonanos D, Li G M, Edupuganti S, Sui J, Morrissey M, McCausland M, Skountzou I, Hornig M, Lipkin W I, et al. Broadly cross-reactive antibodies dominate the human B cell response against 2009 pandemic H1N1 influenza virus infection. J Exp Med. 2011; 208(1):181-93. [0189] Wrammert J, Smith K, Miller J, Langley W A, Kokko K, Larsen C, Zheng N Y, Mays I, Garman L, Helms C, et al. Rapid cloning of high-affinity human monoclonal antibodies against influenza virus. Nature. 2008; 453(7195):667-71. [0190] Krammer F, Jul-Larsen A, Margine I, Hirsh A, Sjursen H, Zambon M, and Cox R J. An H7N1 influenza virus vaccine induces broadly reactive antibody responses against H7N9 in humans. Clinical and vaccine immunology:CVI. 2014. [0191] Dreyfus C, Laursen N S, Kwaks T, Zuijdgeest D, Khayat R, Ekiert D C, Lee J H, Metlagel Z, Bujny M V, Jongeneelen M, et al. Highly conserved protective epitopes on influenza B viruses. Science. 2012; 337(6100):1343-8. [0192] Kapczynski D R, Pantin-Jackwood M, Guzman S G, Ricardez Y, Spackman E, Bertran K, Suarez D L, and Swayne D E. Characterization of the 2012 highly pathogenic avian influenza H7N3 virus isolated from poultry in an outbreak in Mexico: pathobiology and vaccine protection. J Virol. 2013; 87(16):9086-96. [0193] Brandenburg B, Koudstaal W, Goudsmit J, Klaren V, Tang C, Bujny M V, Korse H J, Kwaks T, Otterstrom J J, Juraszek J, et al. Mechanisms of hemagglutinin targeted influenza virus neutralization. PLoS One. 2013; 8(12):e80034. [0194] Tan G S, Lee P S, Hoffman R M, Mazel-Sanchez B, Krammer F, Leon P E, Ward A B, Wilson I A, and Palese P. Characterization of a broadly neutralizing monoclonal antibody that targets the fusion domain of group 2 influenza a virus hemagglutinin. J Virol. 2014; 88(23):13580-92. [0195] Ekiert D C, Friesen R H, Bhabha G, Kwaks T, Jongeneelen M, Yu W, Ophorst C, Cox F, Korse H J, Brandenburg B, et al. A highly conserved neutralizing epitope on group 2 influenza A viruses. Science. 2011; 333(6044):843-50. [0196] Hensley S E, Das S R, Bailey A L, Schmidt L M, Hickman H D, Jayaraman A, Viswanathan K, Raman R, Sasisekharan R, Bennink J R, et al. Hemagglutinin receptor binding avidity drives influenza A virus antigenic drift. Science. 2009; 326(5953):734-6. [0197] Corti D, Suguitan A L, Jr., Pinna D, Silacci C, Fernandez-Rodriguez B M, Vanzetta F, Santos C, Luke C J, Torres-Velez F J, Temperton N J, et al. Heterosubtypic neutralizing antibodies are produced by individuals immunized with a seasonal influenza vaccine. J Clin Invest. 2010; 120(5):1663-73. [0198] Li G M, Chiu C, Wrammert J, McCausland M, Andrews S F, Zheng N Y, Lee J H, Huang M, Qu X, Edupuganti S, et al. Pandemic H1N1 influenza vaccine induces a recall response in humans that favors broadly cross-reactive memory B cells. Proc Natl Acad Sci USA. 2012; 109(23):9047-52. [0199] Thomson C A, Wang Y, Jackson L M, Olson M, Wang W, Liavonchanka A, Keleta L, Silva V, Diederich S, Jones R B, et al. Pandemic H1N1 Influenza Infection and Vaccination in Humans Induces Cross-Protective Antibodies that Target the Hemagglutinin Stem. Frontiers in immunology. 2012; 3(87. [0200] Wilson P C, and Andrews S F. Tools to therapeutically harness the human antibody response. Nature reviews Immunology. 2012; 12(10):709-19. [0201] Ekiert D C, Kashyap A K, Steel J, Rubrum A, Bhabha G, Khayat R, Lee R I, Dillon M A, O'Neil R E, Faynboym A M, et al. Cross-neutralization of influenza A viruses mediated by a single antibody loop. Nature. 2012; 489(7417):526-32. [0202] Margine I, Hai R, Albrecht R A, Obermoser G, Harrod A C, Banchereau J, Palucka K, Garcia-Sastre A, Palese P, Treanor J J, et al. H3N2 influenza virus infection induces broadly reactive hemagglutinin stalk antibodies in humans and mice. J Virol. 2013; 87(8):4728-37. [0203] Margine I, Krammer F, Hai R, Heaton N S, Tan G S, Andrews S A, Runstadler J A, Wilson P C, Albrecht R A, Garcia-Sastre A, et al. Hemagglutinin Stalk-Based Universal Vaccine Constructs Protect against Group 2 Influenza A Viruses. J Virol. 2013; 87(19):10435-46. [0204] Krammer F, Margine I, Hai R, Flood A, Hirsh A, Tsvetnitsky V, Chen D, and Palese P. H3 stalk-based chimeric hemagglutinin influenza virus constructs protect mice from H7N9 challenge. J Virol. 2014; 88(4):2340-3. [0205] Ekiert D C, Bhabha G, Elsliger M A, Friesen R H, Jongeneelen M, Throsby M, Goudsmit J, and Wilson I A. Antibody recognition of a highly conserved influenza virus epitope. Science. 2009; 324(5924):246-51. [0206] Friesen R H, Lee P S, Stoop E J, Hoffman R M, Ekiert D C, Bhabha G, Yu W, Juraszek J, Koudstaal W, Jongeneelen M, et al. A common solution to group 2 influenza virus neutralization. Proc Natl Acad Sci USA. 2014; 111(1):445-50. [0207] O'Donnell C D, Vogel L, Wright A, Das S R, Wrammert J, Li G M, McCausland M, Zheng N Y, Yewdell J W, Ahmed R, et al. Antibody pressure by a human monoclonal antibody targeting the 2009 pandemic H1N1 virus hemagglutinin drives the emergence of a virus with increased virulence in mice. MBio. 2012; 3(3). [0208] Wang T T, Tan G S, Hai R, Pica N, Petersen E, Moran T M, and Palese P. Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins. PLoS Pathog. 2010; 6(2):e1000796. [0209] Corti D, Voss J, Gamblin S J, Codoni G, Macagno A, Jarrossay D, Vachieri S G, Pinna D, Minola A, Vanzetta F, et al. A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins. Science. 2011; 333(6044):850-6. [0210] Throsby M, van den Brink E, Jongeneelen M, Poon L L, Alard P, Cornelissen L, Bakker A, Cox F, van Deventer E, Guan Y, et al. Heterosubtypic neutralizing monoclonal antibodies cross-protective against H5N1 and H1N1 recovered from human IgM+ memory B cells. PLoS One. 2008; 3(12):e3942. [0211] Sui J, Hwang W C, Perez S, Wei G, Aird D, Chen L M, Santelli E, Stec B, Cadwell G, Ali M, et al. Structural and functional bases for broad-spectrum neutralization of avian and human influenza A viruses. Nat Struct Mol Biol. 2009; 16(3):265-73. [0212] Krammer F, Albrecht R A, Tan G S, Margine I, Hai R, Schmolke M, Runstadler J, Andrews S F, Wilson P C, Cox R J, et al. Divergent H7 immunogens offer protection from H7N9 virus challenge. J Virol. 2014; 88(8):3976-85. [0213] Margine I, Palese P, and Krammer F. Expression of functional recombinant hemagglutinin and neuraminidase proteins from the novel H7N9 influenza virus using the baculovirus expression system. Journal of visualized experiments:JoVE. 201381):e51112. [0214] Crotty S, Aubert R D, Glidewell J, and Ahmed R. Tracking human antigen-specific memory B cells: a sensitive and generalized ELISPOT system. Journal of immunological methods. 2004; 286(1-2):111-22. [0215] Quinlivan M, Zamarin D, Garcia-Sastre A, Cullinane A, Chambers T, and Palese P. Attenuation of equine influenza viruses through truncations of the NS1 protein. J Virol. 2005; 79(13):8431-9. [0216] Fodor E, Devenish L, Engelhardt O G, Palese P, Brownlee G G, and Garcia-Sastre A. Rescue of influenza A virus from recombinant DNA. J Virol. 1999; 73(11):9679-82. [0217] Hai R, Krammer F, Tan G S, Pica N, Eggink D, Maamary J, Margine I, Albrecht R A, and Palese P. Influenza viruses expressing chimeric hemagglutinins: globular head and stalk domains derived from different subtypes. J Virol. 2012; 86(10):5774-81. [0218] Smith K, Garman L, Wrammert J, Zheng N Y, Capra J D, Ahmed R, and Wilson P C. Rapid generation of fully human monoclonal antibodies specific to a vaccinating antigen. Nat Protoc. 2009; 4(3):372-84.