CD96-BINDING AGENTS AS IMMUNOMODULATORS
20230192845 · 2023-06-22
Assignee
Inventors
- Florence Renart-Depontieu (Saint-Priest, FR)
- Sachiko Takami (Toyama, JP)
- Germain Margall-Ducos (Marseille, FR)
- Nicola Beltraminel-Li (Marseille, FR)
- Pierre Garrone (Lyon, FR)
- Anne Rogel (Southampton Hampshire, GB)
- Aymen Al-Shamkhani (Southampton Hampshire, GB)
- Xavier Preville (St. Louis, FR)
Cpc classification
A61P35/00
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
A61K39/3955
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
C07K2317/71
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K39/395
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
Abstract
Provided is a CD96-binding agent, wherein the agent is capable of stimulating activation and/or proliferation of T cells upon binding to CD96. Also provided are isolated nucleic acids and cells that produce the agent and uses thereof.
Claims
1.-32. (canceled)
33. A CD96-binding agent, wherein the agent stimulates signaling via CD96, wherein the agent is capable of stimulating activation and/or proliferation of T cells upon binding to CD96, and wherein the agent specifically binds to at least one epitope in an extracellular domain D1 (SEQ ID NO: 269), domain D2 v1 or v2 (SEQ ID NO: 270 or SEQ ID NO: 273), or domain D3 (SEQ ID NO: 271).
34. The CD96-binding agent of claim 33, wherein the CD96-binding agent is capable of stimulating activation and/or proliferation of T cells in combination with a T cell co-stimulatory agent and/or a T cell proliferation agent.
35. The CD96-binding agent of claim 33, wherein binding of the CD96-binding agent to CD96 induces dimerization or multimerization of CD96.
36. The CD96-binding agent of claim 33, wherein the CD96-binding agent is a chimeric, humanized, or fully human anti-CD96 antibody or fragment thereof.
37. The CD96-binding agent of claim 36, wherein the antibody is an F(ab′)2 or a Fab fragment.
38. The CD96-binding agent of claim 36, wherein the antibody comprises the following combinations of 3 heavy light chain CDR sequences with 3 light chain CDR sequences: a. SEQ ID NOs: 1-3 in combination with SEQ ID NOs: 7-9 (Kabat annotation) or SEQ ID NOs: 4-6 in combination with SEQ ID NOs: 10-12 (IMGT annotation); b. SEQ ID NOs: 13-15 in combination with SEQ ID NOs: 19-21 (Kabat annotation) or SEQ ID NOs: 16-18 in combination with SEQ ID NOs: 22-24 (IMGT annotation); c. SEQ ID NOs: 61-63 in combination with SEQ ID NOs: 67-69 (Kabat annotation) or SEQ ID NOs: 64-66 in combination with SEQ ID NOs: 70-72 (IMGT annotation); d. SEQ ID NOs: 73-75 in combination with SEQ ID NOs: 79-81 (Kabat annotation) or SEQ ID NOs: 76-78 in combination with SEQ ID NOs: 82-84 (IMGT annotation); e. SEQ ID NOs: 85-87 in combination with SEQ ID NOs: 91-93 (Kabat annotation) or SEQ ID NOs: 88-90 in combination with SEQ ID NOs: 94-96 (IMGT annotation); f. SEQ ID NOs: 109-111 in combination with SEQ ID NOs: 115-117 (Kabat annotation) or SEQ ID NOs: 112-114 in combination with SEQ ID NOs: 118-120 (IMGT annotation); g. SEQ ID NOs: 145-147 in combination with SEQ ID NOs: 151-153 (Kabat annotation) or SEQ ID NOs: 148-150 in combination with SEQ ID NOs: 154-156 (IMGT annotation); h. SEQ ID NOs: 157-159 in combination with SEQ ID NOs: 163-165 (Kabat annotation) or SEQ ID NOs: 160-162 in combination with SEQ ID NOs: 166-168 (IMGT annotation); i. SEQ ID NOs: 196-171 in combination with SEQ ID NOs: 175-177 (Kabat annotation) or SEQ ID NOs: 172-174 in combination with SEQ ID NOs: 178-180 (IMGT annotation); j. SEQ ID NOs: 181-183 in combination with SEQ ID NOs: 187-189 (Kabat annotation) or SEQ ID NOs: 184-186 in combination with SEQ ID NOs: 190-192 (IMGT annotation); k. SEQ ID NOs: 193-195 in combination with SEQ ID NOs: 199-201 (Kabat annotation) or SEQ ID NOs: 196-198 in combination with SEQ ID NOs: 202-204 (IMGT annotation); l. SEQ ID NOs: 205-207 in combination with SEQ ID NOs: 211-213 (Kabat annotation) or SEQ ID NOs: 208-210 in combination with SEQ ID NOs: 214-216 (IMGT annotation); or m. SEQ ID NOs: 217-219 in combination with SEQ ID NOs: 223-225 (Kabat annotation) or SEQ ID NOs: 220-222 in combination with SEQ ID NOs: 226-228 (IMGT annotation).
39. The CD96-binding agent of claim 38, wherein the antibody comprises a heavy chain variable domain and a light chain variable domain comprising an amino acid sequence set forth in any one of SEQ ID NOs: 229-244, 247-248, or 253-266.
40. An isolated nucleic acid encoding the amino acid sequence of the CD96-binding agent of claim 38.
41. The CD96-binding agent of claim 33, wherein the T cells are CD4.sup.+ and/or CD8.sup.+ cells.
42. The CD96-binding agent of claim 33, wherein the CD96-binding agent binds to human CD96 variant 1 (SEQ ID NO: 267) and/or to human CD96 variant 2 (SEQ ID NO: 268) and/or to rhesus CD96 (SEQ ID NO: 272).
43. The CD96-binding agent of claim 33, wherein the CD96-binding agent is capable of binding to human CD96 expressed on T-cells with a dissociation constant (K.sub.D) of less than 50 nM.
44. An isolated cell that produces the CD96-binding agent of claim 33.
45. A pharmaceutical composition comprising the CD96-binding agent of claim 33 and a pharmaceutical acceptable excipient or carrier.
46. A method of treating cancer or an infectious disease, the method comprising administering a therapeutically effective amount of the CD96-binding agent of claim 33 to a patient in need thereof.
47. The method of claim 46, wherein the CD96-binding agent is administered as a monotherapy.
48. The method of claim 46, wherein the CD96-binding agent is administered as a combination therapy.
49. The method of claim 46, wherein the CD96-binding agent is administered in combination with a co-stimulating agent or an immune checkpoint inhibitor.
50. A method of stimulating activation and/or proliferation of T cells upon binding to CD96, the method comprising administering a therapeutically effective amount of the CD96-binding agent of claim 33 to a patient in need thereof.
51. The method of claim 50, wherein the CD96-binding agent is administered at a dosage effective to proliferate T cells when administered in combination with a T cell co-stimulatory agent and/or a T cell proliferation agent.
52. The method of claim 50, wherein the CD96-binding agent is a CD96 agonist.
53. The method of claim 50, wherein binding of the CD96-binding agent to CD96 induces dimerization or multimerization of CD96.
54. The method of claim 50, wherein the T cells are CD4.sup.+ and/or CD8.sup.+ cells.
55. A prophylactic or therapeutic vaccine comprising an adjuvant, wherein the adjuvant comprises the CD96-binding agent of claim 33.
Description
BRIEF DESCRIPTION OF FIGURES
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
DETAILED DESCRIPTION
[0057] The present invention provides CD96-binding agents that activate T cells. In a preferred embodiment, the CD96-binding agents are antibodies or fragments thereof. However alternative CD96-binding agents are also within the scope of the invention, e.g. aptamers, oligonucleotides, mimetics, peptides or small molecular weight compounds, or combinations thereof, which bind to CD96, preferably human CD96. In one embodiment, the CD96-binding agent is a soluble receptor for CD96, e.g. a soluble fragment of CD155 (in monomeric or oligomeric form) that binds to CD96.
[0058] The CD96 binding agents stimulate activation and/or proliferation of T cells. By this it is meant that T cells (or a subset thereof) show increased activation and/or proliferation in the presence of the CD96-binding agent, either in vitro or in vivo. T cell activation and/or proliferation can be measured by standard assays, as described e.g. in the examples below. For instance, T cell activation may be measured by the increased expression of a T cell activation marker, e.g. CD25, CD69, CD137 or CD107a, and T cell proliferation may be measured by the analysis of dye dilution in dividing T cells previously labelled with a fluorescent dye, e.g. CFSE. In some embodiments the T cells may be e.g. helper or cytotoxic T cells (CD4+ or CD8+ T cells).
[0059] The increased activation and/or proliferation of T cells may occur either in the presence of the CD96-binding agent alone, as for example in an in vivo tumor environment, or in the presence of the CD96-binding agent in combination with a further agent. For instance, in one embodiment the CD96-binding agent co-stimulates T cell activation/proliferation, i.e. the CD96-binding agent stimulates T cell activation and/or proliferation in combination with a further agent (a T cell co-stimulatory agent).
[0060] Preferably T cell activation and/or proliferation (e.g. as determined by expression of a T cell activation marker and/or fluorescent dye dilution) is increased by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 75% or at least 100% in the presence of the CD96 binding agent (e.g. in the presence of the CD96-binding agent and T cell co-stimulatory agent), as compared to T cell activation and/or proliferation in the absence of the CD96-binding agent (e.g. in the presence of a T cell co-stimulatory agent alone). Preferably the CD96-binding agent stimulates T cell activation and/or proliferation with an EC50 value of less than 100 nM, less than 10 nM, less than 5 nM or less than 1 nM.
[0061] In a preferred embodiment, the CD96-binding agent is a CD96 agonist. A CD96 agonist is an agent which binds to CD96 (preferably human CD96) and stimulates signaling via CD96, thereby promoting T cell activation and/or proliferation. For instance, the agonist may bind to CD96 and produce a conformational change in the CD96 protein, thereby promoting intracellular signaling via CD96. In some embodiments, the CD96-binding agent may induce dimerization or multimerization of CD96, e.g. binding of the agent to CD96 may result in association of CD96 into homodimers or multimers, or association of CD96 into heterodimers or multimers in combination with a further cell surface protein such as CD226. Dimerization or multimerization of CD96 may be detected using standard techniques, e.g. using fluorescence resonance energy transfer (FRET) as described in the examples below.
[0062] In some embodiments, the CD96-binding agent is an antibody, preferably a monoclonal antibody. In one aspect, the present invention is directed to mouse, chimeric, humanized or fully human monoclonal antibodies capable of binding specifically to CD96, and cell lines that produce such antibodies.
[0063] In some other aspects, the CD96-binding agent is an antibody mimetic or an antibody mimetic fragment. Antibody mimetics are organic compounds or scaffold proteins that can specifically bind to various antigens. Examples of antibody mimetics include affibody molecules, affilins, affimers, affitins, alphabodies, anticalins, avimers, DARPins, fynomers, monobodies, aptamers, beta-hairpin mimetics, non-immunoglobulin scaffolds, or fusion proteins.
[0064] The term “antibody” is used in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multi-specific antibodies (e.g., bi-specific antibodies), and antibody fragments so long as they exhibit the desired biological activity. “Antibodies” (Abs) and “immunoglobulins” (Igs) are glycoproteins having the same structural characteristics. While antibodies exhibit binding specificity to a specific antigen, immunoglobulins include both antibodies and other antibody-like molecules which lack antigen specificity. Polypeptides of the latter kind are, for example, produced at low levels by the lymph system and at increased levels by myelomas.
[0065] As used in this invention, the term “epitope” means any antigenic determinant on an antigen to which the paratope of an antibody binds. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
[0066] “Native antibodies and immunoglobulins” are usually heterotetrameric glycoproteins of about 150,000 dalton, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies between the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains. Each light chain has a variable domain at one end (VL) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light- and heavy-chain variable domains (Chothia C, Novotny J, Bruccoleri R, and Karplus M, Domain association in immunoglobulin molecules. The packing of variable domains, J Mol. Biol. 186:651-63 (1985); Novotny J and Haber E., Structural invariants of antigen binding: comparison of immunoglobulin VL-VH and VL-VL domain dimers., Proc. Natl. Acad. Sci. U.S.A. 82: 4592-96 (1985)).
[0067] The term “variable” refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called complementarity-determining regions (CDRs) or hypervariable regions both in the light-chain and the heavy-chain variable domains. The more highly conserved portions of variable domains are called the framework (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a β-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the β-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (for KABAT annotation see Kabat E. A. Sequences of Proteins of Immunological Interest, Fifth Edition, National Institutes of Health, Bethesda, Md. (1991) or for IMGT annotation, see http://www.imgt.org). The constant domains are not involved directly in the binding of an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity (ADCC).
[0068] Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual “Fc” fragment, whose name reflects its ability to crystallize readily. Pepsin treatment yields an F(ab′)2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
[0069] “Fv” is the minimum antibody fragment which contains a complete antigen recognition and binding site. In a two-chain Fv species, this region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. In a single-chain Fv species (scFv), one heavy- and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a “dimeric” structure analogous to that of a two-chain Fv species. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site. For a review of scFv, see Plückthun A. Antibodies from Escherichia coli, in “The Pharmacology of Monoclonal Antibodies”, by Rosenburg and Moore eds., Springer-Verlag, New York, vol. 113, pp. 269-315 (1994).
[0070] The Fab fragment also contains the constant domain of the light chain and the first constant domain of the heavy chain. Fab′ fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region. Fab′-SH is the designation herein for Fab′ in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab′)2 antibody fragments originally were produced as pairs of Fab′ fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
[0071] There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes), e.g., IgG1, lgG2, lgG3, lgG4, IgA1, and lgA2. The heavy-chain constant domains that correspond to the different classes of immunoglobulins are called α, δ, ε, γ, and μ, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
[0072] “Antibody fragment”, and all grammatical variants thereof, as used herein are defined as a portion of an intact antibody comprising the antigen binding site or variable region of the intact antibody, wherein the portion is free of the constant heavy chain domains (i.e. CH2, CH3, and CH4, depending on antibody isotype) of the Fc region of the intact antibody. Examples of antibody fragments include Fab, Fab′, Fab′-SH, F(ab′)2, and Fv fragments; diabodies; any antibody fragment that is a polypeptide having a primary structure consisting of one uninterrupted sequence of contiguous amino acid residues (referred to herein as a “single-chain antibody fragment” or “single chain polypeptide”), including without limitation (1) single-chain Fv (scFv) molecules (2) single chain polypeptides containing only one light chain variable domain, or a fragment thereof that contains the three CDRs of the light chain variable domain, without an associated heavy chain moiety and (3) single chain polypeptides containing only one heavy chain variable region, or a fragment thereof containing the three CDRs of the heavy chain variable region, without an associated light chain moiety; and multispecific or multivalent structures formed from antibody fragments. In an antibody fragment comprising one or more heavy chains, the heavy chain(s) can contain any constant domain sequence (e.g. CH1 in the IgG isotype) found in a non-Fc region of an intact antibody, and/or can contain any hinge region sequence found in an intact antibody, and/or can contain a leucine zipper sequence fused to or situated in the hinge region sequence or the constant domain sequence of the heavy chain(s).
[0073] The term “monoclonal antibody” (mAb) as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Each mAb is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they can be synthesized by hybridoma culture or mammalian cell lines, uncontaminated by other immunoglobulins. The modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made in an immortalized B cell or hybridoma thereof or may be made by recombinant DNA methods.
[0074] The monoclonal antibodies herein include hybrid and recombinant antibodies produced by splicing a variable (including hypervariable) domain of an anti-CD96 antibody with a constant domain (e.g. “humanized” antibodies), or a light chain with a heavy chain, or a chain from one species with a chain from another species, or fusions with heterologous proteins, regardless of species of origin or immunoglobulin class or subclass designation, as well as antibody fragments (e.g., Fab, F(ab′)2, and Fv), so long as they exhibit the desired biological activity.
[0075] The monoclonal antibodies herein specifically include “chimeric” antibodies (immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
[0076] The CD96-binding agents (e.g. antibodies) of the present invention may be used in isolated form. An “isolated” antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. In some embodiments, the antibody will be purified (1) to greater than 75% by weight of antibody as determined by the Lowry method, and most preferably more than 80%, 90% or 99% by weight, or (2) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain. Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
[0077] In one aspect, the present invention provides mouse and chimeric or humanized mouse-human monoclonal antibodies binding to human CD96 with a dissociation constant (K.sub.D) in the range from 0.01 to 50 nM, e.g. 0.18 to 42.3 nM. Some of the antibodies co-stimulate the activation and the proliferation of human CD4+ and CD8+ T cells. These agonistic antibodies find use for stimulating immune responses in patients with cancer or infectious diseases. Some of the disclosed antibodies disrupt or inhibit the CD96-CD155 interaction and could have a functional role in the regulation of T cell function.
[0078] Anti-human CD96 (hCD96) antibodies were generated by immunization of mice upon priming with the DNA coding for hCD96 and boosting with a cell line displaying the human CD96. B cells isolated from spleens and lymph nodes were then screened by ISAAC (ImmunoSpot Array Assay on Chip) to isolate a large panel of antibodies binding to hCD96. Thanks to the large diversity of antibodies generated, anti-hCD96 candidates with novel biological activities not previously disclosed were identified.
[0079] Nineteen anti-human CD96 antibodies have been produced and characterized in vitro. Nine candidates strongly inhibited the interaction between CD96 and CD155 with an IC50 in the range of 5.92 to 19.42 nM and with maximal inhibition capacity of 98 to 100%. Three mAbs including candidate BL006-4-20 inhibited CD96/CD155 interaction with a lower maximal inhibition capacity inferior to 50% (partial inhibitors).
[0080] Anti-CD96 candidates with strong co-stimulating activity on human CD4+ and CD8+ T cell activation and proliferation were identified. Thirteen candidates (see Table 4) displayed co-stimulation of peripheral blood T cells activated with sub-optimal concentrations of anti-CD3 antibody OKT3. Of importance, the benchmark anti-hCD96 NK92.39 antibody used by other groups (Fuchs et al., 2004; WO2015024060) did not show significant co-stimulating activity in the same in vitro assays.
[0081] Some of the anti-CD96 antibodies of the invention bind to human and rhesus CD96, while others are restricted to human. Cross-reactivity represents an advantage in terms of preclinical development, e.g. the ability to undergo efficacy and safety testing in the same model.
[0082] Thus, novel antibodies with specific activating activity on human CD96-expressing T cells have been identified in the present invention. These antibodies can, therefore, be used as therapeutics to stimulate T cell responses either alone or in combination with checkpoint inhibitors or other therapeutic drugs to treat cancer.
TABLE-US-00001 TABLE 1 Selected candidates with candidate no, antibody name, variable region of heavy chain (VH) SEQ ID NOs and variable region of light chain (VL) SEQ ID NOs: Variable Variable Region of Region of Heavy chain Light Chain (herein also (herein also referred to referred to Candidate as “VH”) as “VL”) NO Antibody name SEQ ID NO SEQ ID NO 1 BL006-4-20G5-20K5 229 230 2 BL006-4-52G6-52K7 231 232 3 BL006-4-61G5-61K1 233 234 4 BL006-8-3G9-3K4 235 236 5 BL006-11-5G1-5K3 237 238 6 BL006-19-14G3-14K1 239 240 7 BL006-19-134G5-134K4 241 242 8 BL006-19-183G3-183K4 243 244 9 BL006-2-19G13-19K15 245 246 10 BL006-4-31G1-31K3 247 248 11 BL006-9-1G1-1K1 249 250 12 BL006-9-15G1-15K5 251 252 13 BL006-19-21G1-21K1 253 254 14 BL006-19-29G5-29K1 255 256 15 BL006-19-55G10-55K7 257 258 16 BL006-19-190G4-190K6 259 260 17 BL006-19-352G9-352K8 261 262 18 BL006-19-363G1-363K1 263 264 19 BL006-19-370G9-370K16 265 266
TABLE-US-00002 TABLE 2 Selected candidates with candidate no, antibody name, CDRs of heavy chain (VH) SEQ ID NOs and CDRs of light chain (VL) SEQ ID NOs (RABAT annotations): SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID NO of NO of NO of NO of NO of NO of CDR1 of CDR2 of CDR3 of CDR1 of CDR2 of CDR3 of NO Antibody name VH VH VH VL VL VL 1 BL006-4-20G5-20K5 #1 1 2 3 7 8 9 2 BL006-4-52G6-52K7 #4 13 14 15 19 20 21 3 BL006-4-61G5-61K1 #7 25 26 27 31 32 33 4 BL006-8-3G9-3K4 #6 37 38 39 43 44 45 5 BL006-11-5G1-5K3 #5 49 50 51 55 56 57 6 BL006-19-14G3-14K1 #8 61 62 63 67 68 69 7 BL006-19-134G5-134K4 #2 73 74 75 79 80 81 8 BL006-19-183G3-183K4 #3 85 86 87 91 92 93 9 BL006-2-19G13-19K15 97 98 99 103 104 105 10 BL006-4-31G1-31K3 109 110 111 115 116 117 11 BL006-9-1G1-1K1 121 122 123 127 128 129 12 BL006-9-15G1-15K5 133 134 135 139 140 141 13 BL006-19-21G1-21K1 145 146 147 151 152 153 14 BL006-19-29G5-29K1 157 158 159 163 164 165 15 BL006-19-55G10-55K7: 169 170 171 175 176 177 16 BL006-19-190G4-190K6 181 182 183 187 188 189 17 BL006-19-352G9-352K8 193 194 195 199 200 201 18 BL006-19-363G1-363K1 205 206 207 211 212 213 19 BL006-19-370G9-370K16 217 218 219 223 224 225
TABLE-US-00003 TABLE 3 Selected candidates with candidate no, antibody name, CDRs of heavy chain (VH) SEQ ID NOs and CDRs of light chain (VL) SEQ ID NOs (IMGT annotations): SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID NO of NO of NO of NO of NO of NO of CDR1 of CDR2 of CDR3 of CDR1 of CDR2 of CDR3 of NO Antibody name VH VH VH VL VL VL 1 BL006-4-20G5-20K5 #1 4 5 6 10 11 12 2 BL006-4-52G6-52K7 #4 16 17 18 22 23 24 3 BL006-4-61G5-61K1 #7 28 29 30 34 35 36 4 BL006-8-3G9-3K4 #6 40 41 42 46 47 48 5 BL006-11-5G1-5K3 #5 52 53 54 58 59 60 6 BL006-19-14G3-14K1 #8 64 65 66 70 71 72 7 BL006-19-134G5-134K4 #2 76 77 78 82 83 84 8 BL006-19-183G3-183K4 #3 88 89 90 94 95 96 9 BL006-2-19G13-19K15 100 101 102 106 107 108 10 BL006-4-31G1-31K3 112 113 114 118 119 120 11 BL006-9-1G1-1K1 124 125 126 130 131 132 12 BL006-9-15G1-15K5 136 137 138 142 143 144 13 BL006-19-21G1-21K1 148 149 150 154 155 156 14 BL006-19-29G5-29K1 160 161 162 166 167 168 15 BL006-19-55G10-55K7: 172 173 174 178 179 180 16 BL006-19-190G4-190K6 184 185 186 190 191 192 17 BL006-19-352G9-352K8 196 197 198 202 203 204 18 BL006-19-363G1-363K1 208 209 210 214 215 216 19 BL006-19-370G9-370K16 220 221 222 226 227 228
[0083] The antibodies of the invention may have at least one of the following characteristics: stimulation (including co-stimulation) of T cell activation and/or proliferation, binding to (e.g. human or rhesus) CD96, agonism of (e.g. human) CD96, induction of dimerization or multimerization on (e.g. human) CD96 on T cells, inhibition of binding of (e.g. human) CD155 to CD96, and inhibition of tumor growth, e.g. in xenograft mouse models.
[0084] In the following paragraphs, the candidate antibodies are referred to by the names given in Table 1 to 3 which in some cases may be abbreviated for convenience, e.g. BL006-4-31G1-31K3 may be referred to as BL006-4-31, BL006-19-183G3-183K4 may be referred to as BL006-19-183 and so on. In some embodiments, the antibody is one of the candidates described in Tables 1 to 3 or a variant thereof, e.g. an antibody comprising one or more CDR sequences or variable regions from one of the above antibodies.
[0085] In a preferred embodiment, the antibody has a high affinity for binding to human CD96. For instance, in one embodiment the antibody binds to human CD96 (e.g. variant 2, short isoform, SEQ ID NO: 268) e.g. with an EC50 value of less than 10 nM. The EC50 value may, for example be determined by flow cytometry analysis on CHO cells transfected with human CD96 variant 2. 11 candidates were found to bind strongly to CD96 (BL006-4-31, BL006-19-183, BL006-19-190, BL006-19-134, BL006-19-21, BL006-19-55, BL006-19-352, BL006-19-363, BL006-19-370, BL006-19-14, BL006-19-29). Thus, in some embodiments, the antibody is one of the above candidates or a variant thereof, e.g. an antibody comprising one or more CDR sequences or variable regions from one of the above antibodies. Preferred antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID NO:s: 109-120, 247, 248 (BL006-4-31); 85-96, 243, 244 (BL006-19-183); 181-192, 259, 260 (BL006-19-190); 73-84, 241, 242 (BL006-19-134); 145-156, 253, 254 (BL006-19-21); 169-180, 257, 258 (BL006-19-55); 193-204, 261, 262 (BL006-19-352); 205-216, 263, 264 (BL006-19-363); 217-228, 265, 266 (BL006-19-370); 61-72, 239, 240 (BL006-19-14); and 157-168, 255, 256 (BL006-19-29).
[0086] In another embodiment, the antibody has a high affinity for the long form of human CD96, i.e. variant 1, SEQ ID NO: 267, e.g. the antibody binds with an EC50 value of less than 10 nM determined by flow cytometry analysis on CHO cells transfected with human CD96 variant 1. 8 candidates were also found to strongly bind to the long form of human CD96 (CD96v1) (BL006-19-183, BL006-19-14, BL006-19-29, BL006-2-19, BL006-11-5, BL006-4-61, BL006-9-1, BL006-8-3, BL006-9-15). Thus, in some embodiments, the antibody is one of the above candidates or a variant thereof, e.g. an antibody comprising one or more CDR sequences or variable regions from one of the above antibodies. Preferred antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID NO:s: 85-96, 243, 244 (BL006-19-183); 61-72, 239, 240 (BL006-19-14); 157-168, 255, 256 (BL006-19-29); 97-108, 245, 246 (BL006-2-19); 49-60, 237, 238 (BL006-11-5); 25-36, 233, 234 (BL006-4-61); 121-132, 249, 250 (BL006-9-1); 37-48, 235, 236 (BL006-8-3); 133-144, 251, 252 (BL006-9-15).
[0087] In another embodiment, the antibody binds strongly to human T cells and/or NK cells. Thus, in some embodiments, the antibody is one of the above candidates or a variant thereof, e.g. an antibody comprising one or more CDR sequences or variable regions from one of the above antibodies. Preferred antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected SEQ ID NO:s: 1-12, 229, 230 (BL006-4-20G5), 13-24, 231, 232 (BL006-4-52G6), 109-120, 247, 248 (BL006-4-31); 85-96, 243, 244 (BL006-19-183); 181-192, 259, 260 (BL006-19-190); 73-84, 241, 242 (BL006-19-134); 145-156, 253, 254 (BL006-19-21); 169-180, 257, 258 (BL006-19-55); 193-204, 261, 262 (BL006-19-352); 205-216, 263, 264 (BL006-19-363); 217-228, 265, 266 (BL006-19-370); 61-72, 239, 240 (BL006-19-14); and 157-168, 255, 256 (BL006-19-29).
[0088] In another embodiment, the antibody has a high affinity for rhesus CD96, e.g. the antibody binds with an EC50 value of less than 10 nM determined by flow cytometry analysis in CHO cells transfected with rhesus CD96 (SEQ ID NO: 272). 8 antibodies strongly recognized rhesus CD96 (BL006-4-31, BL006-19-352, BL006-19-14, BL006-19-29, BL006-4-52, BL006-2-19, BL006-4-61, BL006-9-1). Thus, in some embodiments, the antibody is one of the above candidates or a variant thereof, e.g. an antibody comprising one or more CDR sequences or variable regions from one of the above antibodies. Preferred antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID NO:s: 109-120, 247, 248 (BL006-4-31); 193-204, 261, 262 (BL006-19-352); 61-72, 239, 240 (BL006-19-14); 157-168, 255, 256 (BL006-19-29); 13-24, 231, 232 (BL006-4-52); 97-108, 245, 246 (BL006-2-19); 25-36, 233, 234 (BL006-4-61); 121-132, 249, 250 (BL006-9-1).
[0089] Thus, in preferred embodiments, the antibody binds to one or more forms of CD96, e.g. to human CD96 variants 1 and 2 or to human CD96 and rhesus CD96. Preferred antibodies that cross-react with human and rhesus CD96 comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID NOs: 61-72, 239, 240 (BL006-19-14); 109-120, 247, 248 (BL006-4-31); 157-168, 255, 256 (BL006-19-29); and 193-204, 261, 262 (BL006-19-352).
[0090] In another embodiment, the antibody inhibits the binding of CD155 to CD96. For instance, the antibody may inhibit the binding of hCD155 to hCD96v2 expressed on CHO cells, as determined by flow cytometry, with an IC50 value of less than 20 nM. 9 candidates strongly inhibited the binding of hCD155 to hCD96v2 with IC50 values ranging from 5.9 to 19.4 nM (candidates BL006-4-31, BL006-19-21, BL006-19-183, BL006-19-190, BL006-19-134, BL006-19-55, BL006-19-352, BL006-19-363, BL006-19-370). Those 9 anti-CD96 candidates were similar to the clone 628211 and NK92.39 antibodies in this assay. Thus, in some embodiments, the antibody is one of the above candidates or a variant thereof, e.g. an antibody comprising one or more CDR sequences or variable regions from one of the above antibodies. Preferred antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID NO:s: 109-120, 247, 248 (BL006-4-31); 145-156, 253, 254 (BL006-19-21); 85-96, 243, 244 (BL006-19-183); 181-192, 259, 260 (BL006-19-190); 73-84, 241, 242 (BL006-19-134); 169-180, 257, 258 (BL006-19-55); 193-204, 261, 262 (BL006-19-352); 205-216, 263, 264 (BL006-19-363); 217-228, 265, 266 (BL006-19-370).
[0091] In an alternative embodiment, the antibody partially inhibits the binding of CD155 to CD96. By “partially inhibits” or “partial inhibitor” it is meant that the antibody inhibits less than 100% of the available CD155/CD96 binding sites at an excess concentration of antibody, e.g. the antibody maximally inhibits less than 95%, less than 90%, less than 80%, less than 70%, less than 60% or less than 50% of CD155/CD96 binding. For instance, 3 candidates (BL006-4-20, BL006-19-14 and BL006-19-29) were found to be partial inhibitors of CD155 binding to CD96, with a maximal inhibition capacity inferior to 50%, but with a relative IC50 value between 2.67 and 5.24 nM. Thus, in some embodiments, the antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID NOs: 1-12, 229, 230 (BL006-4-20); 61-72, 239, 240 (BL006-19-14); and 157-168, 255, 256 (BL006-19-29).
[0092] In an alternative embodiment, the antibody does not inhibit the binding of CD155 to CD96. For instance, 6 candidates (BL006-4-52, BL006-4-61, BL006-11-5, BL006-8-3, BL006-9-1 and BL006-9-15) did not inhibit the CD96/CD155 interaction. Preferred antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID NOs: 13-24, 231, 232 (BL006-4-52); 25-36, 233, 234 (BL006-4-61); 49-60, 237, 238 (BL006-11-5); 37-48, 235, 236 (BL006-8-3); 121-132, 249, 250 (BL006-9-1) and 133-144, 251, 252 (BL006-9-15).
[0093] In another embodiment, the antibody does bind to the D1 domain of the CD96 protein. For instance, 1 candidate (BL006-19-183) binds to the D1 domain of CD96. Preferred antibody comprises one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID Nos: 85-96, 243, 244 (BL006-19-183).
[0094] In another embodiment, the antibody binds to the D1 and D2 domains of the CD96 protein. For instance, 9 candidates (BL006-4-31, BL006-4-20, BL006-19-190, BL006-19-21, BL006-19-55, BL006-19-370, BL006-19-363, BL006-19-352 and BL006-19-134) bind to the D1 and D2 domains of CD96. Preferred antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID Nos: 109-120, 247, 248 (BL006-4-31); 1-12, 229, 230 (BL006-4-20); 181-192, 259, 260 (BL006-19-190); 145-156, 253, 254 (BL006-19-21); 169-180, 257, 258 (BL006-19-55); 217-228, 265, 266 (BL006-19-370); 205-216, 263, 264 (BL006-19-363); 193-204, 261, 262 (BL006-19-352) and 73-84, 241, 242 (BL006-19-134).
[0095] In another embodiment, the antibody binds to the D2 and D3 domains of the CD96 protein. For instance, 2 candidates (BL006-19-14 and BL006-19-29) bind to the D2 and D3 domains of CD96. Preferred antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID Nos: 61-72, 239, 240 (BL006-19-14) and 157-168, 255, 256 (BL006-19-29).
[0096] In another embodiment, the antibody binds to the D3 domains of the CD96 protein. For instance, 2 candidates (BL006-4-52 and BL006-2-19) bind to the D3 domain of CD96. Preferred antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID Nos: 13-24, 231, 232 (BL006-4-52) and 97-108, 245, 246 (BL006-2-19).
[0097] In another embodiment, the antibody binds to the D4 domain of the CD96 protein. For instance, 5 candidates (BL006-4-61, BL006-8-3, BL006-9-1, BL006-9-15 and BL006-11-5) bind to the D4 domain of CD96, but did not show T cell activation or proliferation. Preferred antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID Nos: 25-36, 233, 234 (BL006-4-61); 37-48, 235, 236 (BL006-8-3); 121-132, 249, 250 (BL006-9-1); 133-144, 251, 252 (BL006-9-15) and 49-60, 237, 238 (BL006-11-5).
[0098] In another embodiment, the antibody according to anyone of the embodiments of the present invention is capable of co-activating the proliferation of T cells and bind an epitope either present in the D1 domain, or in the D1 and D2 domains, or in the D2 and D3 domains or in the D3 domain. For instance, such antibody may be capable of co-activating CD4+ and/or CD8+ T cells with a suboptimal concentration of a T cell stimulatory or proliferation agent, e.g. an anti-CD3 antibody. The percentage of activated cells may be measured e.g. by measuring increased expression of a T cell marker such as CD25, the dilution of CFSE staining and/or the incorporation of .sup.3[H]-thymidine that are correlated to the number of dividing cells. Preferably the co-stimulation activity of the antibody is observed at low concentrations of anti-CD3 antibody (e.g. 0.1 ng/ml or below). BL006-4-31, BL006-4-20, BL006-19-14, BL006-19-190, BL006-19-21, BL006-19-55, BL006-19-370, BL006-19-363, BL006-19-352, BL006-19-29, BL006-19-183, BL006-19-134, and BL006-4-52 were found to show T cell stimulatory activity. Thus, in some embodiments, the antibody is a chimeric, humanized or engineered version of one of the above candidate. In another embodiment, the antibody is used as a soluble form. Thus, in some embodiments, the antibody is one of the above candidates or a variant thereof, e.g. an antibody comprising one or more CDR sequences or variable regions from one of the above antibodies. Preferred antibodies comprise one or more CDR sequences (e.g. 3 heavy chain and 3 light chain CDR sequences) or a heavy and/or light chain variable domain selected from SEQ ID NO:s: 109-120, 247, 248 (BL006-4-31); 1-12, 229, 230 (BL006-4-20); 61-72, 239, 240 (BL006-19-14); 181-192, 259, 260 (BL006-19-190); 145-156, 253, 254 (BL006-19-21); 169-180, 257, 258 (BL006-19-55); 217-228, 265, 266 (BL006-19-370); 205-216, 263, 264 (BL006-19-363); 193-204, 261, 262 (BL006-19-352); 157-168, 255, 256 (BL006-19-29); 85-96, 243, 244 (BL006-19-183); 73-84, 241, 242 (BL006-19-134); and 13-24, 231, 232 (BL006-4-52).
[0099] Preferred candidates are one or more of the antibodies defined above, including humanized and further engineered antibodies derived therefrom. The CDRs (in KABAT- (Table 2) and IMGT- (Table 3) annotations) and variable regions (Table 1) of exemplary antibodies (referred herein usually by candidate NOs or antibody name) are provided (IMGT annotations preferred). Antibodies of interest include these provided combinations, as well as fusions of the variable regions to appropriate constant regions or fragments of constant regions, e.g. to generate F(ab)′ antibodies. Variable regions of interest include at least one CDR sequence of the provided anti-CD96 antibodies, where a CDR may be 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more amino acids. Alternatively, antibodies of interest include a variable region as set forth in the provided antibodies, or pairs of variable regions sequences as set forth herein. These antibodies may be full length antibodies, e.g. having a human immunoglobulin constant region of any isotype, e.g. lgG1, lgG2, lgG3, lgG4, IgA. Preferably the antibody is an IgG1, i.e. the antibody comprises a human IgG1 constant region such as e.g. a Fc part that enhances the agonism and other effector functions of the antibodies of the invention (Zhang D., Goldberg M. V. and Chiu M. L., Fc engineering approaches to enhance the agonism and effector functions of anti-OX40 antibody, The journal of biological chemistry, 291(53):27134-27146 (2016); Saxena A. and Wu, D., Advances in therapeutic Fc engineering—Modulation of IgG-associated effector functions and serum half-life, Frontiers in Immunology, 12(7):580 (2016)). Other preferred antibodies of the invention are antibodies conferring multimerization of the antibodies.
TABLE-US-00004 TABLE 4 Summary of anti-human CD96 candidate properties Binding to Binding to Binding to Inhibition of Binding to T cell hCD96 hCD96 rhesus CD96/CD155 human activation/ NO Antibody name short form long form CD96 interaction T cells proliferation 1 BL006-4-20G5-20K5 #1 + +/− − Yes, Partial ++ Yes 2 BL006-4-52G6-52K7 #4 + + ++ No + Yes 3 BL006-4-61G5-61K1 #7 + ++ ++ No + No 4 BL006-8-3G9-3K4 #6 + ++ − No + No 5 BL006-11-5G1-5K3 #5 + ++ − No +/− No 6 BL006-19-14G3-14K1 #8 ++ + ++ Yes, Partial ++ Yes 7 BL006-19-134G5-134K4 #2 ++ +/− − Yes ++ Yes 8 BL006-19-183G3-183K4 #3 ++ + − Yes ++ Yes 9 BL006-2-19G13-19K15 +/− ++ ++ nd + No 10 BL006-4-31G1-31K3 ++ + ++ Yes ++ Yes 11 BL006-9-1G1-1K1 + ++ ++ No Nd No 12 BL006-9-15G1-15K5 +/− ++ − No +/− No 13 BL006-19-21G1-21K1 ++ + + Yes ++ Yes 14 BL006-19-29G5-29K1 ++ + ++ Yes, Partial ++ Yes 15 BL006-19-55G10-55K7: ++ +/− + Yes ++ Yes 16 BL006-19-190G4-190K6 ++ +/− − Yes ++ Yes 17 BL006-19-352G9-352K8 ++ +/− ++ Yes ++ Yes 18 BL006-19-363G1-363K1 ++ +/− − Yes ++ Yes 19 BL006-19-370G9-370K16 ++ +/− − Yes ++ Yes −: no binding by FCM; +/−: weak binding by FCM; +: binding by FCM; ++ strong binding by FCM.
[0100] The CD96-binding agents (e.g. antibodies) may be coupled to a further active agent, e.g. in the form of a conjugate. The conjugate may be e.g. a heterogeneous molecule formed by the covalent attachment of one or more active agent (e.g. antibody fragment(s)) to one or more polymer molecule(s), wherein the heterogeneous molecule is water soluble, i.e. soluble in physiological fluids such as blood, and wherein the heterogeneous molecule is free of any structured aggregate. A conjugate of interest is PEG. In the context of the foregoing definition, the term “structured aggregate” refers to (1) any aggregate of molecules in aqueous solution having a spheroid or spheroid shell structure, such that the heterogeneous molecule is not in a micelle or other emulsion structure, and is not anchored to a lipid bilayer, vesicle or liposome; and (2) any aggregate of molecules in solid or insolubilized form, such as a chromatography bead matrix, that does not release the heterogeneous molecule into solution upon contact with an aqueous phase. Accordingly, the term “conjugate” as defined herein encompasses the aforementioned heterogeneous molecule in a precipitate, sediment, bio-erodible matrix or other solid capable of releasing the heterogeneous molecule into aqueous solution upon hydration of the solid.
[0101] The CD96-binding agent (e.g. antibody) may be epitope tagged. The term “epitope tagged” when used herein refers to an anti-CD96 antibody fused to an “epitope tag”. The epitope tag polypeptide has enough residues to provide an epitope against which an antibody can be made, yet is short enough such that it does not interfere with activity of the CD96 antibody. The epitope tag preferably is sufficiently unique so that the antibody specific for the epitope does not substantially cross-react with other epitopes. Suitable tag polypeptides generally have at least 6 amino acid residues and usually between about 8-50 amino acid residues (preferably between about 9-30 residues). Examples include the c-myc tag and the 8F9, 3C7, 6E10, G4, B7 and 9E10 antibodies thereto (Evan G. I., Lewis G. K., Ramsay G., et al. “Isolation of monoclonal antibodies specific for human c-myc proto-oncogene product”, Mol. Cell. Biol. 5(12):3610-3616 (1985)); and the Herpes Simplex virus glycoprotein D (gD) tag and its antibody (Paborsky L. R., Fendly B. M., Fisher K. L., et al. “Mammalian cell transient expression of tissue factor for the production of antigen”, Protein Engineering 3(6):547-553 (1990)).
[0102] Further labels may be attached to the CD96-binding agent. The word “label” when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to the agent (e.g. antibody). The label may itself be detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
[0103] In some embodiments, the CD96-binding agent may be attached to a solid phase. By “solid phase” is meant a non-aqueous matrix to which the agent (e.g. antibody) of the present invention can adhere. Examples of solid phases encompassed herein include those formed partially or entirely of glass (e.g. controlled pore glass), polysaccharides (e.g., agarose), polyacrylamides, polystyrene, polyvinyl alcohol and silicones. In certain embodiments, depending on the context, the solid phase can comprise the well of an assay plate; in others it is a purification column (e.g. an affinity chromatography column). This term also includes a discontinuous solid phase of discrete particles, such as those described in U.S. Pat. No. 4,275,149.
[0104] The CD96-binding agents (e.g. antibodies) disclosed herein can be used in the treatment of disease, particularly in mammals (e.g. humans). “Treatment” refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented. “Mammal” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, etc. Preferably, the mammal is a human.
[0105] The CD96-binding agents (e.g. monoclonal antibodies) of the invention can be used to promote T cell activation and/or proliferation, e.g. in the treatment of cancer and infectious diseases. For example, CD96-binding agent (e.g. antibody) compositions may be administered to increase T cell activation and/or proliferation in cancer immunotherapy.
[0106] In another embodiment, the anti-CD96 binding agent, may be used as an adjuvant to a prophylactic or therapeutic vaccine in order to further stimulate the T cell response to cancer or chronic infectious disease associated antigens. Examples of vaccines include but are not restricted to peptide vaccines, proteinous vaccines, viral-based vaccines, DNA-based vaccines, RNA-based vaccines, autologous dendritic cell-based vaccines, allogeneic tumor cell vaccines and dendritic-cell based vaccines (Melero et al. Therapeutic vaccines for cancer: an overview of clinical trials. Nature reviews. Clinical oncology. 11(9):509-524 (2014))
[0107] Pharmaceutical compositions for use in the treatment of cancer comprising the CD96-binding agent (e.g. a humanized or chimeric monoclonal antibody) of the invention and optionally pharmaceutically suitable excipients or carrier are also provided.
[0108] In a preferred embodiment, the CD96-binding agent (e.g. antibody) of the invention can be used in treating, delaying the progression of, preventing relapse of or alleviating a symptom of a cancer or other neoplastic condition, as a monotherapy, or in combinations with other anti-cancer agent(s) (combination therapy). As used herein, the terms “cancer” “neoplasm” and “tumor” are interchangeable. Examples of cancer include, without limitation, gastric cancer, breast cancer, lung cancer, ovarian cancer, cervical cancer, prostate cancer, bladder cancer, colorectal cancer, pancreatic cancer, liver cancer, renal cancer, thyroid cancer, brain cancer, head and neck cancer, hematological cancer, carcinoma, melanoma, leiomyoma, leiomyosarcoma, glioma, glioblastoma, etc. The “hematological cancer” refers to a cancer of the blood, and includes leukemia, lymphoma and myeloma among others. Solid tumors include, for example, gastric tumor, breast tumors, lung tumors, ovarian tumors, prostate tumors, bladder tumors, colorectal tumors, pancreatic tumors, liver tumors, kidney tumors, thyroid tumor, brain tumor, head and neck tumors, esophageal tumors and melanoma tumors, etc. Symptoms associated with cancers and other neoplastic disorders include, but are not limited to, inflammation, fever, general malaise, pain, loss of appetite, weight loss, edema, headache, fatigue, rash, anemia, muscle weakness and muscle fatigue.
[0109] The combination therapy can include one or more CD96-binding agents (e.g. antibodies) of the invention co-formulated with, and/or co-administered with, one or more additional therapeutic agents, e.g., chemotherapeutic or anti-neoplastic agents, such as cytokine and growth factor inhibitors, immunosuppressants, anti-inflammatory agents, metabolic inhibitors, enzyme inhibitors, and/or cytotoxic or cytostatic agents. The term “combination” in this context means that the agents are given substantially contemporaneously, either simultaneously or sequentially. Exemplary chemotherapeutic agents include, but are not limited to, aldesleukin, altretamine, amifostine, asparaginase, bleomycin, capecitabine, carboplatin, carmustine, cladribine, cisapride, cisplatin, cyclophosphamide, cytarabine, dacarbazine (DTIC), dactinomycin, docetaxel, doxorubicin, dronabinol, duocarmycin, etoposide, filgrastim, fludarabine, fluorouracil, gemcitabine, granisetron, hydroxyurea, idarubicin, ifosfamide, interferon alpha, irinotecan, lansoprazole, levamisole, leucovorin, megestrol, mesna, methotrexate, metoclopramide, mitomycin, mitotane, mitoxantrone, omeprazole, ondansetron, paclitaxel (Taxol™), pilocarpine, prochloroperazine, saproin, tamoxifen, taxol, topotecan hydrochloride, vinblastine, vincristine and vinorelbine tartrate.
[0110] The CD96-binding agents (e.g. antibodies) of the invention can be combined with an effective dose of an agent that increases patient hematocrit, for example erythropoietin stimulating agents (ESA). Such agents are known and used in the art, including, for example, Aranesp®, Epogen® NF/Procrit® NF, Omontys®, Procrit®, etc.
[0111] In other embodiments, the CD96-binding agents (e.g. antibodies) of the invention can be combined with an effective dose of other antibodies that have been used in treatment of cancer including, without limitation the following FDA approved monoclonal antibodies: rituximab (Rituxan®, CD20: chimeric IgG1), trastuzumab (Herceptin®, HER2: chimeric IgG1), alemtuzumab (Campath®, CD52: humanized IgG1), ibritumomab tiuxetan (Zevalin®, CD20: murine, IgG1, radiolabeled (Yttrium 90), tositumomab-I-131 (Bexxar®: CD20, murine, IgG2a, radiolabeled (Iodine 131)), cetuximab (Erbitux®, EGFR: chimeric, IgG1), bevacizumab (Avastin®, VEGF: humanized, IgG4), panitumumab (Vectibix®, EGFR: human IgG2), ofatumumab (Arzerra®, CD20: human IgG1), ipilimumab (Yervoy®, CTLA-4: human IgG1), brentuximab vedotin (Adcetris®, CD30: chimeric, IgG1, drug-conjugate), pertuzumab (Perjeta®, HER2: humanized IgG1), adotrastuzumab emtansine (Kadcyla®, HER2: humanized, IgG1, drug-conjugate), obinutuzumab (Gazyva®, CD20: humanized and glycol-engineered), nivolumab and pembrolizumab (anti-PD-1s), etc. Trastuzumab targets the HER-2 antigen. This antigen is seen on 25% to 35% of breast cancers and on metastatic gastric cancers. Trastuzumab is approved for the treatment of HER2-overexpressing breast cancers and for HER2-overexpressing metastatic gastric and gastroesophageal junction adenocarcinoma. Cetuximab is used for the treatment of metastatic colorectal cancer, metastatic non-small cell lung cancer and head and neck cancer. Nivolumab and pembrolizumab have been recently approved to treat metastatic melanoma and non-small cell lung cancer. They are tested in clinical trials for lung cancer, renal-cell cancer, lymphoma and mesothelioma. Other cancer drug that are currently tested in clinical trials or researched may also be combined.
[0112] In some embodiments, the anti-CD96 antibody may be used in combination with a T cell stimulating or proliferation agent, e.g. an anti-CD3 antibody. In some other embodiments, the anti-CD96 antibody may be used in combination with a T cell co-stimulatory agent, e.g. an agent that binds to a T cell co-stimulatory molecule such as CD28. For instance, the T cell co-stimulatory agent may be an anti-CD28, an anti-ICOS, an anti-CD226, an anti-CD40, an anti-OX40, an anti-CD137, an anti-GITR, or an anti-CD27 antibody.
[0113] In some embodiments, the anti-CD96 antibody may be combined with a checkpoint inhibitor. For instance, the checkpoint inhibitor may be an inhibitor of the programmed death-1 (PD-1) pathway, e.g. an anti-PD1 antibody such as nivolumab, atezolizumab, avelumab or pembrolizumab. In another embodiment, the checkpoint inhibitor is an anti-cytotoxic T-lymphocyte-associated antigen 4 (CTLA4) antibody, e.g. ipilimumab or tremelimumab.
[0114] Immune checkpoints are inhibitory pathways that slow down or stop immune reactions and prevent excessive tissue damage from uncontrolled activity of immune cells. By “checkpoint inhibitor” is meant to refer to any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragment thereof, that inhibits the inhibitory pathways, allowing more extensive immune activity. In certain embodiments, the checkpoint inhibitor is an inhibitor of the programmed death-1 (PD-1) pathway, for example an anti-PD1 antibody, such as, but not limited to nivolumab, atezolizumab, avelumab or pembrolizumab. In other embodiments, the checkpoint inhibitor is an anti-cytotoxic T-lymphocyte-associated antigen (CTLA-4) antibody. In additional embodiments, the checkpoint inhibitor is targeted at another member of the CD28/CTLA4 Ig superfamily such as BTLA, LAGS, ICOS, PDL1 or KIR (Page D. B., Postow M. A., Callahan M. K., Allison J. P. and Wolchok, J, Immune modulation in cancer with antibodies, Annual Review of Medicine, 65:185-202 (2014)). In further additional embodiments, the checkpoint inhibitor is targeted at a member of the TNFR superfamily such as CD40, OX40, 4-1BB, GITR, or CD27. In some cases, targeting a checkpoint inhibitor is accomplished with an inhibitory antibody or similar molecule. In other cases, it is accomplished with an agonist for the target; examples of this class include the stimulatory targets 4-1BB, OX40 and GITR.
[0115] Preferred combinations are combinations of a CD96 antibody of the invention and i) an immune check-point inhibitor or ii) an antibody against a tumor associated antigen. Exemplified combinations are herein described for Herceptin® and Erbitux®, wherein the combination with Herceptin® is preferred due to its additive, cooperative, or possibly synergistic effect. Other agents may also be useful to be combined.
[0116] The CD96-binding agents (e.g. monoclonal antibodies) of the invention may be used in vitro in immunoassays in which they can be utilized in liquid phase or bound to a solid phase carrier. In addition, the monoclonal antibodies in these immunoassays can be detectably labeled in various ways. Examples of types of immunoassays which can utilize monoclonal antibodies of the invention are flow cytometry, e.g. FACS, MACS, immunohistochemistry, competitive and non-competitive immunoassays in either direct or indirect formats; and the like. Detection of the antigens using the monoclonal antibodies of the invention can be done utilizing immunoassays which are run in either the forward, reverse, or simultaneous modes, including immunohistochemical assays on physiological samples. Those of skill in the art will know, or can readily discern, other immunoassay formats without undue experimentation.
[0117] The CD96-binding agents (e.g. monoclonal antibodies) of the invention can be bound to many different carriers and used to detect the presence of CD96-expressing cells. Examples of well-known carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses and magnetite. The nature of the carrier can be either soluble or insoluble for purposes of the invention. Those skilled in the art will know of other suitable carriers for binding monoclonal antibodies, or will be able to ascertain such, using routine experimentation.
[0118] There are many different labels and methods of labeling known to those of ordinary skill in the art, which find use as tracers in therapeutic methods, for use in diagnostic methods, and the like. For diagnostic purposes a label may be covalently or non-covalently attached to an antibody of the invention or a fragment thereof, including fragments consisting or comprising of CDR sequences. Examples of the types of labels which can be used in the present invention include enzymes, radioisotopes, fluorescent compounds, colloidal metals, chemiluminescent compounds, and bio-luminescent compounds. Those of ordinary skill in the art will know of other suitable labels for binding to the CD96-binding agents (e.g. monoclonal antibodies) of the invention, or will be able to ascertain such, using routine experimentation. Furthermore, the binding of these labels to the CD96-binding agents (e.g. monoclonal antibodies) of the invention can be done using standard techniques common to those of ordinary skill in the art.
[0119] In some embodiments CD96-binding agent (e.g. monoclonal antibody or a fragment thereof) is attached to a nanoparticle, e.g. for use in imaging. Useful nanoparticles are those known in the art, for example including without limitation, Raman-silica-gold-nanoparticles (R-Si-Au-NP). The R-Si-Au-NPs consist of a Raman organic molecule, with a narrow-band spectral signature, adsorbed onto a gold core. Because the Raman organic molecule can be changed, each nanoparticle can carry its own signature, thereby allowing multiple nanoparticles to be independently detected simultaneously by multiplexing. The entire nanoparticle is encapsulated in a silica shell to hold the Raman organic molecule on the gold nanocore. Optional polyethylene glycol (PEG)-ylation of R-Si-Au-NPs increases their bioavailability and provides functional “handles” for attaching targeting moieties (see Thakor A. S., Luong R., Paulmurugan R., et al. et al., The fate and toxicity of raman-active silica-gold nanoparticles in mice, Sci. Transl. Med. 3(79): 79ra33 (2011); Jokerst IV., Miao Z., Zavaleta C., Cheng Z., and Gambhir S. S., Affibody-functionalized gold-silica nanoparticles for raman molecular imaging of the epidermal growth factor receptor, Small. 7(5):625-633 (2011); Gao J., Chen K, Miao Z., Ren G., Chen X, Gambhir S. S. and Cheng Z., Affibody-based nanoprobes for HER2-expressing cell and tumor imaging, Biomaterials 32(8):2141-2148 (2011); each herein specifically incorporated by reference).
[0120] For purposes of the invention, CD96 may be detected by the CD96-binding agents (e.g. monoclonal antibodies) of the invention when present in biological fluids and on tissues, in vivo or in vitro. Any sample containing a detectable amount of CD96 can be used. A sample can be a liquid such as urine, saliva, cerebrospinal fluid, blood, serum and the like, or a solid or semi-solid such as tissues, feces, and the like, or, alternatively, a solid tissue such as those commonly used in histological diagnosis.
[0121] Another labeling technique which may result in greater sensitivity consists of coupling the antibodies to low molecular weight haptens. These haptens can then be specifically detected by means of a second reaction. For example, it is common to use haptens such as biotin, which reacts with avidin, or dinitrophenol, pyridoxal, or fluorescein, which can react with specific anti-hapten antibodies.
[0122] As a matter of convenience, the CD96-binding agent (e.g. antibody) of the present invention can be provided in a kit, i.e., a packaged combination of reagents in predetermined amounts with instructions for performing the diagnostic assay. Where the CD96-binding agent (e.g. antibody) is labeled with an enzyme, the kit will include substrates and cofactors required by the enzyme (e.g., a substrate precursor which provides the detectable chromophore or fluorophore). In addition, other additives may be included such as stabilizers, buffers (e.g., a block buffer or lysis buffer) and the like. The relative amounts of the various reagents may be varied widely to provide for concentrations in solution of the reagents which substantially optimize the sensitivity of the assay. Particularly, the reagents may be provided as dry powders, usually lyophilized, including excipients which on dissolution will provide a reagent solution having the appropriate concentration.
[0123] Therapeutic formulations comprising one or more CD96-binding agents (e.g. antibodies) of the invention are prepared for storage by mixing the CD96-binding agent (e.g. antibody) having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences, 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. The composition will be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners. The “therapeutically effective amount” of the CD96-binding agent (e.g. antibody) to be administered will be governed by such considerations, and is the minimum amount necessary to prevent the disease.
[0124] The therapeutic dose may be at least about 0.01 mg per kg body weight, at least about 0.05 mg per kg body weight; at least about 0.1 mg per kg body weight, at least about 0.5 mg per kg body weight, at least about 1 mg per kg body weight, at least about 2.5 mg per kg body weight, at least about 5 mg per kg body weight, at least about 10 mg per kg body weight, and not more than about 100 mg per kg body weight with a preference of 0.1 to 20 mg per kg body weight. It will be understood by one of skill in the art that such guidelines will be adjusted for the molecular weight of the active agent, e.g. in the use of antibody fragments, or in the use of antibody conjugates. The dosage may also be varied for localized administration, e.g. intranasal, inhalation, etc., or for systemic administration, e.g., i.m., i.p., i.v., s.c., and the like.
[0125] The CD96-binding agent (e.g. antibody) need not be, but is optionally formulated with one or more agents that potentiate activity, or that otherwise increase the therapeutic effect. These are generally used in the same dosages and with administration routes as used hereinbefore or about from 1 to 99% of the heretofore employed dosages.
[0126] Acceptable carriers, excipients, or stabilizers are non-toxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyidimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™, PLURONICS™ or polyethylene glycol (PEG). Formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
[0127] The active ingredients may also be entrapped in microcapsule prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsule and poly-(methylmethacylate) microcapsule, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences, 16th edition, Osol, A. Ed. (1980).
[0128] The CD96-binding agent (e.g. antibody) is administered by any suitable means, including parenteral, subcutaneous, intraperitoneal, intrapulmonary, and intranasal. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. In addition, the CD96-binding agent (e.g. antibody) is suitably administered by pulse infusion, particularly with declining doses of the agent.
[0129] For the prevention or treatment of disease, the appropriate dosage of CD96-binding agent (e.g. antibody) will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the agent is administered for preventive purposes, previous therapy, the patient's clinical history and response to the agent, and the discretion of the attending physician. The agent is suitably administered to the patient at one time or over a series of treatments.
[0130] In another embodiment of the invention, an article of manufacture containing materials useful for the treatment of the disorders described above is provided. The article of manufacture comprises a container and a label. Suitable containers include, for example, bottles, vials, syringes, and test tubes. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is effective for treating the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The active agent in the composition is the CD96-binding agent (e.g. antibody). The label on, or associated with, the container indicates that the composition is used for treating the condition of choice. The article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as phosphate-buffered saline, Ringer's solution and/or dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
[0131] The invention now being fully described, it will be apparent to one of ordinary skill in the art that various changes and modifications can be made without departing from the spirit or scope of the invention.
TABLE-US-00005 TABLE 5 Overview of Seq Id numbers. When indicated, X indicates ‘any’ amino acid, or X can be absent. Seq ID NO Name Sequence 1 BL006-4-20G5-20K5 heavy chain, CDR1-Kabat SYGMS 2 BL006-4-20G5-20K5 heavy chain, CDR2-Kabat TITHGGSYIYYPDSVKG 3 BL006-4-20G5-20K5 heavy chain, CDR3-Kabat HADYARFAY 4 BL006-4-20G5-20K5 heavy chain, CDR1-IMGT GFTFSSYG 5 BL006-4-20G5-20K5 heavy chain, CDR2-IMGT ITHGGSYI 6 BL006-4-20G5-20K5 heavy chain, CDR3-IMGT IRHADYARFAY 7 BL006-4-20G5-20K5 light chain, CDR1-Kabat RPSQDISNYLN 8 BL006-4-20G5-20K5 light chain, CDR2-Kabat YTSRLHS 9 BL006-4-20G5-20K5 light chain, CDR3-Kabat QQGNTLPWT 10 BL006-4-20G5-20K5 light chain, CDR1-IMGT QDISNY 11 BL006-4-20G5-20K5 light chain, CDR2-IMGT XYTS 12 BL006-4-20G5-20K5 light chain, CDR3-IMGT QQGNTLPWT 13 BL006-4-52G6-52K7 heavy chain, CDR1-Kabat SYWMH 14 BL006-4-52G6-52K7 heavy chain, CDR2-Kabat QIDPSDSYTNYNQKFKG 15 BL006-4-52G6-52K7 heavy chain, CDR3-Kabat GNYGPYLGNYFDY 16 BL006-4-52G6-52K7 heavy chain, CDR1-IMGT GYSFTSYW 17 BL006-4-52G6-52K7 heavy chain, CDR2-IMGT IDPSDSYT 18 BL006-4-52G6-52K7 heavy chain, CDR3-IMGT ASGNYGPYLGNYFDY 19 BL006-4-52G6-52K7 light chain, CDR1-Kabat KSSQSLLHSTNQKNYLA 20 BL006-4-52G6-52K7 light chain, CDR2-Kabat WASTRES 21 BL006-4-52G6-52K7 light chain, CDR3-Kabat QQYYNYPYT 22 BL006-4-52G6-52K7 light chain, CDR1-IMGT QSLLHSTNQKNY 23 BL006-4-52G6-52K7 light chain, CDR2-IMGT XWAS 24 BL006-4-52G6-52K7 light chain, CDR3-IMGT QQYYNYPYT 25 BL006-4-61G5-61K1 heavy chain, CDR1-Kabat NYWMN 26 BL006-4-61G5-61K1 heavy chain, CDR2-Kabat QIRFKSDNYATHYAESVKG 27 BL006-4-61G5-61K1 heavy chain, CDR3-Kabat XFAY 28 BL006-4-61G5-61K1 heavy chain, CDR1-IMGT GFTFSNYW 29 BL006-4-61G5-61K1 heavy chain, CDR2-IMGT IRFKSDNYAT 30 BL006-4-61G5-61K1 heavy chain, CDR3-IMGT TEFAY 31 BL006-4-61G5-61K1 light chain, CDR1-Kabat SASSRVNSRFLN 32 BL006-4-61G5-61K1 light chain, CDR2-Kabat GTSNLAS 33 BL006-4-61G5-61K1 light chain, CDR3-Kabat QQYQSDPPIT 34 BL006-4-61G5-61K1 light chain, CDR1-IMGT SRVNSRF 35 BL006-4-61G5-61K1 light chain, CDR2-IMGT XGTS 36 BL006-4-61G5-61K1 light chain, CDR3-IMGT QQYQSDPPIT 37 BL006-8-3G9-3K4 heavy chain, CDR1-Kabat DYEME 38 BL006-8-3G9-3K4 heavy chain, CDR2-Kabat AIDPETGGTAYNQKFKG 39 BL006-8-3G9-3K4 heavy chain, CDR3-Kabat EGDGSYGAY 40 BL006-8-3G9-3K4 heavy chain, CDR1-IMGT GYRFTDYE 41 BL006-8-3G9-3K4 heavy chain, CDR2-IMGT IDPETGGT 42 BL006-8-3G9-3K4 heavy chain, CDR3-IMGT TREGDGSYGAY 43 BL006-8-3G9-3K4 light chain, CDR1-Kabat RSSQSIVYSNGNTYLE 44 BL006-8-3G9-3K4 light chain, CDR2-Kabat KVSNRFS 45 BL006-8-3G9-3K4 light chain, CDR3-Kabat FQGSHAPWT 46 BL006-8-3G9-3K4 light chain, CDR1-IMGT QSIVYSNGNTY 47 BL006-8-3G9-3K4 light chain, CDR2-IMGT XKVS 48 BL006-8-3G9-3K4 light chain, CDR3-IMGT FQGSHAPWT 49 BL006-11-5G1-5K3 heavy chain, CDR1-Kabat SYAMS 50 BL006-11-5G1-5K3 heavy chain, CDR2-Kabat AINTDGASTYFPATVKD 51 BL006-11-5G1-5K3 heavy chain, CDR3-Kabat PLEPGSWFAY 52 BL006-11-5G1-5K3 heavy chain, CDR1-IMGT GFTFSSYA 53 BL006-11-5G1-5K3 heavy chain, CDR2-IMGT INTDGAST 54 BL006-11-5G1-5K3 heavy chain, CDR3-IMGT ARPLEPGSWFAY 55 BL006-11-5G1-5K3 light chain, CDRl-Kabat RSSQSIVHSNGNTYLE 56 BL006-11-5G1-5K3 light chain, CDR2-Kabat KVSNRFS 57 BL006-11-5G1-5K3 light chain, CDR3-Kabat FQGSHVPYT 58 BL006-11-5G1-5K3 light chain, CDR1-IMGT QSIVHSNGNTY 59 BL006-11-5G1-5K3 light chain, CDR2-IMGT XKVS 60 BL006-11-5G1-5K3 light chain, CDR3-IMGT FQGSHVPYT 61 BL006-19-14G3-14K1 heavy chain, CDRl-Kabat TFGMGVG 62 BL006-19-14G3-14K1 heavy chain, CDR2-Kabat HIWWDDDKFYNPALKS 63 BL006-19-14G3-14K1 heavy chain, CDR3-Kabat YYGSLSFDV 64 BL006-19-14G3-14K1 heavy chain, CDR1-IMGT GFSLDTFGMG 65 BL006-19-14G3-14K1 heavy chain, CDR2-IMGT IWWDDDK 66 BL006-19-14G3-14K1 heavy chain, CDR3-IMGT AHYYGSLSFDV 67 BL006-19-14G3-14K1 light chain, CDRl-Kabat KSSQSLLDSDGKTYLN 68 BL006-19-14G3-14K1 light chain, CDR2-Kabat LVSKLDS 69 BL006-19-14G3-14K1 light chain, CDR3-Kabat LQATHFPWT 70 BL006-19-14G3-14K1 light chain, CDR1-IMGT QSLLDSDGKTY 71 BL006-19-14G3-14K1 light chain, CDR2-IMGT XLVS 72 BL006-19-14G3-14K1 light chain, CDR3-IMGT LQATHFPWT 73 BL006-19-134G5-134K4 heavy chain, CDRl-Kabat TYWMH 74 BL006-19-134G5-134K4 heavy chain, CDR2-Kabat MIHPNSDTTLYNEKFRS 75 BL006-19-134G5-134K4 heavy chain, CDR3-Kabat TGTNFDY 76 BL006-19-134G5-134K4 heavy chain, CDR1-IMGT DYTFTTYW 77 BL006-19-134G5-134K4 heavy chain, CDR2-IMGT IHPNSDTT 78 BL006-19-134G5-134K4 heavy chain, CDR3-IMGT VVTGTNFDY 79 BL006-19-134G5-134K4 light chain, CDRl-Kabat SATSSVSYMY 80 BL006-19-134G5-134K4 light chain, CDR2-Kabat RTSNLAS 81 BL006-19-134G5-134K4 light chain, CDR3-Kabat QQWSSNPLT 82 BL006-19-134G5-134K4 light chain, CDR1-IMGT SSVSY 83 BL006-19-134G5-134K4 light chain, CDR2-IMGT XRTS 84 BL006-19-134G5-134K4 light chain, CDR3-IMGT QQWSSNPLT 85 BL006-19-183G3-183K4 heavy chain, CDRl-Kabat TYGMGVG 86 BL006-19-183G3-183K4 heavy chain, CDR2-Kabat NIWWTEDKYYNSALKS 87 BL006-19-183G3-183K4 heavy chain, CDR3-Kabat MGPEVYSAMDY 88 BL006-19-183G3-183K4 heavy chain, CDR1-IMGT GFSLTTYGMG 89 BL006-19-183G3-183K4 heavy chain, CDR2-IMGT IWWTEDK 90 BL006-19-183G3-183K4 heavy chain, CDR3-IMGT AQMGPEVYSAMDY 91 BL006-19-183G3-183K4 light chain, CDRl-Kabat KASQNVGTAVA 92 BL006-19-183G3-183K4 light chain, CDR2-Kabat SASNRNT 93 BL006-19-183G3-183K4 light chain, CDR3-Kabat HQYSRYPWT 94 BL006-19-183G3-183K4 light chain, CDR1-IMGT QNVGTA 95 BL006-19-183G3-183K4 light chain, CDR2-IMGT XSAS 96 BL006-19-183G3-183K4 light chain, CDR3-IMGT HQYSRYPWT 97 BL006-2-19G13-19K15 heavy chain, CDRl-Kabat SYWMH 98 BL006-2-19G13-19K15 heavy chain, CDR2-Kabat SIYPGSGSTNYDEKFKR 99 BL006-2-19G13-19K15 heavy chain, CDR3-Kabat EMAY 100 BL006-2-19G13-19K15 heavy chain, CDR1-IMGT GYKFTSYW 101 BL006-2-19G13-19K15 heavy chain, CDR2-IMGT IYPGSGST 102 BL006-2-19G13-19K15 heavy chain, CDR3-IMGT TREMAY 103 BL006-2-19G13-19K15 light chain, CDRl-Kabat RSSKSLLYKDGKTYLN 104 BL006-2-19G13-19K15 light chain, CDR2-Kabat WMSTRAS 105 BL006-2-19G13-19K15 light chain, CDR3-Kabat QQVVEYPFT 106 BL006-2-19G13-19K15 light chain, CDR1-IMGT KSLLYKDGKTY 107 BL006-2-19G13-19K15 light chain, CDR2-IMGT XWMS 108 BL006-2-19G13-19K15 light chain, CDR3-IMGT QQVVEYPFT 109 BL006-4-31G1-31K3 heavy chain, CDR1-Kabat DYYIN 110 BL006-4-31G1-31K3 heavy chain, CDR2-Kabat WIFPGSGSSFYSEIFKG 111 BL006-4-31G1-31K3 heavy chain, CDR3-Kabat RNYYGYGAYAMDY 112 BL006-4-31G1-31K3 heavy chain, CDR1-IMGT GFTFTDYY 113 BL006-4-31G1-31K3 heavy chain, CDR2-IMGT IFPGSGSS 114 BL006-4-31G1-31K3 heavy chain, CDR3-IMGT ARRNYYGYGAYAMDY 115 BL006-4-31G1-31K3 light chain, CDR1-Kabat RASQSINFWLS 116 BL006-4-31G1-31K3 light chain, CDR2-Kabat KASNLHT 117 BL006-4-31G1-31K3 light chain, CDR3-Kabat LQGQSYPLT 118 BL006-4-31G1-31K3 light chain, CDR1-IMGT QSINFW 119 BL006-4-31G1-31K3 light chain, CDR2-IMGT XYTS 120 BL006-4-31G1-31K3 light chain, CDR3-IMGT LQGQSYPLT 121 BL006-9-1G1-1K1 heavy chain, CDR1-Kabat SYAMS 122 BL006-9-1G1-1K1 heavy chain, CDR2-Kabat AIQSNGGSTFYPDTVKD 123 BL006-9-1G1-1K1 heavy chain, CDR3-Kabat GPFDY 124 BL006-9-1G1-1K1 heavy chain, CDR1-IMGT GFTFSSYA 125 BL006-9-1G1-1K1 heavy chain, CDR2-IMGT IQSNGGST 126 BL006-9-1G1-1K1 heavy chain, CDR3-IMGT VRGPFDY 127 BL006-9-1G1-1K1 light chain, CDR1-Kabat SASSSVNYIH 128 BL006-9-1G1-1K1 light chain, CDR2-Kabat DTSKLTP 129 BL006-9-1G1-1K1 light chain, CDR3-Kabat HQWRSYPPT 130 BL006-9-1G1-1K1 light chain, CDR1-IMGT SSVNY 131 BL006-9-1G1-1K1 light chain, CDR2-IMGT XDTS 132 BL006-9-1G1-1K1 light chain, CDR3-IMGT HQWRSYPPT 133 BL006-9-15G1-15K5 heavy chain, CDR1-Kabat SYNMH 134 BL006-9-15G1-15K5 heavy chain, CDR2-Kabat AVIPGNGDSFYNQKFKG 135 BL006-9-15G1-15K5 heavy chain, CDR3-Kabat SSSGCIAY 136 BL006-9-15G1-15K5 heavy chain, CDR1-IMGT GYTFTSYN 137 BL006-9-15G1-15K5 heavy chain, CDR2-IMGT VIPGNGDS 138 BL006-9-15G1-15K5 heavy chain, CDR3-IMGT RSSSGCIAY 139 BL006-9-15G1-15K5 light chain, CDR1-Kabat RVSGSVDYDGDSYMN 140 BL006-9-15G1-15K5 light chain, CDR2-Kabat AASNLES 141 BL006-9-15G1-15K5 light chain, CDR3-Kabat LQSNEAPWT 142 BL006-9-15G1-15K5 light chain, CDR1-IMGT GSVDYDGDSY 143 BL006-9-15G1-15K5 light chain, CDR2-IMGT XAAS 144 BL006-9-15G1-15K5 light chain, CDR3-IMGT LQSNEAPWT 145 BL006-19-21G1-21K1 heavy chain, CDR1-Kabat SYWIT 146 BL006-19-21G1-21K1 heavy chain, CDR2-Kabat DIYPGSGHTNYNEKFKS 147 BL006-19-21G1-21K1 heavy chain, CDR3-Kabat PTVEAMDY 148 BL006-19-21G1-21K1 heavy chain, CDR1-IMGT GYTFISYW 149 BL006-19-21G1-21K1 heavy chain, CDR2-IMGT IYPGSGHT 150 BL006-19-21G1-21K1 heavy chain, CDR3-IMGT ARPTVEAMDY 151 BL006-19-21G1-21K1 light chain, CDR1-Kabat SASSSVNYMH 152 BL006-19-21G1-21K1 light chain, CDR2-Kabat DTSKLAS 153 BL006-19-21G1-21K1 light chain, CDR3-Kabat QQWSNNPLT 154 BL006-19-21G1-21K1 light chain, CDR1-IMGT SSVNY 155 BL006-19-21G1-21K1 light chain, CDR2-IMGT XDTS 156 BL006-19-21G1-21K1 light chain, CDR3-IMGT QQWSNNPLT 157 BL006-19-29G5-29K1 heavy chain, CDR1-Kabat TFGMGVS 158 BL006-19-29G5-29K1 heavy chain, CDR2-Kabat HIFWDDDKRYNPSLKS 159 BL006-19-29G5-29K1 heavy chain, CDR3-Kabat GSNWFAY 160 BL006-19-29G5-29K1 heavy chain, CDR1-IMGT GFSLSTFGMG 161 BL006-19-29G5-29K1 heavy chain, CDR2-IMGT IFWDDDK 162 BL006-19-29G5-29K1 heavy chain, CDR3-IMGT TRGSNWFAY 163 BL006-19-29G5-29K1 light chain, CDR1-Kabat RASESVDSYGNSFMH 164 BL006-19-29G5-29K1 light chain, CDR2-Kabat RASNLES 165 BL006-19-29G5-29K1 light chain, CDR3-Kabat QQSNEDPLT 166 BL006-19-29G5-29K1 light chain, CDR1-IMGT ESVDSYGNSF 167 BL006-19-29G5-29K1 light chain, CDR2-IMGT XRAS 168 BL006-19-29G5-29K1 light chain, CDR3-IMGT QQSNEDPLT 169 BL006-19-55G10-55K7 heavy chain, CDR1-Kabat DNWID 170 BL006-19-55G10-55K7 heavy chain, CDR2-Kabat NIFPGGNYTNYNEKFKG 171 BL006-19-55G10-55K7 heavy chain, CDR3-Kabat AVADSQFAY 172 BL006-19-55G10-55K7 heavy chain, CDR1-IMGT GYTFTDNW 173 BL006-19-55G10-55K7 heavy chain, CDR2-IMGT IFPGGNYT 174 BL006-19-55G10-55K7 heavy chain, CDR3-IMGT VRAVADSQFAY 175 BL006-19-55G10-55K7 light chain, CDR1-Kabat SASSRVTYMY 176 BL006-19-55G10-55K7 light chain, CDR2-Kabat RTSNLAS 177 BL006-19-55G10-55K7 light chain, CDR3-Kabat QQWSSNPLT 178 BL006-19-55G10-55K7 light chain, CDR1-IMGT SRVTY 179 BL006-19-55G10-55K7 light chain, CDR2-IMGT XRTS 180 BL006-19-55G10-55K7 light chain, CDR3-IMGT QQWSSNPLT 181 BL006-19-190G4-190K6 heavy chain, CDR1-Kabat NYGMS 182 BL006-19-190G4-190K6 heavy chain, CDR2-Kabat TINSNGGSTYYPDSVKG 183 BL006-19-190G4-190K6 heavy chain, CDR3-Kabat RGAWYFDV 184 BL006-19-190G4-190K6 heavy chain, CDR1-IMGT GFTFSNYG 185 BL006-19-190G4-190K6 heavy chain, CDR2-IMGT INSNGGST 186 BL006-19-190G4-190K6 heavy chain, CDR3-IMGT KRGAWYFDV 187 BL006-19-190G4-190K6 light chain, CDR1-Kabat KASEDIYNRLA 188 BL006-19-190G4-190K6 light chain, CDR2-Kabat SATSLET 189 BL006-19-190G4-190K6 light chain, CDR3-Kabat QQYWTTPTWT 190 BL006-19-190G4-190K6 light chain, CDR1-IMGT EDIYNR 191 BL006-19-190G4-190K6 light chain, CDR2-IMGT XSAT 192 BL006-19-190G4-190K6 light chain, CDR3-IMGT QQYWTTPTWT 193 BL006-19-352G9-352K8 heavy chain, CDR1-Kabat SYWMH 194 BL006-19-352G9-352K8 heavy chain, CDR2-Kabat MIHPNGDITDYNEKFKS 195 BL006-19-352G9-352K8 heavy chain, CDR3-Kabat ASYYGSLY 196 BL006-19-352G9-352K8 heavy chain, CDR1-IMGT GYTFTSYW 197 BL006-19-352G9-352K8 heavy chain, CDR2-IMGT IHPNGDIT 198 BL006-19-352G9-352K8 heavy chain, CDR3-IMGT ARASYYGSLY 199 BL006-19-352G9-352K8 light chain, CDR1-Kabat KASQNVGIAVA 200 BL006-19-352G9-352K8 light chain, CDR2-Kabat SASTRYT 201 BL006-19-352G9-352K8 light chain, CDR3-Kabat QQYGSSPLT 202 BL006-19-352G9-352K8 light chain, CDR1-IMGT QNVGIA 203 BL006-19-352G9-352K8 light chain, CDR2-IMGT XSAS 204 BL006-19-352G9-352K8 light chain, CDR3-IMGT QQYGSSPLT 205 BL006-19-363G1-363K1 heavy chain, CDR1-Kabat TYWIH 206 BL006-19-363G1-363K1 heavy chain, CDR2-Kabat MILPNSGTTIYNEKFRS 207 BL006-19-363G1-363K1 heavy chain, CDR3-Kabat TGTNFDY 208 BL006-19-363G1-363K1 heavy chain, CDR1-IMGT GYTFTTYW 209 BL006-19-363G1-363K1 heavy chain, CDR2-IMGT ILPNSGTT 210 BL006-19-363G1-363K1 heavy chain, CDR3-IMGT AVTGTNFDY 211 BL006-19-363G1-363K1 light chain, CDR1-Kabat SASSSVSYMY 212 BL006-19-363G1-363K1 light chain, CDR2-Kabat RTSNLAS 213 BL006-19-363G1-363K1 light chain, CDR3-Kabat QQWSSNPLT 214 BL006-19-363G1-363K1 light chain, CDR1-IMGT SSVSY 215 BL006-19-363G1-363K1 light chain, CDR2-IMGT XRTS 216 BL006-19-363G1-363K1 light chain, CDR3-IMGT QQWSSNPLT 217 BL006-19-370G9-370K16 heavy chain, CDR1-Kabat NYWIG 218 BL006-19-370G9-370K16 heavy chain, CDR2-Kabat DIYPGGGYTNYNEKFKG 219 BL006-19-370G9-370K16 heavy chain, CDR3-Kabat SGYYDGSPLAMDY 220 BL006-19-370G9-370K16 heavy chain, CDR1-IMGT GYTFTNYW 221 BL006-19-370G9-370K16 heavy chain, CDR2-IMGT IYPGGGYT 222 BL006-19-370G9-370K16 heavy chain, CDR3-IMGT ARSGYYDGSPLAMDY 223 BL006-19-370G9-370K16 light chain, CDR1-Kabat SASSSVSYMH 224 BL006-19-370G9-370K16 light chain, CDR2-Kabat DTSKLAS 225 BL006-19-370G9-370K16 light chain, CDR3-Kabat QQWSSNPPT 226 BL006-19-370G9-370K16 light chain, CDR1-IMGT SSVSY 227 BL006-19-370G9-370K16 light chain, CDR2-IMGT XDTS 228 BL006-19-370G9-370K16 light chain, CDR3-IMGT QQWSSNPPT 229 BL006-4-20G5-20K5 variable region heavy chain EVQLAESGGDLVTPGGSLKLSCAASGFTFSSYGM SWVRQTPDKRLEWVATITHGGSYIYYPDSVKGR FTLSRDNAKNTLYLQMSSLKSEDTAMYYCIRHA DYARFAYWGQGTLVTVSA 230 BL006-4-20G5-20K5 variable region light chain DIQMTQTTSSLSASLGDRVTISCRPSQDISNYLNW YQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGT DYSLTISNLEQEDIATYFCQQGNTLPWTFGGGTK LEK 231 BL006-4-52G6-52K7 variable region heavy chain QVQLQQPGAELVKPGASVKLSCKASGYSFTSYW MHWVKQRPGQGLEWIGQIDPSDSYTNYNQKFK GKATLTVDKSSSTAYMQLSSLTSEDSAVYYCAS GNYGPYLGNYFDYWGQGTTLTVPS 232 BL006-4-52G6-52K7 variable region light chain DIVMSQSPSSLVVSVGEKVTMSCKSSQSLLHSTN QKNYLAWYQQKPGQSPKLLIYWASTRESGVPDR FTGSGSGTDFTLTISSVKAEDLVVYYCQQYYNYP YTFGGGTKLEIK 233 BL006-4-61G5-61K1 variable region heavy chain EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYW MNWVRQSPEKGLEWVAQIRFKSDNYATHYAES VKGRFTISRDDSKSSVYLQMHNLRAEDTGIYYCT EFAYWGQGTLVTVSA 234 BL006-4-61G5-61K1 variable region light chain QILLTQSPAIMSASPGEKVTMTCSASSRVNSRFLN WYQQKSGVSPKLWIYGTSNLASGVPARFSGSGS GTSYSLTISSVEAEDVATYYCQQYQSDPPITFGAG TRLELI 235 BL006-8-3G9-3K4 variable region heavy chain QVQLQQSGAELVRPGASVKLSCKASGYRFTDYE MEWVKQTPVHGLEWIGAIDPETGGTAYNQKFKG KATVTADKSSRTAYMELRSLTSEDSAVYYCTRE GDGSYGAYWGQGTLVTVSA 236 BL006-8-3G9-3K4 variable region light chain DVMMTQTPLSLPVSLGDQASISCRSSQSIVYSNG NTYLEWYLQKPGQSPKLLMYKVSNRFSGVPDRF SGSGSGTDFTLKISRVEAEDLGVYYCFQGSHAPW TFGGGTKLEIK 237 BL006-11-5G1-5K3 variable region heavy chain EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAM SWVRQTPEKRLEWVAAINTDGASTYFPATVKDR FTISRDNAKNTLYLQMSSLRSEDTALYYCARPLE PGSWFAYWGQGTLVTVSA 238 BL006-11-5G1-5K3 variable region light chain DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGN TYLEWYLQKPGQSPKVLIYKVSNRFSGVPDRISG SGSGTDFTLKISRVEAGDLGVYYCFQGSHVPYTF GGGTKLEIK 239 BL006-19-14G3-14K1 variable region heavy chain QVTLKESGPGILQPSQTLSLTCSFSGFSLDTFGM GVGWIRQSSGKGLEWLAHIWWDDDKFYNPALKS RLTVSKDTSKNQVFLKIANVDTADTATYYCAHY YGSLSFDVWGTGTTVTVSS 240 BL006-19-14G3-14K1 variable region light chain DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGK TYLNWLLQRPGESPKLLIYLVSKLDSGVPDRFTG SGSGTDFTLKISRVEAEDLGVYYCLQATHFPWTF GGGTKLEIK 241 BL006-19-134G5-134K4 variable region heavy chain QVQLQQPGAELVKPGASVKLSCKASDYTFTTYW MHWVKQRPGQGLEWIGMIHPNSDTTLYNEKFRS QATLTVDKSSSTAYIQLSRLTSEDSAVYYCWTG TNFDYWGQGTTLAVSS 242 BL006-19-134G5-134K4 variable region light chain QVVLTQSPAIMSASPGEKVTMTCSATSSVSYMY WYQQKPGSSPKPWIYRTSNLASGVPVRFSGSGSG TSYSLTISSMEAEDAATYYCQQWSSNPLTFGGGT KLELK 243 BL006-19-183G3-183K4 variable region heavy chain QVTLNESGPGILQPSQTLSLTCSFSGFSLTTYGMG VGWIRQPSGKSLEWLANIWWTEDKYYNSALKSR LTISTDTSHNQVFLKISSVDTEDTATYYCAQMGP EVYSAMDYWGQGTSVTVSS 244 BL006-19-183G3-183K4 variable region light chain DIVMTPSQKFMSTTVGDRVSITCKASQNVGTAV AWYQQKPGHSPKLLIYSASNRNTGVPDRFTGSGS GTDFTLTISNMQSEDLADYFCHQYSRYPWTFGG GTKLEIK 245 BL006-2-19G13-19K15 variable region heavy chain QVQLQQPGSELVRPGASVKLSCKASGYKFTSYW MHWVKQRPGQGLEWIGSIYPGSGSTNYDEKFKR KATLTVDTFSSTASMQLSSLTSEDSAVYYCTREM AYWGQGTLVTVSA 246 BL006-2-19G13-19K15 variable region light chain DIVITQDELSNPVTSGESVSISCRSSKSLLYKDGKT YLNWFLQRPGQSPQLLVYWMSTRASGVSDRFSG SGSGTDFTLEISRVKAEDVGVYYCQQVVEYPFTF GTGTKLGIK 247 BL006-4-31G1-31K3 variable region heavy chain QVQLQQSGPELVKPGASVKISCKTSGFIFIDYYI NWVKQRPGQGLEWIGWIFPGSGSSFYSEIFKGQA TLTVDKSSSTAYMLLSSLTSEDSAVYFCARRNYY GYGAYAMDYWGQGTSVTVSS 248 BL006-4-31G1-31K3 variable region light chain DIQMNQSPSSLSASLGDTITITCRASQSINFWLSW YQQKPGNIPKLLIYKASNLHTGVPSRFSGSGSGTD FTLTISSLQPEDIATYYCLQGQSYPLTFGGGTKLEI K 249 BL006-9-1G1-1K1 variable region heavy chain EVKLVESGGGLVKPGGSLKLSCAASGFTFSSYAM SWVRQTPERGLEWVAAIQSNGGSTFYPDTVKDR FTISRDNAKNTLYLQMSSLRSEDTALYYCVRGPF DYWGQGTTLTVSS 250 BL006-9-1G1-1K1 variable region light chain QIVLTQSPAIMSASPGQKVTIPCSASSSVNYIHWF QQKLGSSPKLWIYDTSKLTPGVPARFSGSGSGTS YSLTISSMEAEDAASYFCHQWRSYPPTFGGGTKL EIK 251 BL006-9-15G1-15K5 variable region heavy chain QAYLQQSGAELVRPGASVKMSCKASGYTFTSYN MHWVKQTPRQGLEWIGAVIPGNGDSFYNQKFK GKATLTVDKSSSTAYMQLSSLTSEDSAVYFCGRS SSGCIAYWGQGTLVTVSA 252 BL006-9-15G1-15K5 variable region light chain DIVLTQSPASLAVSLGQRATISCRVSGSVDYDGD SYMNWYQQKPGQPPKLLIYAASNLESGIPARFSG SGSETDFTLNIHPVEEEDAATYYCLQSNEAPWTF GGGTKVEIK 253 BL006-19-21G1-21K1 variable region heavy chain QVQLQQPGAELVKPGASVKMSCKASGYTFISYW ITWVKQRPGQGLEWIGDIYPGSGHTNYNEKFKSK ATLTVDTSSSTAYMQLSSLTSEDSAVYYCARPTV EAMDYWGQGTSVTVSS 254 BL006-19-21G1-21K1 variable region light chain QIVLTQSPAIMSASPGEKVTMTCSASSSVNYMHW YQQRSGTSPKRWIYDTSKLASGVPARFSGSGSGT SYSLTISSMEAEDAATYYCQQWSNNPLTFGAGT KLELK 255 BL006-19-29G5-29K1 variable region heavy chain QVTLKESGPGILQSSQTLSLTCSFSGFSLSTFGMG VSWIRKPSGKGLEWLAHIFWDDDKRYNPSLKSR LTISKDTSSNQVFLMINSMDIADTATYYCTRGSN WFAYWGQGTLVTVSA 256 BL006-19-29G5-29K1 variable region light chain DIVLTQSPASLAVSLGQRATISCRASESVDSYGNS FMHWYQQKPGQPPKLLIYRASNLESGIPARFSGS GSRTDFTLTINPVEADDVATYYCQQSNEDPLTFG AGTKLELK 257 BL006-19-55G10-55K7 variable region heavy chain QVQLQQSGAEVVRPGTSVKMSCKAAGYTFTDN WIDWVKQRPGHGLDWIGNIFPGGNYTNYNEKFK GKATLTADTSSSTAYMQLINLTSEDSAIYYCVRA VADSQFAYWGQGTLVTVSA 258 BL006-19-55G10-55K7 variable region light chain QIVLTQSPAIMSVSPGEKVTMTCSASSRVTYMYW YQQKPGSSPKPWIYRTSNLASGVPVRFSGSGSGT SYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTK LELK 259 BL006-19-190G4-190K6 variable region heavy chain EVQLVESGGGLVQPGGSLKLSCAASGFTFSNYG MSWVRQTPDKRLELVATINSNGGSTYYPDSVKG RFTISRDNAKNTLYLQMSSLKSEDTAMYYCTKR GAWYFDVWGTGTTVTVSS 260 BL006-19-190G4-190K6 variable region light chain DIQMTQSSSSFSVSLGDRVTITCKASEDIYNRLAW YQQKPGNAPRLLISSATSLETGVSSRFSGSGSGKD YTLSITSLQTEDVATYYCQQYWTTPTWTFGGGT KLEIK 261 BL006-19-352G9-352K8 variable region heavy chain QVQLQQPGAELVKPGASVKLSCKASGYTFTSYW MHWVKQRPGQGLEWIGMIHPNGDITDYNEKFKS KATLAVDESSSTAFMQLNSLTSEDSAFYYCARAS YYGSLYWGQGTTLTVSS 262 BL006-19-352G9-352K8 variable region light chain DIVMTQSQKFMSTSVGDRVSVTCKASQNVGIAV AWYQKKPGQSPKTLIYSASTRYTGVPDRFTGSGS GTDFTLTINDVQSEDLADYFCQQYGSSPLTFGAG TKLELK 263 BL006-19-363G1-363K1 variable region heavy chain QVQLQQPGAELVKPGASVKLSCKASGYTFTTYW IHWVKQRPGQGLEWIGMILPNSGTTIYNEKFRSQ ATLTVDKSSSAAYMQLSRLTSEDSAVYYCAVTG TNFDYWGQGTTLTVSS 264 BL006-19-363G1-363K1 variable region light chain QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMYW YQQKPGSSPKPWIYRTSNLASGVPVRFSGSGFGT SYSLTISNMEAEDAATYYCQQWSSNPLTFGTGTK LELK 265 BL006-19-370G9-370K16 variable region heavy chain QVQLQQSGAELGRPGTSVKMSCKAAGYTFTNY WIGWVKQRPGHGLEWIGDIYPGGGYTNYNEKFK GKATLTADTSSSTAYIQLSSLTSEDSAIYYCARSG YYDGSPLAMDYWGQGTSVTVS 266 BL006-19-370G9-370K16 variable region light chain QIVLTQSPTIMSASPGEKVTMTCSASSSVSYMHW YQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGT SYSLTISSMEAEDAATYYCQQWSSNPPTFGSGTK LEK 267 Human CD 96 MEKKWKYCAVYYIIQIHFVKGVWEKTVNTEENV variant 1 (long isoform) YATLGSDVNLTCQTQTVGFFVQMQWSKVTNKID LIAVYHPQYGFYCAYGRPCESLVTFTETPENGSK WTLHLRNMSCSVSGRYECMLVLYPEGIQTKIYN LLIQTHVTADEWNSNHTIEIEINQTLEIPCFQNSSS KISSEFTYAWSVENSSTDSWVLLSKGIKEDNGTQ ETLISQNHLISNSTLLKDRVKLGTDYRLHLSPVQI FDDGRKFSCHIRVGPNKILRSSTTVKVFAKPEIPVI VENNSTDVLVERRFTCLLKNVFPKANITWFIDGS FLHDEKEGIYITNEERKGKDGFLELKSVLTRVHS NKPAQSDNLTIWCMALSPVPGNKVWNISSEKITF LLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYP ATSSVTLVDVSALRPNTTPQPSNSSMTTRGFNYP WTSSGTDTKKSVSRIPSETYSSSPSGAGSTLHDNV FTSTARAFSEVPTTANGSTKTNHVHITGIVVNKPK DGMSWPVIVAALLFCCMILFGLGVRKWCQYQKE IMERPPPFKPPPPPIKYTCIQEPNESDLPYHEMETL 268 Human CD 96, variant 2 MEKKWKYCAVYYIIQIHFVKGVWEKTVNTEENV (long isoform) YATLGSDVNLTCQTQTVGFFVQMQWSKVTNKID LIAVYHPQYGFYCAYGRPCESLVTFTETPENGSK WTLHLRNMSCSVSGRYECMLVLYPEGIQTKIYN LLIQTHVTADEWNSNHTIEIEINQTLEIPCFQNSSS KISSEFTYAWSVEDNGTQETLISQNHLISNSTLLK DRVKLGTDYRLHLSPVQIFDDGRKFSCHIRVGPN KILRSSTTVKVFAKPEIPVIVENNSTDVLVERRFT CLLKNVFPKANITWFIDGSFLHDEKEGIYITNEER KGKDGFLELKSVLTRVHSNKPAQSDNLTIWCMA LSPVPGNKVWNISSEKITFLLGSEISSTDPPLSVTE STLDTQPSPASSVSPARYPATSSVTLVDVSALRPN TTPQPSNSSMTTRGFNYPWTSSGTDTKKSVSRIPS ETYSSSPSGAGSTLHDNVFTSTARAFSEVPTTANG STKTNHVHITGIVVNKPKDGMSWPVIVAALLFCC MILFGLGVRKWCQYQKEIMERPPPFKPPPPPIKYT CIQEPNESDLPYHEMETL 269 Human CD 96, Ig-like residues 38-125 of SEQ ID GSDVNLTCQTQTVGFFVQMQWSKVTNKIDLIAV (V-type 1) domain 1 NO: 267 YHPQYGFYCAYGRPCESLVTFTETPENGSKWTL HLRNMSCSVSGRYECMLVLYPE 270 Human CD 96, IG-like residues 156-238 of SEQ ID NQTLEIPCFQNSSSKISSEFTYAWSVENSSTDSWV (V-type 2) domain 2 NOD: 267 LLSKGIKEDNGTQETLISQNHLISNSTLLKDRVKL GTDYRLHLSPVQI 271 Human CD96, Ig-like residues 269-375 of SEQ ID PEIPVIVENNSTDVLVERRFTCLLKNVFPKANITW (C2 type) domain 3 NO: 267 FIDGSFLHDEKEGIYITNEERKGKDGFLELKSVLT RVHSNKPAQSDNLTIWCMALSPVPGNKVWNISS EKIT 272 Rhesus CD96, from NCBI accession MEKKWKYCAVYYIIQIHFVKGVWGKPLNTEENI short isoform number XP_00548247 YATLGSDVNLTCQTQAKGFLVQMQWSKVTDKA DLIALYHPQYGFHCAYGSPCESLVTFTQTPENGS KWTLHLRNMSSSVSGRYECMLTLYPEGMQTKIY NLLIQTHVTPDEWKSNHTIEIEINQTLEIPCFQNSS SEISSEFTYAWLVEDNGTQQTLISQDHLISSSTLLK DRVKVGTDYRLHLSPVQIFDDGRKFSCHIRVGPD KILRSSTTIKVFAKPEIPMIVENNSTDVLVERTFTC LLTNVFPKANIIWFIDGSFLHDEKEGIYITNEERKG KDGFLELKSVLTRVHSDKPAQSDNLTIWCMALSP VPGNKVWNISSEKITFLLGSEMSTTDPPPSVTEST LDTQPSPASSVSPTRYPATSSVTLADVSALRPNTT PQSSSSSVTTQDFNYPWTSSGTDAKKSFSQIPSET YSLSPSGAGSTLHDNVFTSTTRALSEVPTTANGST KTNHVHITGIVVSKPKDGMSWPVIVAALLFCCMI LFVLGVRKWCQYQKEIMERPPPFKPPPPPIKYTCI QEPNESDPPYHEMETL 273 Human CD69, Ig-like residues 156-222 of SEQ ID NQTLEIPCFQNSSSKISSEFTYAWSVEDNGTQETLI (V-type 2) domain 2 NO: 268 SQNHLISNSTLLKDRVKLGTDYRLHLSPVQI 274 Human CD96, residues 370-502 of SEQ ID SSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSV Pro/Ser/Thr- NO: 267 SPARYPATSSVTLVDVSALRPNTTPQPSNSSMTTR rich domain 4 GFNYPWTSSGTDTKKSVSRIPSETYSSSPSGAGST LHDNVFTSTARAFSEVPTTANGSTKT
EXAMPLES
[0132] 1. Characterization of the Human CD96
[0133] CD96 Expression on T, NK and Other Hematopoietic Cell Populations
[0134] Expression of the human CD96 on the different populations of human PBMCs has been tested by using anti-CD96 clone 628211 (R&D Biotech) and NK92.39 (Fuchs, 2004) antibody. CD96 expression on CD4+ and CD8+ cells, NK cells and few B cells is demonstrated in
[0135] More specifically, we have found that among peripheral blood mononuclear cells (PBMCs) of healthy donors, 38.5% (median, range from 55-22.5%, n=8) of NK cells, 39.1% (53.2-29%, n=4) of CD4.sup.+ T cells and 45.6% (53.8-26.2%, n=4) of CD8.sup.+ T cells co-express CD96 and CD226. Interestingly, 51% (75-25%, n=8) of NK cells, 96.8% (99.6-96.5%, n=4) of CD4.sup.+ T cells and 73.1% (87.7-68.1%, n=4) of CD8.sup.+ T cells expressing CD226 were found to co-express CD96. Of note, 27% (45-20%, n=4) of NK cells, 15.5% (20-8%, n=4) of CD4.sup.+ T cells, 28% (30-16%, n=4) of CD8.sup.+ T cells expressing CD226 and CD96 also co-express TIGIT (data not shown).
[0136] FCM analysis further showed that, like CD226, CD96 was more strongly expressed on CD45RO+ memory T cells than on resting naive T cells (
[0137] As observed for CD226 (Lozano et al. The TIGIT/CD226 Axis Regulates Human T Cell Function. J Immunol. 188:3869-3875 (2012)), the expression of CD96 was increased on both CD4+ and CD8+ memory T cells activated with anti-CD3 antibody (OKT3), but not on naive T cells in this activation condition (
[0138] Finally, the expression of CD96 was investigated by FCM on circulating CD4+ regulatory T cells (Tregs) identified by the high expression of CD25 and low expression of CD127 markers. As shown in
[0139] 1.2 CD96 can Form Homodimers and Heterodimers with CD226
[0140] It has been described that CD226 can form cis-homodimers that are required for the efficient interaction of CD226 with CD155 and for the activation of cells expressing CD226. CD226 can also form cis-heterodimers with TIGIT that results in the disruption of CD226 homodimerization and thus CD226 activation, most likely through inhibition of CD226/CD155 interaction (Johnston et al. The Immunoreceptor TIGIT Regulates Antitumor and Antiviral CD8+ T Cell Effector Function. Cancer cell 26(6):923-937 (2014)). However, whether CD96 can form homodimers and/or heterodimers with CD226 is not known. We therefore investigated the homo and hetero-dimerization of hCD96 with hCD96 and hCD226 by using fluorescence resonance energy transfer (FRET) between antibodies tagged with the phycoerythrin (PE—excited by 488 nm laser) and the allophycocyanin (APC—detected using the emission filter 670 LP) (Batard et al. Use of phycoerythrin and allophycocyanin for fluorescence resonance energy transfer analyzed by flow cytometry: advantages and limitations. Cytometry 48(2):97-105 (2002)). We expressed transiently on CHO cells the hCD226-His tagged protein in combination or not with the hCD96-HA and/or with hTIGIT-Myc tagged proteins by transfection with the plasmids HG10565-NH, HG11202-NY, HG10917-NM respectively (SinoBiological). The CD226, CD96 and TIGIT were labelled with anti-hCD226, -hCD96, -hTIGIT, -His, -HA or -Myc mAbs coupled to PE and APC. As control, cells are separately labelled with either anti-Tag mAbs-PE or anti-Tag mAbs-APC, then pooled. Transfected cells were incubated at +4° C. for 30 minutes with mAbs, then after several washes, the interaction between molecules (FRET between PE-conjugated mAbs and APC-conjugated mAbs) was analyzed by flow cytometry on a FACSCanto II flow cytometer (BD biosciences). Of note, for each condition of transfected, four combinations of mAbs have been tested, ie. Anti-Tag-PE+ anti-Tag-APC; Anti-Tag-PE+ anti-receptor-APC, anti-receptor-PE+ anti-receptor-APC, and anti-receptor-PE+ anti-Tag-APC. As described by Batard et al, only some combinations of mAbs are able to allow energy transfer (data not shown) (Batard, 2002).
[0141] We confirmed the hCD226 formed hCD226-hCD226 homodimers (
[0142] As already described in the literature, the expression of CD96 has been confirmed on circulating NK, T and NKT cells of healthy individuals. Moreover, CD96 was found to be co-expressed with CD226 on the majority of the NK, T and NKT cells. On circulating NK cells, we have now observed that CD96 is expressed on resting and activated CD56dim and CD56bright/CD1610 subsets, while TIGIT is not expressed on the CD56bright/CD1610 subset (data not shown). On circulating T cells, we have shown that CD96 is mostly expressed on CD4+ memory T cells and on both naive and memory CD8+ T cells, like CD226. The expression of CD96 is further increased on anti-CD3-activated memory T cells, like CD226. Finally, we have observed that the expression of CD96 is weaker on the circulating CD4+ Treg population compared to conventional CD4+ T cells.
[0143] We have also demonstrated that human CD96 can form homodimers as well as heterodimers with human CD226. This dimerization may play a key role in the functional activities of CD96 on cells expressing CD96 and CD226.
[0144] Altogether, these observations combined with our results showing that some of the disclosed anti-CD96 antibodies co-stimulate human T cells (see below), suggest that an agonistic anti-CD96 antibody preferentially stimulates conventional CD8+ and CD4+ T cells and thus finds use for increasing cellular immune responses in patients with diseases such as cancer. The stimulating activity of CD96 may be mediated by triggering of CD96 as a monomer or homodimer, and/or as heterodimer with the activating receptor CD226.
[0145] 2. Generation of Mouse Anti-Human CD96 Antibodies
[0146] 2.1 The human CD96 used for the assay, unless otherwise mentioned, is the shorter form of CD96 (isoform v2 lacking the exon 4), which is the major form expressed on human lymphocytes.
[0147] In order to generate mouse antibodies against human CD96, mice were immunized by applying a protocol comprising 4 DNA injections at 2 weeks' intervals followed by two final boosts at one-week interval and animal sacrifice according to sera screening results: [0148] 5 WT mice: Prime humanCD96 DNA+Boost humanCD96 DNA [0149] 5 WT mice: Prime humanCD96 DNA+Boost humanCD96 CHO (CHO cells transfected with hCD96 expression vector)
[0150] The presence and the titer of IgG binding to human CD96 was monitored in serum of immunized animals by ELISA (coating of hCD96-humanIgG1 fusion protein, hCD96-hFc, produced and purified in house) and by flow cytometry on CHO cells expressing hCD96. The presence of mAbs inhibiting the CD155-CD96 interaction was also tested using interference ELISA. Animals displaying strong anti-CD96 IgG titers were sacrificed. Their spleens and lymph nodes were extracted and the mononuclear cells (MNCs) were purified and frozen. The cells from the 5 mice boosted with humanCD96-CHO were pooled.
[0151] 2.2 Single B Cell Screening Using the ISAAC Technology and Generation of Recombinant Anti-CD96 Antibodies
[0152] The ISAAC technology, described in WO2009/017226, is a unique method for detecting individual antibody secreting cells using microarray chips, which enables the analysis of live cells on a single-cell basis and offers a rapid, efficient and high-throughput (up to 234,000 individual cells) system for identifying and recovering the relevant cells.
[0153] An array of single live cells was prepared by applying mouse MNCs, previously purified from spleen and lymph nodes of immunized mice, to a microarray chip. The chip surface was previously coated with the target antigen (hCD96-hFc) and the anti-CD96 mouse antibodies secreted by an antibody secreting cell were trapped by the CD96 coated on the surface around the well. After washings, the presence of mouse IgG bound to the immobilized CD96 was detected by an anti-mouse IgG antibody coupled to Cy3 and fluorescence microscopy. Binding of the antigen to the specific antibodies formed distinct circular spots, which were easily distinguishable from nonspecific signals. CD96-specific antibody secreting single cells were then retrieved by micromanipulation, mRNA was recovered from single cells and cDNA sequences coding the variable regions of the heavy (VH) and light (VL) chain of IgG were amplified by RT-PCR. The VH and VL sequences were then cloned in expression vectors containing a mouse gamma-2a constant region (Fcγ2a) and a kappa constant region, respectively. Antibodies were also cloned in a mIgG2a format containing the D265A mutation (mIgG2a-D265A) that decreases the affinity of mIgG2a for Fcγ receptors.
[0154] After co-transfection of the H and L chain expression vectors in CHO cells, the recombinant antibodies were tested for confirmation of CD96 recognition and specificity by ELISA on plates coated with hCD96-hFc or with an unrelated human protein fused to hFc and produced and purified as for the hCD96-hFc protein. The inhibition of CD155-CD96 interaction was monitored by ELISA. Recognition of native CD96 and inhibition of CD96-CD155 interaction was confirmed by flow cytometry on CHO cells transfected with hCD96 or an irrelevant protein.
[0155] In total, 160 pairs of VH and VL were amplified and the resulting IgG antibodies were confirmed for specific binding to human CD96. Among them, 19 antibodies were produced and purified. From those 19 antibodies, 12 inhibited hCD155-hCD96 interaction.
[0156] In Vitro Characterization of Recombinant Mouse Anti-CD96 Antibodies
[0157] FACS Binding on CHO Cells Expressing Human CD96
[0158] The capacity of the identified mouse anti-CD96 antibodies to recognize the cell membrane expressed human CD96 was further analyzed by flow cytometry (FCM) by using CHO cells stably transfected with the CD96 short isoform v2 (CD96v2; Genbank accession number NM_005816, flanked in C-terminus with HA-tag) (SEQ ID NO: 268). The recognition of the long form of human CD96 (v1 isoform; CD96v1) (SEQ ID NO: 267) was also tested by flow cytometry with CHO cells transiently expressing the human CD96v1 (Genbank accession number NM_198196.2). The binding capacity of the 19 candidates was compared to the binding capacity of the 2 mIgG1 benchmark antibodies NK92.39 (Fuchs, 2004; Biolegend) and clone 628211 (R&D System).
[0159] Mouse anti-CD96 antibodies and isotype control antibodies were incubated at various concentrations from 10 μg/mL to 4.6 ng/mL with CHO cells expressing human CD96 at +4° C. for 30 minutes. After two washings, the presence of antibody bound to cell membrane CD96 was revealed by incubation with a PE-coupled anti-mouse antibody and analysis on an Accuri-C6 flow cytometer (BD-Biosciences). The differences between the mean fluorescence intensity (MFI) obtained for each of the antibody concentration and the intensity obtained in absence of primary antibody (delta-MFI), were calculated and plotted against the concentrations of antibodies. Negative control antibodies of appropriate isotype that did not recognize CD96 were tested in the same conditions to measure the background of antibody staining (non-specific staining).
[0160] The binding results obtained for 19 mouse anti-hCD96 antibodies are shown in
[0161] Among the 19 antibodies tested, 11 candidates were found to bind strongly to hCD96v2 (BL006-4-31, BL006-19-183, BL006-19-190, BL006-19-134, BL006-19-21, BL006-19-55, BL006-19-352, BL006-19-363, BL006-19-370, BL006-19-14, BL006-19-29). Binding of these candidates to hCD96v2 was similar or superior to the one of clone 628211. Six candidates (BL006-4-20, BL006-4-52, BL006-4-61, BL006-11-5, BL006-8-3, BL006-9-1) bound weaker to CD96v2, as did benchmark NK92.39. Candidate BL006-9-15 bound even weaker to CD96v2. Finally, candidate BL006-2-19 showed very weak binding to CD96v2 by FCM (not shown).
[0162] Among the 19 antibodies tested, 11 candidates were also found to strongly bind to the long form of human CD96 (CD96v1) expressed on CHO cells by FCM (BL006-4-31; BL006-19-21; BL006-19-183, BL006-19-14, BL006-19-29, BL006-4-52; BL006-2-19, BL006-11-5, BL006-4-61, BL006-9-1, BL006-8-3, BL006-9-15). The rest of the candidates bound weaker to the long form of hCD96 (CD96v1), as did the 2 benchmarks NK92.39 and 628211.
TABLE-US-00006 TABLE 6 EC50 values and maximum binding capacity of anti-CD96 antibodies on hCD96-transfected CHO cells by flow cytometry analysis (values of 1 representative experiment) EC50 on hCD96 Maximum binding Recognition short form on hCD96 short hCD96 long Antibodies (nM) (delta MFI) form 628211 3.75 543 390 +/− NK92.39 1.59 282 606 +/− BL006-4-20 0.69 327 585 +/− BL006-4-31 4.82 723 334 + BL006-19-21 6.53 598 872 + BL006-19-183 4.56 681 369 + BL006-19-190 3.39 710 819 +/− BL006-19-134 3.00 575 690 +/− BL006-19-55 3.30 635 919 +/− BL006-19-352 6.87 731 367 +/− BL006-19-363 1.69 494 147 +/− BL006-19-370 4.71 648 271 +/− BL006-19-14 3.10 693 852 + BL006-19-29 2.98 753 029 + BL006-4-52 13.41 492 761 + BL006-2-19 Not determined* Not determined* ++ BL006-11-5 12.83 373 445 ++ BL006-4-61 2.05 329 658 ++ BL006-9-1 17.46 513 596 ++ BL006-8-3 4.68 234 883 ++ BL006-9-15 14.26 42 028 ++ *antibody BL006-2-19 bound very weakly on hCD96v2 by FCM. The EC50 and maximum binding values could not be calculated; +/−: weak binding at 10 μg/ml antibody; +: binding at 10 μg/ml antibody; ++: strong binding at 10 μg/ml antibody.
[0163] 3.2 Cross-Reactivity with Mouse and Rhesus CD96
[0164] The capacity of the identified mouse anti-human CD96 antibodies to recognize the CD96 protein from other species was further analyzed by flow cytometry by using CHO cells expressing the mouse or the rhesus CD96. The expression of the species-specific CD96 on CHO cell surface was confirmed by using staining with appropriate anti-CD96 antibodies and flow cytometry on non-fixed cells. The rat anti-mCD96 antibody clone #630612 (R&D Systems) and the candidate BL006-9-1 (positive by ELISA on rhesus CD96) were used to confirm the expression of rhesus CD96, while the clone 6A6 (rat IgG2a, e-Bioscience) was used to verify the expression of mouse CD96.
[0165] Mouse anti-CD96 antibodies and isotype control antibodies were incubated at 10 or 1 μg/mL with CHO cells expressing different CD96 species at +4° C. for 30 minutes. After 2 washings, the presence of antibody bound to cell membrane CD96 was revealed by incubation with a PE-coupled anti-mouse antibody and analysis on an Accuri-C6 flow cytometer (BD-Biosciences).
[0166] The results obtained for the 19 mouse anti-CD96 antibodies are shown in the
[0167] 3.3 Inhibition of CD96/CD155 Interaction Measured by Flow Cytometry on CHO Cells
[0168] All candidates except BL006-2-19 that bound very weakly on hCD96v2 by FCM were tested for their capacity to inhibit the binding of human CD155 to hCD96v2 stably expressed on CHO cells. Human CD96-transfected CHO cells (3×10.sup.5 cells/well of 96-well plate) were incubated at +4° C. for 30 minutes with serial dilutions of anti-CD96 antibodies or isotype control antibody (in mIgG2a or mIgG2aD265A format) in the presence of 4 μg/mL of biotinylated hCD155-Fc (produced and biotinylated at BliNK). The cells were then washed twice and the binding of CD155-hFc to CHO cells was revealed by incubation with a FITC-conjugated Streptavidin (BD Biosciences) and flow cytometry analysis on an Accuri-C6 flow cytometer (BD biosciences).
[0169] The percentage of inhibition of hCD155 binding to hCD96 was calculated as follows:
[0170] % inhibition=(1−(MFI_wAb&CD155−MFI_CHO)/(MFI_wCD155−MFI_CHO))×100, where MFI_wAb&CD155 is the Mean Intensity Fluorescence (MFI) obtained with the hCD96-CHO cells incubated with the tested antibody and hCD155-hFc; MFI_CHO is the MFI obtained in the absence of hCD155 and mAbs; and MFI_wCD155 is the fluorescence with hCD155 but without pre-incubation with antibody (0% CD155 binding inhibition). The % of inhibition was plotted against antibody concentration and the IC50 values were calculated by using a nonlinear regression analysis model of the GraphPad Prism software.
[0171] The results illustrated in
TABLE-US-00007 TABLE 7 IC50 values of anti-CD96 antibodies in the CD96/hCD155 inhibition assay with CD96v2-transfected CHO cells and flow cytometry analysis (mean of n = 2 independent experiments) Maximal Inhibition Capacity Antibody IC50 (nM) (%) 628211 15.78 100 NK92.39 10.45 100 BL006-4-20 2.81* 43.8 BL006-4-31 16.78 100 BL006-19-183 15.04 100 BL006-19-190 11.53 98.1 BL006-19-134 11.37 100 BL006-19-21 19.42 100 BL006-19-55 8.84 98.3 BL006-19-352 14.68 100 BL006-19-363 5.92 100 BL006-19-370 10.85 100 BL006-19-14 2.67* 41.4 BL006-19-29 5.24* 43.1 BL006-4-52 nd <5 BL006-4-61 nd <5 BL006-11-5 nd <5 BL006-8-3 nd <5 BL006-9-1 nd <5 BL006-9-15 nd <5 *relative IC50; nd: not determined
[0172] Binding of Anti-CD96 Candidates on Human PBMCs
[0173] The anti-CD96 mAbs candidates have been tested for their binding capacity on human PBMCs. The mAbs were previously biotinylated (EZ-link Sulfo-NHS-LC-Biotin). PBMCs from 3 healthy donors were stained with anti-CD3-PerCP (Clone SK7, BD biosciences), CD56-FITC (Clone REA196 Miltenyi), and anti-CD96-Biotinylated (10 μg/ml). The T cells population was gated as CD3pos, CD56neg (mean: 64.9%, SD: 9.4% of lymphocyte population), NK cell as CD3neg, CD56pos (mean: 11.1%, SD: 1.7% of lymphocyte population), and NKT cells, as CD3pos, CD56pos (mean: 4.2%, SD: 2.9% of lymphocyte population). Streptavidin-APC (Abcam) was used to detect anti-CD96-biotinylated mAbs.
[0174] Among the 18 antibodies tested (BL006-9-1 was not tested)), 9 candidates (BL006-4-20, BL006-4-31, BL006-19-29, BL006-19-14, BL006-19-55, BL006-19-183, BL006-19-190, BL006-19-134, BL006-19-21) displayed strong binding on T and NK cells (
[0175] The expression of CD96 has been tested on human tumor infiltrating lymphocytes (TILs) obtained from head and neck tumors. To extract TILs, head and neck tumors were washed twice with serum free RPMI media and any blood clots removed with tweezers. Tumor samples were first mechanically disaggregated using sterile scalpel blade to dice into small pieces, then enzymatically digested using DNAse I (800 U/mL) and Liberase Dispase Low (0.15 WU/mL) for 20 minutes at 37° C. with continuous agitation. Enzyme reaction was quenched with 5 ml RMPI 10% FCS and disaggregated tumor samples were passed through a 100 μm cell strainer. Prior to counting, red blood cells were removed using red cell lysis buffer at room temperature for 5 minutes. TILs, obtained from 4 patients, were stained anti-CD3-eFluor450 (UCHT1, ebioscience), anti-CD56-PC7 (CMSSB, ebioscience), anti-CD4-APC-eFluor780 (RPA-T4, ebioscience), anti-CD8-FITC (RPA-T8, Biolegend), anti-FoxP3-PE (PCH101(CL), ebioscience) and anti-CD96-APC (FAB6199A, R&D Systems). CD96 was markedly expressed on CD3+CD8+ T cells (except for donor HN306), CD3+CD4+ conventional T cells, CD3-CD56+NK cells and CD3+CD4+FoxP3+ cells from 4 patients (
[0176] CD96 is not Expressed on Human Platelets and Our Anti-CD96 Candidates do not Bind on Platelets
[0177] CD226 has been described to be expressed on platelets and this may represent a potential side effect for the use of therapeutic anti-CD226 antibodies. In contrast, CD96 is not expressed on human platelets (Wang, 1992). The potential binding of our 19 anti-CD96 candidates on platelets was further tested by FCM. None of the candidates as well as benchmarks NK92.39 and 628211 show significant binding to human platelets (data not shown). Thus, in contrast to CD226, CD96 is not expressed on human platelets and our anti-CD96 candidates do not show reactivity on platelets. In conclusion, conversely to CD226, agonistic antibodies against CD96 can be safely developed without incurring the risk to trigger platelets aggregation.
[0178] Epitope Mapping by FCM on hCD96 Truncated Proteins
[0179] Expression vectors coding for truncated extracellular domains of hCD96v2 (short isoform v2) were constructed to map, within the 3 described immunoglobulin domains of hCD96v2, the epitopes recognized by the anti-hCD96 candidates. All expression vectors constructed contained the signal peptide, the D4 domain, the transmembrane, the intracellular chain of hCD6 plus a HA-Tag to monitor transfection efficiency of the various constructs. The expression vectors contained only D1, D2, D3 or combinations of those 3 domains (D1D2, D1D3, D2D3). The anti-hCD96 antibodies were tested by FCM for their capacity to recognize the truncated CD96 proteins transiently expressed on CHO-S cells. As shown in
[0180] Affinity of the Best Mouse Anti-CD96 Candidates
[0181] The kinetic constants (K.sub.on and K.sub.off) and the dissociation constant (KD) of the anti-hCD96 candidates were measured by surface plasmon resonance (SPR) on Biacore using hCD96-hFc protein (in house production) captured by anti-huFc antibodies coated on the chip and compared to benchmark. Results are shown in Table 8 below. Most of candidates displayed an affinity in the nM range with a KD value between 0.18 and 42.3 nM, except for candidate BL006-2-19 that showed no binding in this setting by Biacore. Ten candidates have better affinity than NK92.39 clone.
TABLE-US-00008 TABLE 8 Association (K.sub.on), dissociation (K.sub.off) and affinity (KD) constants of anti-CD96 antibodies as measured by SPR (Biacore). Antibody KD (M) Kon (1/Ms) Koff (1/s) NK92.39 3.24E−09 1.07E+05 3.46E−04 BL006-4-20 8.25E−10 6.91E+05 5.70E−04 BL006-4-31 1.32E−08 5.31E+04 7.00E−04 BL006-19-183 4.50E−10 6.56E+05 2.96E−04 BL006-19-190 2.97E−09 1.50E+05 4.44E−04 BL006-19-134 7.07E−10 1.40E+05 9.88E−05 BL006-19-21 6.75E−09 1.46E+05 9.88E−04 BL006-19-55 3.45E−09 1.45E+05 5.01E−04 BL006-19-352 2.34E−08 3.41E+04 7.96E−04 BL006-19-363 3.50E−09 1.67E+05 5.85E−04 BL006-19-370 4.23E−08 4.55E+04 1.93E−03 BL006-19-14 2.54E−10 6.09E+05 1.55E−04 BL006-19-29 1.82E−10 8.96E+05 1.63E−04 BL006-4-52 2.83E−09 1.28E+05 3.63E−04 BL006-4-61 3.64E−10 4.20E+05 1.53E−04 BL006-11-5 3.47E−09 1.67E+05 5.79E−04 BL006-8-3 3.51E−10 5.48E+05 1.92E−04 BL006-9-1 1.98E−10 8.10E+05 1.60E−04 BL006-9-15 4.60E−09 5.98E+05 2.75E−03
[0182] Anti-CD96 Antibody Candidates can Co-Stimulate Human CD4+ and CD8+ T Cells Activation and Proliferation
[0183] The biological activity of the anti-CD96 candidates was further evaluated on human T cells co-stimulated with anti-CD3 antibody OKT3. PBMC were isolated from healthy individuals, stained with CFSE fluorescent dye and cultured with soluble or plate-bound anti-CD96 antibodies (mIgG2a-D265A format) in the presence or the absence of different concentrations of soluble anti-CD3 antibody (OKT3, mIgG2a). The cells were collected at different times of culture, and the activation and proliferation of CD4+ and CD8+ T cells was analyzed by FCM by measuring the expression of the CD25 activation marker and the CFSE fluorescence dilution, respectively.
[0184] The results reported in
[0185] Example of increased CD25 expression on T cells is shown in
[0186] In a second set of experiments, 8 anti-CD96 candidates were tested for their capacity to co-stimulate T cells from 2 donors (#2 and #3) and were compared with the benchmark anti-hCD96 antibody (NK92.39). Example of CFSE dilution measured by FCM is shown in
[0187] All candidate antibodies, except BL006-2-19, were tested in parallel for co-stimulatory effects on OKT3-sub-optimally activated T cell proliferation. The percentage of dividing cells (cells showing decreased CFSE staining, upper panels) as well as the CFSE median of fluorescence intensities (middle panels) were reported. Lower panels report the percentage of dividing cells for each antibody candidate according to the concentration of OKT3 used for sub-optimal stimulation. Results indicate that candidates BL006-4-20, BL006-4-31, BL006-19-183, BL006-19-134, BL006-19-14, BL006-19-190, BL006-19-21, BL006-19-55, BL006-19-370, BL006-19-363, BL006-19-352, BL006-19-29 and BL006-4-52 co-stimulated CD4+(
[0188] The co-stimulation properties of 3 candidates were tested on purified CD4+ and CD8+ T cells (magnetic cell sorting) in order to evaluate the role of accessory cells present in PBMC on the observed phenomenon. CFSE-stained purified T cells were sub-optimally activated with 2 μL/mL of tetrameric CD3/CD28 complex (ImmunoCult™, Stemcell). The activity of anti-CD96 candidates (10 μg/mL) on these T cells was evaluated 5 days later by FCM. Results indicate that candidates BL006-4-20, BL006-19-134 and BL006-4-31 co-stimulated purified CD4+ and CD8+ T cells (
[0189] CD96 and CD226 (DNAM-1) are both able to interact with CD155. Engagement of CD226 by CD155 provides a stimulatory signal for NK and T cells. CD155 is expressed on monocytes and activated T cells (data not shown). To rule out the possibility that CD96 masking by candidate antibodies could favor interaction between CD226 and CD155, a co-stimulation experiment of PBMCs was performed in presence of either a blocking antibody to CD226 or a blocking antibody to CD155. Results reported as the median of CFSE fluorescence after 4 days of co-stimulation, indicate that candidate BL006-19-134 was able to induce CD4+ and CD8+ T cells proliferation independently of an interaction between CD226 and CD155 (
[0190] The optimal timing for co-stimulation induced by candidates BL006-4-20, BL006-19-134 and BL006-4-31 was evaluated. Purified CD4+ or CD8+ T cells were sub-optimally activated with 2 μL/mL of tetrameric CD3/CD28 complex (ImmunoCult™, Stemcell). Co-stimulation with anti-CD96 antibodies was either introduced simultaneously or delayed 24 h, 48 h or 72 h. Results indicate that CD96 engagement must be concomitant with sub-optimal CD3 stimulation to obtain the maximal co-stimulation effect (
[0191] Chimeric antibodies were generated for candidates BL006-4-20, BL006-19-134 and BL006-19-14 on a human IgG1 backbone (CHG1). For each candidate, a Fc silent version (CHS1) was also constructed to evaluate the impact of interaction with Fc receptors on the activity of soluble anti-CD96 candidate antibodies. The effect of these various soluble constructs (1 μg/mL), on proliferation of sub-optimally activated (0.1 and 0.3 ng/mL OKT3) CD4+ and CD8+ T cells was evaluated as previously described. Results indicate that candidates BL006-4-20, BL006-19-134 and BL006-19-14 introduced as soluble human IgG1 in a co-stimulation experiment, are able to co-stimulate CD4+ and CD8+ T cells (
[0192] Tumor infiltrating lymphocytes were extracted from surgically removed head and neck cancers from 2 patients who gave their informed consent. This work was approved by the local ethical committee of the hospital of Southampton (UK). The effect of the plate-bound BL006-19-134CHG1 candidate (5 μg/mL) on the proliferation of sub-optimally activated (3 μL/mL Immunocult™) TILs was evaluated after a 5-days co-culture by a 16-hours long pulse of .sup.3[H] Thymidine. Results indicate that candidate BL006-19-134CHG1 introduced as plate-bound human IgG1 in a co-stimulation experiment, is able to co-stimulate and re-invigorate ex vivo TILs from head and neck tumor cells (
[0193] All documents cited or referenced herein (“herein cited documents”), and all documents cited or referenced in herein cited documents, together with any manufacturer's instructions, descriptions, product specifications, and product sheets for any products mentioned herein or in any document incorporated by reference herein, are hereby incorporated herein by reference, and may be employed in the practice of the invention. More specifically, all referenced documents are incorporated by reference to the same extent as if each individual document was specifically and individually indicated to be incorporated by reference.
[0194] Although the present invention and its advantages have been described in detail, it should be understood that various changes, substitutions and alterations can be made herein without departing from the spirit and scope of the invention as defined in the appended claims.
REFERENCES
[0195] Batard P., Szollosi J., Luescher I., Cerottini J.-C., MacDonald R. and Romero P., Use of phycoerythrin and allophycocyanin for fluorescence resonance energy transfer analyzed by flow cytometry: advantages and limitations, Cytometry, 2002, 48:97-105 [0196] Blake S. J., Dougall W. C., Miles J. J., Teng M. W. L, and Smyth M. J., Molecular pathways: Targeting CD96 and TIGIT for cancer immunotherapy, Clinical Cancer Research, 2016, 22(21): 5183-8 [0197] Chan C. J., Martinet L., Gilfillan S., Souza-Fonseca-Guimaraes F., Chow M., Town L., Ritchie D. S., Colonna M., Andrews D. M. & Smyth M. J., The receptors CD96 and CD226 oppose each other in the regulation of natural killer cell functions, Nature Immunology, 2014, 15(5):431-8 [0198] Chothia C., Novotny J., Bruccoleri R. and Karplus M., Domain association in immunoglobulin molecules. The packing of variable domains, J. Mol. Biol., 1985, 186:651-63 [0199] Evan G. I., Lewis G. K., Ramsay G., et al., Isolation of monoclonal antibodies specific for human c-myc proto-oncogene product, Mol. Cell. Biol., 1985, 5(12):3610-6 [0200] Fuchs A., Cella M., Giurisato E., Shaw A. S., and Colonna M. Cutting Edge: CD96 (Tactile) Promotes NK Cell-Target Cell Adhesion by Interacting with the Poliovirus Receptor (CD155), Journal of Immunology, 2004, 172:3994-8 [0201] Fuhrman C. A., Yeh W.-I., Seay H. R., Saikumar Lakshmi P., Chopra G., Zhang L., Perry D. J., McClymont S. A., Yadav M., Lopez M.-C., Baker H. V., Zhang Y., Li Y., Whitley M., von Schack D., Atkinson M. A., Bluestone J. A. and Brusko T. M., Divergent phenotypes of human regulatory T cells expressing the receptors TIGIT and CD226, The Journal of Immunology, 2015, 195:145-55 [0202] Gao J., Chen K., Miao Z., Ren G., Chen X., Gambhir S. S. and Cheng Z., Affibody-based nanoprobes for HER2-expressing cell and tumor imaging, Biomaterials, 2011, 32(8):2141-8 [0203] Johnston R. J., Comps-Agrar L., Hackney J., Yu X., Huseni M., Yang Y., Park S., Javinal V., Chiu H., Irving B., Eaton D. L. and Grogan J. L., The immunoreceptor TIGIT regulates antitumor and antiviral CD8+ T cell effector function, Cancer Cell, 2014, 26:923-37 [0204] Jokerst J. V., Miao Z., Zavaleta C., Cheng Z., and Gambhir S. S., Affibody-functionalized gold-silica nanoparticles for raman molecular imaging of the epidermal growth factor receptor, Small., 2011, 7(5):625-33 [0205] Kennedy J., Vicari A. P., Saylor V., Zurawski, S. M., Copeland N. G., Gilber D. J., Jenkins N. A. and Zlotnik A., A molecular analysis of NKT cells: identification of a class-I restricted T cell-associated molecule (CRTAM), Journal of Leukocyte Biology, 2000, 67:725-34 [0206] Novotny J. and Haber E., Structural invariants of antigen binding: comparison of immunoglobulin VL-VH and VL-VL domain dimers., Proc. Natl. Acad. Sci. U.S.A., 1985, 82:4592-96 [0207] Lozano E., Dominguez-Villar M., Kuchroo V. and Hafler D. A., The TIGIT/CD226 axis regulates human T cell function, The Journal of Immunology, 2012, 188:3869-75 [0208] Melero et al. Therapeutic vaccines for cancer: an overview of clinical trials. Nature reviews. Clinical oncology. 11(9):509-524 (2014) [0209] Paborsky L. R., Fendly B. M., Fisher K. L., et al., Mammalian cell transient expression of tissue factor for the production of antigen, Protein Engineering, 1990, 3(6):547-53 [0210] Page D. B., Postow M. A., Callahan M. K., Allison J. P. and Wolchok, J., Immune modulation in cancer with antibodies, Annual Review of Medicine, 2014, 65:185-202 [0211] Sanmamed et al. Agonists of co-stimulation in cancer immunotherapy directed against CD137, OX40, GITR, CD27, CD28 and ICOS. Seminars in oncology. 42(4):640-655 (2015) [0212] Saxena A. and Wu, D., Advances in therapeutic Fc engineering—Modulation of IgG-associated effector functions and serum half-life, Frontiers in Immunology, 2016, 12(7):580 [0213] Seth S., Maier M. K., Qiu Q., Ravens I., Kremmer E., Förster, R. and Bernhardt G., The murine pan T cell marker CD96 is an adhesion receptor for CD155 and nectin-1, Biochemical and Biophysical Research Communications, 2007, 364:959-65 [0214] Shibuya A., Campbell D., Hannum C., Yssel H., Franz-Bacon K., McClanahan T., Kitamura T., Nicholl J., Sutherland G. R., Lanier L. L. and Phillips J. H., DNAM-1, a novel adhesion molecule involved in the cytolytic function of T lymphocytes, Immunity, 1996, 4:573-81 [0215] Stanietsky N., Simic H., Arapovic J., Toporik A., Levy O., Novik A., Levine Z., Beiman M., Dassa L., Achdout H., Stern-Ginossar N., Tsukerman P., Jonjic S. and Mandelboim O., The interaction of TIGIT with PVR and PVRL2 inhibits human NK cell cytotoxicity, PNAS, 2009, 106(42): 17858-63 [0216] Thakor A. S., Luong R., Paulmurugan R., et al. et al., The fate and toxicity of raman-active silica-gold nanoparticles in mice, Sci. Transl. Med., 2011, 3(79):79ra33 [0217] Wang P., O'Farrell S., Clayberger C., Krensky A. Identification and molecular cloning of tactile. A Novel Human T Cell Activation Antigen that Is a Member of the Ig Gene Superfamily, Journal of Immunology, 1992, 148:2600-8 [0218] Yu X., Harden K., Gonzales L. C., Francesco M., Chiang E., Irving B., Tom I., Ivejla S., Refino C. J., Clark H., Eaton D. and Grogan J. L., The surface protein TIGIT suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells, Nature Immunology, 2009, 10(1):48-57