CONJUGATES OF ANTIBODIES AN IMMUNE CELL ENGAGERS

20230190951 · 2023-06-22

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention concerns a process for preparing a multispecific antibody construct, comprising conjugating a functionalized antibody Ab(F).sub.x containing x reactive moieties F, wherein x is an integer in the range 1 -10, and an immune cell-engaging polypeptide containing one or two reactive moieties Q, wherein the antibody is specific for a tumour cell and the immune cell-engaging polypeptide is specific for an immune cell, wherein the reaction forms a covalent linkage between the functionalized antibody and the immune cell-engaging polypeptide by reaction of Q with F. The invention further concerns the multispecific antibody constructs obtainable by the process according to the invention and medical uses thereof.

    Claims

    1. A process for preparing a multispecific antibody construct, comprising conjugating a functionalized antibody Ab(F).sub.x containing x reactive moieties F, wherein x is an integer in the range 1 - 10, and an immune cell-engaging polypeptide containing one or two reactive moieties Q, wherein the antibody is specific for a tumour cell and the immune cell-engaging polypeptide is specific for an immune cell, wherein the reaction forms a covalent linkage between the functionalized antibody and the immune cell-engaging polypeptide by reaction of Q with F.

    2. The process according to claim 1, wherein the antibody is specific for an extracellular receptor on a tumour cell selected from the group consisting of CD30, nectin-4, folate receptor alpha, CEACAM5, CD37, TF, ENPP3, CD203c, EGFR, CD138/syndecan-1, Axl, DKL-1, IL13R, HER3, CD166, LIV-1, c-Met, CD25, PTK7, CD71, FLT3, GD3, ASCT2, IGF-1R, CD123, CD74, guanyl cyclase C, CD205, ROR1, ROR2, CD46, CD228, CD70, Globo H, Lewis Y, MUC1, CA-IX, PSMA, CanAg, EphA2, Cripto, av-integrin, CD56, SLITRK6, 5T4, c-KIT, FGFR2, Notch3, CS1, gpNMB, TIM-1, CD19, CD20, Cadherin-6, P-cadherin, C4.4a, DPEP3, MFI2, CD48a, LRRC15, PRLR, DLL3, CD324, RNF43, ADAM-9, AMHRII, CD13, CD38, CD45, claudin, Gal-3BP, GFRA1, MICA/B, RON, TM4SF, TWEAKR, TROP-2, BCMA, B7-H3, BMPR1B, E16, STEAP1, MUC16, MPF, NaPi2b, Sema 5b, PSCA hlg, ETBR, MSG783, STEAP2, TrpM4, CRIPTO, CD21, CD79b, FcRH2, HER2, NCA, MDP, IL20Rα, Brevican, EphB2R, ASLG659, PSCA, GEDA, BAFF-R, CD22, CD79a, CXCR5, HLA-DOB, P2X5, CD72, LY64, FcRH1, FcRH5, TENB2, PMEL17, TMEFF, GDNF-Ra1, Ly6E, TMEM46, Ly6G6D, LGR5, RET, LY6K, GPR19, GPR54, ASPHD1, Tyrosinase, TMEM118, GPR172A, CD33, CLL-1, CLEC12A, MOSPD2, EpCAM, CD133, TAG72, FAP, PD-L1 and SSTR2.

    3. The process according to claim 1, wherein the immune cell-engaging polypeptide is selected from the group consisting of Fab, VHH, scFv, diabody, minibody, affibody, affylin, affimers, atrimers, fynomer, Cys-knot, DARPin, adnectin/centryin, knottin, anticalin, FN3, Kunitz domain, OBody, bicyclic peptides and tricyclic peptides.

    4. The process according to claim 1, wherein: (i) the immune cell-engaging polypeptide is specific for a cellular receptor on a T cell selected from the group consisting of CD3, CD28, CD137, CD134, CD27, Vγ9Vδ2 and ICOS; or (ii) the immune cell-engaging polypeptide is specific for a cellular receptor on a NK cell selected from the group consisting of CD16, CD56, CD335, CD336, CD337, CD28, NKG2A, NKG2D, KIR, DNAM-1 and CD161; or (iii) the immune cell-engaging polypeptide is specific for a cellular receptor on a monocyte or a macrophage selected from CD64; or (iv) the immune cell-engaging polypeptide is specific for a cellular receptor on a granulocyte selected from CD89; or (v) the immune cell-engaging polypeptide is an antibody specific for IL-2 or IL-15.

    5. The process according to claim 4, wherein the immune cell-engaging polypeptide is selected from the group consisting of OKT3, UCHT1, BMA031, VHH 6H4, IL-2, IL-15, IL-15/IL-15R complex, IL-15/IL-15R fusion, mAb602, Nara1 or TCB2, an antibody specific for IL-2 and an antibody specific for IL-15m.

    6. The process according to claim 1, wherein the immune cell-engaging polypeptide contains one reactive moiety Q.

    7. The process according to claim 1, wherein Q is selectively introduced onto the immune cell-engaging polypeptide by chemical or enzymatic modification.

    8. The process according to claim 1, wherein: (i) the multispecific antibody construct is bispecific, and the functionalized antibody and the cell-engaging polypeptide are both monospecific; or (ii) the multispecific antibody construct is trispecific, the functionalized antibody is bispecific, (iii) and the immune cell-engaging polypeptide is monospecific.

    9. The process according to claim 1, wherein the conjugation is preceded by reacting a linker compound, comprising one or two reactive moieties Q and one reactive moiety Q.sup.1 with an immune cell engaging polypeptide, containing a reactive moiety F.sup.2 reactive towards Q.sup.1, to afford a linker-polypeptide construct (Q)yL-polypeptide, wherein L is a linker and y = 1 or 2, which is subjected to the conjugation.

    10. The process according to claim 1, wherein the conjugation comprises: (i) reacting a linker compound comprising a reactive moiety Q with Ab(F).sub.x, to afford a modified antibody Ab(Z-L-Q.sup.1)x, wherein L is a linker and Z is a connecting group formed by the reaction of Q with F; or (ii) reacting a linker compound comprising two reactive moieties Q with Ab(F).sub.x, to afford a modified antibody having structure: ##STR00132## wherein L is a linker and Z is a connecting group formed by the reaction of Q with F.

    11. The process according to claim 1, wherein x = 1, 2, 4 or 8.

    12. The process according to claim 1, wherein the immune cell-engaging polypeptide comprises one reactive moiety Q, and the conjugation comprises reaction of ximmune cell-engaging polypeptides with Ab(F).sub.x, or wherein the immune cell-engaging polypeptide comprises two reactive moieties Q, and the conjugation involves reaction of x / 2 immune cell-engaging polypeptides with Ab(F).sub.x.

    13. The process according to claim 1, wherein Q.sup.1 comprises a cyclooctyne moiety.

    14. The process according to claim 13, wherein Q.sup.1 is selected from bicyclononyne (BCN), azadibenzocyclooctyne (DIBAC/DBCO), dibenzocyclooctyne (DIBO) or sulfonylated dibenzocyclooctyne (s-DIBO).

    15. The process according to claim 1, wherein F is present on the Fc fragment of the antibody.

    16. The process according to claim 1, wherein F is present on a native glycan of the antibody.

    17. A multispecific antibody construct obtainable by the process according to claim 1.

    18. The multispecific antibody construct according to claim 17, which has structure (13a) or (13b): ##STR00133## ##STR00134## wherein: Ab is an antibody specific for a tumour cell; Z is a connecting group; L is a linker; D is an immune cell-engaging polypeptide specific for an immune cell; x is an integer in the range of 1 - 10.

    19. The multispecific antibody construct according to claim 18, wherein linker L is selected from the group consisting of linear or branched C.sub.1-C.sub.200 alkylene groups, C.sub.2-C.sub.200 alkenylene groups, C.sub.2-C.sub.200 alkynylene groups, C.sub.3-C.sub.200 cycloalkylene groups, C.sub.5-C.sub.200 cycloalkenylene groups, C.sub.8-C.sub.200 cycloalkynylene groups, C.sub.7-C.sub.200 alkylarylene groups, C.sub.7-C.sub.200 arylalkylene groups, C.sub.8-C.sub.200 arylalkenylene groups and C.sub.9-C.sub.2oo arylalkynylene groups, the alkylene groups, alkenylene groups, alkynylene groups, cycloalkylene groups, cycloalkenylene groups, cycloalkynylene groups, alkylarylene groups, arylalkylene groups, arylalkenylene groups and arylalkynylene groups being optionally substituted and optionally interrupted by one or more heteroatoms selected from the group of O, S and NR.sub.3, wherein R.sup.3 is independently selected from the group consisting of hydrogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.2 - C.sub.24 alkenyl groups, C.sub.2 - C.sub.24 alkynyl groups and C.sub.3 - C.sub.24 cycloalkyl groups, the alkyl groups, alkenyl groups, alkynyl groups and cycloalkyl groups being optionally substituted.

    20. The multispecific antibody construct according to claim 18, wherein Z contains a succinimide, a triazole, a cyclohexene, a cyclohexadiene, an isoxazoline, an isoxazolidine, a pyrazoline, or a piperazine.

    21. The multispecific antibody construct according to claim 18, wherein Z is according to any one of structures (Za) to (Zk): ##STR00135## ##STR00136## ##STR00137## ##STR00138## ##STR00139## ##STR00140## ##STR00141## ##STR00142## ##STR00143## wherein, X.sup.8 is O or NH; X.sup.9 is selected from H, C.sub.1-12 alkyl and pyridyl; R.sup.23 is C.sub.1-12alkyl; in structure (Zg) and (Zh), the ##STR00144## bond represents either a single or a double bond, and may be connected via either side of this bond to linkers L; the wavy lines indicate the connection to linkers L.

    22. A method of treating cancer comprising administering to a subject a multispecific antibody construct according to claim 17.

    Description

    DESCRIPTION OF THE FIGURES

    [0037] FIG. 1 shows a representative (but not comprehensive) set of functional groups (F) in a biomolecule, either naturally present or introduced by engineering, which upon reaction with a reactive group lead to connecting group Z. Functional group F may be artificially introduced (engineered) into a biomolecule at any position of choice. The pyridazine connecting group (bottom line) is the product of the rearrangement of the tetrazabicyclo[2.2.2]octane connecting group, formed upon reaction of tetrazine with alkyne, with loss of N.sub.2. Connecting groups Z of structure (10a) - (10j) are preferred connecting groups to be used in the present invention.

    [0038] FIG. 2 shows cyclooctynes suitable for metal-free click chemistry, and preferred embodiments for reactive moiety Q. The list is not comprehensive, for example alkynes can be further activated by fluorination, by substitution of the aromatic rings or by introduction of heteroatoms in the aromatic ring.

    [0039] FIG. 3 shows several structures of derivatives of UDP sugars of galactosamine, which may be modified with e.g. a 3-mercaptopropionyl group (11a), an azidoacetyl group (11b), or an azidodifluoroacetyl group (11c) at the 2-position, or with an azido group at the 6-position of N-acetyl galactosamine (11d) or with a thiol group at the 6-position of N-acetyl galactosamine (11e). The monosaccharide (i.e. with UDP removed) are preferred moieties Su to be used in the present invention.

    [0040] FIG. 4 shows the general process for non-genetic conversion of a monoclonal antibody into an antibody containing probes for click conjugation (F). The click probe may be on various positions in the antibody, depending on the technology employed. For example, the antibody may be converted into an antibody containing two click probes (structure on the left) or four click probes (bottom structure) or eight probes (structure on the right) for click conjugation.

    [0041] FIG. 5 depicts how an IgG antibody modified with two click probes (F) can react with a polypeptide modified with the complementary click probe (Q) to form a stable bond (Q) upon reaction, where the polypeptide is elected from any polypeptide that is able to bind to an immune cell, thereby forming a bispecific antibody. Modification of the polypeptide with a single click probe Q may be achieved by any selective genetic or non-genetic method. Probes for click conjugation may be elected from any suitable combination depicted in FIG. 1. Stoichiometry of the resulting bispecific antibody depends on the number of click probes F installed in the first modification of the antibody. A symmetrical, bivalent IgG may be employed (CDR1 = CDR2), thus leading to a bispecific antibody with a 2:2 molecular format (2x attachment of polypeptide). A non-symmetrical antibody may also be employed (CDR1 ≠ CDR2), thus leading to a trispecific antibody with a 1:1:2 molecular format. If more than 2 click probes F are installed, the molecular format may be further varied, leading to for example a 2:4 molecular format (4x F installed on a symmetrical antibody) or 1:1:8 molecular format (8x F installed on a non-symmetrical antibody).

    [0042] FIG. 6 shows three alternative methods to install a single immune cell-engaging polypeptide onto a full-length antibody (2:1 molecular format). The full-length antibody therefore has has first been modified with two click probes F. In one approach (arrow down), the IgG(F.sub.2) is subjected to a polypeptide that has been modified with two complementary click probes Q, connected via a suitable spacer, both of which will react with one occurrence of F on the antibody. In the second approach (arrow right), the IgG(F.sub.2) is subjected to a trivalent construct containing three complementary probes Q of which two will react with IgG(F.sub.2), leaving one unit of Q free for subsequent reaction with F-modified polypeptide. In the third approach (diagonal arrow), the IgG(F.sub.2) is subjected to a trivalent construct containing two complementary probes Q and one non-reactive click probe F.sub.2 (which is also different from F). The two click probes Q will react with IgG(F.sub.2), leaving F.sub.2 for subsequent reaction with Q2-modified polypeptide.

    [0043] FIG. 7 depicts a specific example of forming a bispecific antibody of 2:2 molecular format based on glycan remodeling of a full-length IgG and azide-cyclooctyne click chemistry. The IgG is first enzymatically remodeled by endoglycosidase-mediated trimming of all different glycoforms, followed by glycosyltransferase-mediated transfer of azido-sugar onto the core GIcNAc liberated by endoglycosidase. In the next step, the azido-remodeled IgG is subjected to an immune cell-engaging polypeptide, which has been modified with a single cyclooctyne for metal-free click chemistry (SPAAC), leading to a bispecific antibody of 2:2 molecular format. It is also depicted that the cyclooctyne-polypeptide construct will have a specific spacer between cyclooctyne and polypeptide, which enables tailoring of IgG-polypeptide distance or impart other properties onto the resulting bispecific antibody.

    [0044] FIG. 8 is an illustration of how a azido-sugar remodeled antibody can be converted into a bispecific with a 2:1 molecular format by subjecting first to trivalent cyclooctyne construct suitable for clipping onto bis-azido antibody, leaving one cyclooctyne free for subsequent SPAAC with azido-modified polypeptide, effectively installing only one polypeptide onto the IgG. The latter polypeptide may also be modified with other complement click probes for reaction with cyclooctyne, e.g. a tetrazine moiety for inverse electron-demand Diels-Alder cycloaddition. Any combinations of F and Q (FIG. 1) can be envisaged here.

    [0045] FIG. 9 shows various options for trivalent constructs for reaction with a bis-azidosugar modified mAb. The trivalent construct may be homotrivalent or heterotrivalent (2+1 format). A homotrivalent contract (X = Y) may consist of 3x cyclooctyne or 3x acetylene or 3x maleimide or 3x other thiol-reactive group. A heterotrivalent construct (X ≠ Y) may for example consist of two cyclooctyne groups and one maleimide group or two maleimides groups and one trans-cyclooctene group. The heterotrivalent construct may exist of any combination of X and Y unless X and Y and reactive with each other (e.g. maleimide + thiol).

    [0046] FIG. 10 shows the general concept of sortase-mediated ligation of proteins (capital letters for common amino acid abbreviations) for C-terminal (top) or N-terminal (bottom) ligation to a protein of interest. For C-terminal ligation, a LPXTGG sequence recombinantly fused to the C-terminus of a protein of interest, where X can be any amino acid except proline and GG may be further fused to other amino acids (sequences), and sortase-mediated ligation is achieved by treatment with substrate GGG-R (with R is functionality of interest) to form a new peptide bond. Similarly, for N-terminal ligation, a GGG sequence is fused to the N-terminus of a protein of interest, for ligation with an LPXTGG sequence, where the leucine is modified with functionality of interest R, X can be any amino acid except proline and GG may be further fused to other amino acids (sequences).

    [0047] FIG. 11 shows a range of bivalent BCN reagents (105, 107, 118, 125, 129, 134), trivalent BCN reagents (143, 145, 150), and monovalent BCN reagents for sortagging (154, 157, 161, 163, 168).

    [0048] FIG. 12 shows a range of bivalent or trivalent cross-linkers (XL01-XL13).

    [0049] FIG. 13 shows a range of antibody variants as starting materials for subsequent conversion to antibody conjugates

    [0050] FIG. 14 shows a range of metal-free click reagents equipped with N-terminal GGG (169-171 and 176) or C-terminal LPETGG (172-175), suitable for sortagging of proteins.

    [0051] FIG. 15 shows structures of scFv’s hOKT3 (200), mOKT3 (PF04) and α-4-1BB (PF31) equipped wth C-terminal LPETGG, C-terminal G.sub.4SY, N-terminal SLR (or both), possibly also G.sub.4S spacer. Structures 201-204 and PF01, PF02, PF04-PF09 are derivatives of 200, PF04 or PF31, equipped with a suitable click probe (BCN, tetrazine or azide) obtained by enzymatic or chemical derivatization.

    [0052] FIG. 16 shows bivalent, bis-BCN-modified derivatives of 200.

    [0053] FIG. 17 shows structures of various mutants of IL-15 (PF18) or IL-15R-IL-15 fusion protein (207, 208 and PF26, IL-15R = Sushi domain of IL-15 receptor) and derivatives thereof equipped with a suitable click probe (BCN, tetrazine or azide) or maleimide, in each case modified at its N-terminus to enable site-specific modification.

    [0054] FIG. 18 shows bivalent derivatives of PF26, equipped with bis-BCN (PF27 and PF29) or bis-maleimide (PF28), as well as bis-BCN-modified IL-15 (PF30), derived from PF18.

    [0055] FIG. 19 shows SDS-PAGE analysis: Lane 1 - rituximab; Lane 2 - rit-v1a; Lane 3 - rit-v1a-145; Lane 4 - rit-v1a-(201).sub.2; Lane 5 - rit-v1a-145-204; Lane 6 - rit-v1a-145-PF01; Lane 7 -rit-v1a-145-PF02. Gels were stained with coomassie to visualize total protein. Samples were analyzed on a 6% SDS-PAGE under non-reducing conditions (left) and 12% SDS-PAGE under reducing conditions (right).

    [0056] FIG. 20 shows RP-HPLC traces of B12-v1a (upper trace) and B12-v1a-145 (lowertrace). Samples have been digested with IdeS prior to RP-HPLC analysis.

    [0057] FIG. 21 shows the RP-HPLC trace under reducing conditions for the crosslinking of trastuzumab GaINProSH trast-v5b with bis-maleimide-BCN XL01 and subsequent labelling with azido-MMAF LD12 (=313).

    [0058] FIG. 22 shows the RP-HPLC analysis under reducing conditions for the crosslinking of trastuzumab S239C mutant trast-v6 with bis-maleimide-BCN XL01 subsequent labelling with azido-MMAF LD12 (=313).

    [0059] FIG. 23 shows the SDS-page analysis under reducing conditions for the crosslinking of trastuzumab trast-v7 with bis-maleimide-BCN XL01 subsequent labelling with azido-MMAF LD12 (=313), azido-IL15 PF19, hOkt3-tetrazine PF02 and anti-4-1BB-azide PF09.

    [0060] FIG. 24 shows the RP-HPLC trace under reducing conditions for the crosslinking of trastuzumab GaINProSH trast-v5b with bis-maleimide-azide XL02 and the subsequent labelling with BCN-MMAE LD11 (=312) and BCN-IL15Rα-IL15 PF15.

    [0061] FIG. 25 shows the RP-HPLC trace under reducing conditions for the crosslinking of trastuzumab S239C mutant trast-v6 with bis-maleimide-azide XL02 and the subsequent labelling with BCN-MMAE LD11 (=312) and BCN-IL15Rα-IL15 PF15.

    [0062] FIG. 26 shows the SDS-page analysis under reducing conditions for the crosslinking of trastuzumab S239C mutant trast-v6 with bis-maleimide-azide XL02 and the subsequent labelling with BCN-MMAE LD11 (=312) and BCN-IL15Rα-IL15 PF15.

    [0063] FIG. 27 shows the SDS-page analysis under reducing conditions for the crosslinking of trastuzumab trast-v7 with bis-maleimide-azide XL02 and C-lock-azide XL03 and the subsequent labelling with BCN-MMAE LD11 (=312).

    [0064] FIG. 28 shows the RP-HPLC trace under reducing conditions for the crosslinking of trastuzumab S239C mutant trast-v6 with C-lock-azide XL03 and the subsequent labelling with BCN-MMAE LD11 (=312)

    [0065] FIG. 29 shows the SDS-page analysis under reducing conditions for the crosslinking of trastuzumab S239C mutant trast-v6 with C-lock-azide XL03 and the subsequent labelling with BCN-MMAE LD11 (=312) and BCN-IL15Rα-IL15 PF15.

    [0066] FIG. 30 shows the SDS-page analysis under reducing conditions for the crosslinking of trast-v8 with bis-hydroxylamine-BCN XL06 and subsequent labelling with anti-4-1BB-azide PF09 or hOkt3-tetrazine PF02

    [0067] FIG. 31 shows SDS-PAGE analysis: Lane 1 -trast-v1a; Lane 2 -trast-v1a-XL11; Lane 3 and 4 - trast-v1a-XL11-PF01; Lane 5 - rit-v1a; Lane 6 - rit-v1a-XL11; Lane 7 and 8 - rit-v1a-XL11-PF01. Gels were stained with coomassie to visualize total protein. Samples were analyzed on a 6% SDS-PAGE under non-reducing conditions (left) and 12% SDS-PAGE under reducing conditions (right).

    [0068] FIG. 32 shows the RP-HPLC trace under reducing conditions for the crosslinking of trastuzumab S239C mutant trast-v6 with bis-bromoacetamide-BCN XL12 and subsequent labelling with azido-MMAF LD12 (=313).

    [0069] FIG. 33 shows the native SDS page analysis for the trast-v2-(PF15).sub.2 conjugate.

    [0070] FIG. 34 shows the SDS-page analysis under reducing conditions for the crosslinking of trastuzumab GaINProSH trast-v5b with bis-maleimide-azide XL02 and the subsequent labelling with BCN-MMAE LD11 (=312) and BCN-IL15Rα-IL15 PF15.

    [0071] FIG. 35 shows the SDS-page analysis under reducing conditions for the crosslinking of trastuzumab trast-v9 with bis-azide-MMAF LD10 (=310) and azido-IL15 PF19 via CuAAC.

    [0072] FIG. 36 shows the RP-HPLC trace and SDS-page analysis under reducing conditions for the crosslinking of trastuzumab GaINProSH trast-v5b with bis-maleimide-BCN XL01 subsequent labelling with azido-MMAF LD12 (=313), azido-IL15 PF19, hOkt3-tetrazine PF02 and anti-4-1BB-azide PF09.

    [0073] FIG. 37 shows the SDS-page analysis under reducing conditions for the crosslinking of trastuzumab S239C mutant trast-v6 with bis-maleimide-BCN XL01 subsequent labelling with azido-MMAF LD12 (=313), azido-IL15 PF19, hOkt3-tetrazine PF02 and anti-4-1BB-azide PF09.

    [0074] FIG. 38 shows the SDS-page analysis under reducing conditions for the crosslinking of trastuzumab GaINProSH trast-v5b and trastuzumab S239C mutant trast-v6 with bis-maleimide-MMAE LD09 (=309), bis-maleimide-IL15Rα-IL15 PF28 and maleimide-IL15Rα-IL15 PF16.

    [0075] FIG. 39 shows the SDS-page analysis under reducing conditions for the crosslinking of trastuzumab S239C mutant trast-v6 with bis-bromoacetamide-BCN XL12 subsequent labelling with azido-MMAF LD12 (=313) and hOkt3-tetrazine PF02.

    [0076] FIG. 40 shows SDS-PAGE analysis on a 6% gel under non-reducing conditions: Lane 1 - rituximab; Lane 2- rit-v1a-(201).sub.2; Lane 3 - rit-v1a-145-PF08; Lane 4- B12-v1a-145-PF01; Lane 5 - B12-v1a-145-PF08. Gels were stained with coomassie to visualize total protein. Lanes 1 and 2 are included as a reference for non-conjugated mAb and 2:2 molecular format.

    [0077] FIG. 41 shows SDS-PAGE analysis on a 6% gel under non-reducing conditions: Lane 1 - rit-v1a-(201).sub.2; Lane 2 - rit-v1a-145-PF01; Lane 3 - rit-v1a; Lane 4 - rit-v1a-PF22; Lane 5 -trast-v1a-PF22. Gels were stained with coomassie to visualize total protein. Lanes 1 and 2 are included as a reference for non-conjugated mAb and 2:2 molecular format.

    [0078] FIG. 42 shows SDS-PAGE analysis on a 6% gel under non-reducing conditions: Lane 1 - trast-v1a; Lane 2 - trast-v1a-PF23. Gels were stained with coomassie to visualize total protein. Lanes 1 is included as a reference for non-conjugated mAb.

    [0079] FIG. 43 shows SDS-PAGE analysis on a 6% gel under non-reducing conditions: Lane 1 - rit-v1a; Lane 2 - rit-v1a-(201).sub.2; Lane 3 - rit-v1a-145-PF01; Lane 4 - rit-v1a-PF22; Lane 5 - rit-v1a-PF23. Gels were stained with coomassie to visualize total protein. Lanes 1-4 are included as a reference for non-conjugated mAb, 2:1 and 2:2 molecular format.

    [0080] FIG. 44 shows SDS-PAGE analysis on a 6% gel under non-reducing conditions: Lane 1 - rit-v1a-145; Lane 2 - rit-v1a-145-PF09; Lane 3 - trast-v1a-145; Lane 4 - trast-v1a-145-PF09; Lane 5 - rit-v1a; Lane 6 - rit-v1a-(PF07).sub.2; Lane 7 - trast-v1a; Lane 8 - trast-v1a-(PF07).sub.2. Gels were stained with coomassie to visualize total protein.

    [0081] FIG. 45 shows non-reducing SDS-page analysis: lane 1 - Trast-v1a-(PF. ).sub.1-2; lane 2 -trast-v1a-(209).sub.1-2; lane 3 - trast-v1a-(PF11).sub.1-2; lane 4 - trast-v1a; lane 5 - trast-v1a-145-PF12; lane 6 - trast-v1a-145. Gels were stained with coomassie to visualize total protein.

    [0082] FIG. 46 shows SDS-PAGE analysis on a 6% gel under non-reducing conditions: Lane 1 - rit-v1a-145; Lane 2 - rit-v1a-145-PF17; Lane 3 - trast-v1a-145; Lane 4 - trast-v1a-145-PF17. Gels were stained with coomassie to visualize total protein.

    [0083] FIG. 47 shows SDS-PAGE analysis on a 6% gel under non-reducing conditions: Lane 1 - trast-v1a; Lane 2 - trast-v1a-PF29; Lane 3 - rit-v1a; Lane 4 - rit-v1a-PF29. Gels were stained with coomassie to visualize total protein.

    [0084] FIG. 48 shows effect of bispecifics based on hOKT3 200 on RajiB Tumor cell killing with human PBMCs. Bispecifics and calculated EC.sub.50 values are shown in the legend. B12-v1a-145-PF01 was included as a negative control.

    [0085] FIG. 49 shows effect of bispecifics based on anti-4-1BB PF31 on RajiB Tumor cell killing with human PBMCs. Bispecifics and calculated EC.sub.50 values are shown in the legend. B12-v1a-145-PF31 was included as a negative control.

    [0086] FIG. 50 shows cytokine levels in supernatants of a RajiB-PBMC co-culture after incubation with bispecifics based on hOKT3 200. The murine OKT3 mlgG2a antibody (Invitrogen 16-0037-81) was included as a positive control.

    [0087] FIG. 51 shows cytokine levels in supernatants of a RajiB-PBMC co-culture after incubation with bispecifics based on anti-4-1BB PF31. The murine OKT3 mlgG2a antibody (Invitrogen 16-0037-81) was included as a positive control.

    DETAILED DESCRIPTION OF THE INVENTION

    Definitions

    [0088] The verb “to comprise”, and its conjugations, as used in this description and in the claims is used in its non-limiting sense to mean that items following the word are included, but items not specifically mentioned are not excluded. In addition, reference to an element by the indefinite article “a” or “an” does not exclude the possibility that more than one of the element is present, unless the context clearly requires that there is one and only one of the elements. The indefinite article “a” or “an” thus usually means “at least one”.

    [0089] The compounds disclosed in this description and in the claims may comprise one or more asymmetric centres, and different diastereomers and/or enantiomers may exist of the compounds. The description of any compound in this description and in the claims is meant to include all diastereomers, and mixtures thereof, unless stated otherwise. In addition, the description of any compound in this description and in the claims is meant to include both the individual enantiomers, as well as any mixture, racemic or otherwise, of the enantiomers, unless stated otherwise. When the structure of a compound is depicted as a specific enantiomer, it is to be understood that the invention of the present application is not limited to that specific enantiomer.

    [0090] The compounds may occur in different tautomeric forms. The compounds according to the invention are meant to include all tautomeric forms, unless stated otherwise. When the structure of a compound is depicted as a specific tautomer, it is to be understood that the invention of the present application is not limited to that specific tautomer.

    [0091] The compounds disclosed in this description and in the claims may further exist as exo and endo diastereoisomers. Unless stated otherwise, the description of any compound in the description and in the claims is meant to include both the individual exo and the individual endo diastereoisomers of a compound, as well as mixtures thereof. When the structure of a compound is depicted as a specific endo or exo diastereomer, it is to be understood that the invention of the present application is not limited to that specific endo or exo diastereomer.

    [0092] Furthermore, the compounds disclosed in this description and in the claims may exist as cis and trans isomers. Unless stated otherwise, the description of any compound in the description and in the claims is meant to include both the individual cis and the individual trans isomer of a compound, as well as mixtures thereof. As an example, when the structure of a compound is depicted as a cis isomer, it is to be understood that the corresponding trans isomer or mixtures of the cis and trans isomer are not excluded from the invention of the present application. When the structure of a compound is depicted as a specific cis or trans isomer, it is to be understood that the invention of the present application is not limited to that specific cis or trans isomer.

    [0093] The compounds according to the invention may exist in salt form, which are also covered by the present invention. The salt is typically a pharmaceutically acceptable salt, containing a pharmaceutically acceptable anion. The term “salt thereof” means a compound formed when an acidic proton, typically a proton of an acid, is replaced by a cation, such as a metal cation or an organic cation and the like. Where applicable, the salt is a pharmaceutically acceptable salt, although this is not required for salts that are not intended for administration to a patient. For example, in a salt of a compound the compound may be protonated by an inorganic or organic acid to form a cation, with the conjugate base of the inorganic or organic acid as the anionic component of the salt.

    [0094] The term “pharmaceutically accepted” salt means a salt that is acceptable for administration to a patient, such as a mammal (salts with counter ions having acceptable mammalian safety for a given dosage regime). Such salts may be derived from pharmaceutically acceptable inorganic or organic bases and from pharmaceutically acceptable inorganic or organic acids. “Pharmaceutically acceptable salt” refers to pharmaceutically acceptable salts of a compound, which salts are derived from a variety of organic and inorganic counter ions known in the art and include, for example, sodium, potassium, calcium, magnesium, ammonium, tetraalkylammonium, etc., and when the molecule contains a basic functionality, salts of organic or inorganic acids, such as hydrochloride, hydrobromide, formate, tartrate, besylate, mesylate, acetate, maleate, oxalate, etc.

    [0095] The term “protein” is herein used in its normal scientific meaning. Herein, polypeptides comprising about 10 or more amino acids are considered proteins. A protein may comprise natural, but also unnatural amino acids.

    [0096] The term “monosaccharide” is herein used in its normal scientific meaning and refers to an oxygen-containing heterocycle resulting from intramolecular hemiacetal formation upon cyclisation of a chain of 5-9 (hydroxylated) carbon atoms, most commonly containing five carbon atoms (pentoses), six carbon atoms (hexose) or nine carbon atoms (sialic acid). Typical monosaccharides are ribose (Rib), xylose (Xyl), arabinose (Ara), glucose (Glu), galactose (Gal), mannose (Man), glucuronic acid (GIcA), N-acetylglucosamine (GIcNAc), N-acetylgalactosamine (GaINAc) and N-acetylneuraminic acid (NeuAc).

    [0097] The term “cytokine” is herein used in its normal scientific meaning and are small molecule proteins (5-20 kDa) that modulate the activity of immune cells by binding to their cognate receptors and by triggering subsequent cell signalling. Cytokines include chemokines, interferons (IFN), interleukins, monokines, lymphokines, colony-stimulating factors (CSF) and tumour necrosis factors (TNF). Examples of cytokines are IL-1 alpha (IL1a), IL-1 beta (IL1b), IL-2 (IL2), IL-4 (IL4), IL-5 (IL5), IL-6 (IL6) , IL8 (IL-8), IL-10 (IL10), IL-12 (IL12), IL-15 (IL15), IFN-alpha (IFNA), IFN-gamma (IFN- G), and TNF-alpha (TNFA).

    [0098] The term “antibody” is herein used in its normal scientific meaning. An antibody is a protein generated by the immune system that is capable of recognizing and binding to a specific antigen. An antibody is an example of a glycoprotein. The term antibody herein is used in its broadest sense and specifically includes monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies (e.g. bispecific antibodies), antibody fragments, and double and single chain antibodies. The term “antibody” is herein also meant to include human antibodies, humanized antibodies, chimeric antibodies and antibodies specifically binding cancer antigen. The term “antibody” is meant to include whole immunoglobulins, but also antigen-binding fragments of an antibody. Furthermore, the term includes genetically engineered antibodies and derivatives of an antibody. Antibodies, fragments of antibodies and genetically engineered antibodies may be obtained by methods that are known in the art. Typical examples of antibodies include, amongst others, abciximab, rituximab, basiliximab, palivizumab, infliximab, trastuzumab, efalizumab, alemtuzumab, adalimumab, tositumomab-I131, cetuximab, ibrituximab tiuxetan, omalizumab, bevacizumab, natalizumab, ranibizumab, panitumumab, eculizumab, certolizumab pegol, golimumab, canakinumab, catumaxomab, ustekinumab, tocilizumab, ofatumumab, denosumab, belimumab, ipilimumab and brentuximab.

    [0099] An “antibody fragment” is herein defined as a portion of an intact antibody, comprising the antigen-binding or variable region thereof. Examples of antibody fragments include Fab, Fab′, F(ab′).sub.2, and Fv fragments, diabodies, minibodies, triabodies, tetrabodies, linear antibodies, single-chain antibody molecules, scFv, scFv-Fc, multispecific antibody fragments formed from antibody fragment(s), a fragment(s) produced by a Fab expression library, or an epitope-binding fragments of any of the above which immunospecifically bind to a target antigen (e.g., a cancer cell antigen, a viral antigen or a microbial antigen).

    [0100] The term “antibody construct” is herein defined as the covalently linked combination of two or more different proteins, wherein one protein is an antibody or an antibody fragment and the other protein (or proteins) is an immune cell-engaging polypeptide, such as an antibody, an antibody fragment or a cytokine. Typically, one of the proteins is an antibody or antibody fragments with high affinity for a tumor-associated receptor or antigen, while one (or more) of the other proteins is an antibody, antibody fragment or polypeptide with high affinity for a receptor or antigen on an immune cell.

    [0101] An “antigen” is herein defined as an entity to which an antibody specifically binds.

    [0102] The terms “specific binding” and “specifically binds” is herein defined as the highly selective manner in which an antibody or antibody binds with its corresponding epitope of a target antigen and not with the multitude of other antigens. Typically, the antibody or antibody derivative binds with an affinity of at least about 1×10.sup.-7 M, and preferably 10.sup.-8 M to 10.sup.-9 M, 10.sup.-10 M, 10.sup.-11 M, or 10.sup.-12 M and binds to the predetermined antigen with an affinity that is at least two-fold greater than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen.

    [0103] The term “bispecific” is herein defined as an antibody construct with affinity for two different receptors or antigens, which may be present on a tumour cell or an immune cell, wherein the bispecific may be of various molecular formats and may have different valencies.

    [0104] The term “trispecific” is herein defined as an antibody construct with affinity for three different receptors or antigens, which may be present on a tumour cell or an immune cell, wherein the trispecific may be of various molecular formats and may have different valencies.

    [0105] The term “multispecific” is herein defined as an antibody construct with affinity for at least two different receptors or antigens, which may be present on a tumour cell or an immune cell, wherein the multispecific may be of various molecular formats and may have different valencies.

    [0106] The term “substantial” or “substantially” is herein defined as a majority, i.e. >50% of a population, of a mixture or a sample, preferably more than 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% of a population.

    [0107] A “linker” is herein defined as a moiety that connects two or more elements of a compound. For example in an antibody-conjugate, an antibody and a payload are covalently connected to each other via a linker. A linker may comprise one or more linkers and spacer-moieties that connect various moieties within the linker.

    [0108] A “polar linker” is herein defined as a linker that contains structural elements with the specific aim to increase polarity of the linker, thereby improving aqueous solubility. A polar linker may for example comprise one or more units, or combinations thereof, selected from ethylene glycol, a carboxylic acid moiety, a sulfonate moiety, a sulfone moiety, an acylated sulfamide moiety, a phosphate moiety, a phosphinate moiety, an amino group or an ammonium group.

    [0109] A “spacer” or spacer-moiety is herein defined as a moiety that spaces (i.e. provides distance between) and covalently links together two (or more) parts of a linker. The linker may be part of e.g. a linker-construct, the linker-conjugate or a bioconjugate, as defined below.

    [0110] A “bioconjugate” is herein defined as a compound wherein a biomolecule is covalently connected to a payload via a linker. A bioconjugate comprises one or more biomolecules and/or one or more target molecules.

    [0111] A “biomolecule” is herein defined as any molecule that can be isolated from nature or any molecule composed of smaller molecular building blocks that are the constituents of macromolecular structures derived from nature, in particular nucleic acids, proteins, glycans and lipids. Examples of a biomolecule include an enzyme, a (non-catalytic) protein, a polypeptide, a peptide, an amino acid, an oligonucleotide, a monosaccharide, an oligosaccharide, a polysaccharide, a glycan, a lipid and a hormone.

    [0112] The term “payload” refers to the moiety that is covalently attached to a targeting moiety such as an antibody. Payload thus refers to the monovalent moiety having one open end which is covalently attached to the targeting moiety via a linker. A payload may be small molecule or a biomolecule.

    [0113] The term “molecular format” refers to the number and relative stoichiometry of different binding elements in a bispecific, trispecific or multispecific antibody, with 2:2 molecular format denoting a bispecific with two polypeptide fragments able to bind one target and polypeptide fragment able to bind another target, and with 1:1:2 molecular format denoting a trispecific with one polypeptide fragment able to bind one target, another polypeptide fragment able to bind another target and a third polypeptide fragment able to bind a third target, where in all cases the targets are different. The term “2:1 molecular format” refer to a protein conjugate consisting of a bivalent monoclonal antibody (IgG-type) conjugated to a single functional payload.

    [0114] The term “complement-dependent region” or “CDR” refers to the variable fragment of an antibody that is able to bind a specific receptor or antigen.

    [0115] The present inventors have developed an improved process for the manufacture of multispecific antibody constructs, which are on one hand specific for a tumour cell and on the other hand specific for an immune cell, such as a T cell, an NK cell, a monocyte, a macrophage, a granulocyte. For the first time, it has become possible to prepare such bispecific or multispecific constructs with full control of molecular format and without the need of genetic engineering. The process according to the invention specifically couples an x number of immune cell-engaging polypeptides to a tumour-specific antibody, such that final constructs have a predetermined molecular format and a ratio of tumour-binding domains versus immune cell-binding domain of for example 2:1 or 2:2 or even 2:8.

    [0116] The present invention concerns the process for preparing the multispecific antibody constructs as well as the multispecific antibody constructs obtainable thereby. The invention further concerns the (medical) use of the multispecific antibody constructs according to the invention. The invention further concerns the intermediary immune cell-engaging polypeptide containing one or two reactive moieties Q.

    [0117] Here below, molecular moieties are defined in starting materials, intermediates and final products. The skilled person understands that any definition of preferred embodiment of either one of those equally applies to the other compounds, as long as that part of the molecule is not affected during the conversion. Likewise, anything structurally defined for the process according to the invention equally applies to the compounds according to the invention.

    Process for Preparing a Multispecific Antibody Construct

    [0118] In a first aspect, the invention concerns a process for preparing a multispecific antibody construct. The process according to the invention involves a reaction between an appropriately functionalized antibody and an appropriately functionalized immune cell-engaging polypeptide. The reaction affords the conjugation of both fragments, i.e. a covalent linkage between the functionalized antibody and the immune cell-engaging polypeptide is formed. For that to happen, the immune cell-engaging polypeptide contains or is functionalized with one or two reactive moieties Q and the functionalized antibody contains or is functionalized with 1 - 10 reactive moieties F, wherein Q and F are reactive towards each other such that the conjugation reaction forms a covalent linkage between the functionalized antibody and the immune cell-engaging polypeptide by reaction of Q with F (a list of potential Q and F moieties is provided in FIG. 1).

    [0119] Generally, the process according to the invention is represented according to Scheme 1.

    ##STR00001##

    [0120] Herein, the immune cell-engaging polypeptide is represented by D. The conjugation reaction between reactive moieties F and Q affords connecting group Z. There may be a linker (L.sup.A) present in between Q and D, giving Scheme 1b.

    ##STR00002##

    [0121] Herein, L.sup.A is a linker that covalently links Q and D or, after reaction of Q with F, covalently links Z and D. Herein, D represents the immune cell-engaging polypeptide.

    [0122] The multispecific antibody constructs obtained by the process according to the invention can be represented by structure (1a) or (1b):

    ##STR00003##

    ##STR00004##

    [0123] Herein, L.sup.A is a bivalent linker that connects Z to D, and L.sup.B is a trivalent linker that connects two occurrences of Z to D.

    [0124] In a preferred embodiment, x = 2. The process according to this embodiment can be represented according to Scheme 2 or 3.

    ##STR00005##

    [0125] Herein, the immune cell-engaging polypeptide is represented by D. The conjugation reaction between reactive moieties F and Q affords connecting group Z.

    [0126] In an especially preferred embodiment, x = 2 and the functionalized antibody is reacted with an immune cell-engaging polypeptide having two reactive groups Q. The process according to this preferred embodiment can be represented according to Scheme 3.

    ##STR00006##

    (2) (1b)

    [0127] Herein, the immune cell-engaging polypeptide is represented by structure (2). The polypeptide D is connected two both reactive moieties Q via a trivalent linker L.sup.B. The same linker is present in the final multispecific antibody construct, where it links both occurrences of Z with the polypeptide D.

    [0128] In a preferred embodiment, x = 1. The process according to this embodiment can be represented according to Scheme 4.

    ##STR00007##

    [0129] Herein, the immune cell-engaging polypeptide is represented by D. The conjugation reaction between reactive moieties F and Q affords connecting group Z.

    [0130] The functionalized antibody containing one reactive moiety F in a preferred embodiment has structure (3) as shown below. Herein, L.sup.C is a trivalent linker that links F to the antibody via two instances of Z. Performing the process according to the invention with the functionalized antibody according to structure (3) affords the multispecific antibody construct according to structure (1b). Herein, linker L.sup.B that connects to D contains the connecting group that is formed when F and Q react and covalently attach.

    [0131] The functionalized antibody according to structure (3) can be prepared by reacting a linker compound comprising two reactive moieties Q.sup.1 and one reactive moiety F with a functionalized antibody comprising two reactive moieties F.sup.1, wherein Q.sup.1 and F.sup.1 react to form a covalent connection between the antibody and F, as depicted in Scheme 5 below. The linker compound contains the same linker L.sup.C, which links F to both occurrences of Q.sup.1.

    ##STR00008##

    [0132] Herein, Q.sup.1 and F.sup.1 are reactive moieties just as Q and F, and the definition and preferred 5 embodiments of Q and F equally apply to Q.sup.1 and F.sup.1. The presence of F in the linker compound should not interfere with the reaction, which can be accomplished with the inertness of F in the reaction between Q.sup.1 and F.sup.1. The inventors have found that a trivalent linker compound wherein both Q.sup.1 and F are the same reactive moiety, the reaction with Ab(F.sup.1).sub.2 only occurs for two combinations Q.sup.1/F.sup.1, and the third reactive moiety remains unreacted. Further reduction of a third reaction taking place at the linker compound is accomplished by performing the reaction in dilute conditions.

    [0133] The present invention makes use of linkers. Linkers, also referred to as linking units, are well-known to a person skilled in the art and may be any chain of potentially substituted aliphatic carbon atoms or (hetero)aromatic moieties or a combination thereof. Suitable examples of suitable linkers include (poly)ethylene glycol diamines (e.g. 1,8-diamino-3,6-dioxaoctane or equivalents comprising longer ethylene glycol chains), polyethylene glycol chains or polyethylene oxide chains, polypropylene glycol chains or polypropylene oxide chains and 1,h-diaminoalkanes wherein h is the number of carbon atoms in the alkane. A preferred class of suitable linkers comprises polar linkers. Polar linkers for better aqueous solubility are also known in the art and contains structural elements with the specific aim to increase polarity. A polar linker may for example comprise one or more units, or combinations thereof, selected from ethylene glycol, a carboxylic acid moiety, a sulfonate moiety, a sulfone moiety, an acylated sulfamide moiety, a phosphate moiety, a phosphinate moiety, an amino group or an ammonium group. The linkers defined here are suitable candidates for any of the linkers defined in the context of the present invention, including L.sup.A, L.sup.B, L.sup.C, L.sup.1, L.sup.2 and L.sup.3.

    [0134] The process according to the invention affords a multispecific antibody construct. Thus, the specificity of the functionalized antibody and the immune cell-engaging polypeptide is towards cell types. The antibody is preferably a monoclonal antibody, more preferably selected from the group consisting of IgA, IgD, IgE, IgG and IgM antibodies. Even more preferably AB is an IgG antibody. The IgG antibody may be of any IgG isotype, such as IgG1, IgG2, Igl3 or IgG4. Preferably, the antibody is a full-length antibody, but AB may also be a Fc fragment.

    [0135] Typically, the functionalized antibody is specific for an extracellular receptor on a tumour cell. In a preferred embodiment, the extracellular receptor is selected from the group of consisting of CD30, nectin-4 (PVRL4), folate receptor alpha (FOLR1), CEACAM5 (CD66e), CD37, TF (CD142, thromoplastin), ENPP3, CD203c (AGS-16), EGFR, CD138/syndecan-1, Axl, DKL-1, IL13R, HER3, CD166, LIV-1 (SLC39A6, ZIP6), c-Met, CD25 (IL-2R-α), PTK7 (CCK4), CD71 (transferrin R), FLT3, GD3, ASCT2, IGF-1R, CD123 (IL-3Rα), CD74, guanyl cyclase C (GCC), CD205 (Ly75), ROR1, ROR2, CD46, CD228 (P79, SEMF), CD70, Globo H, Lewis Y (CD174), MUC1 (PEM), CA-IX (CA9, MN), PSMA, CanAg, EphA2, Cripto, av-integrin (ITGAV, CD51), CD56 (NCAM), SLITRK6 (SLC44A4), 5T4 (TPBG), c-KIT (CD117), FGFR2, Notch3, CS1 (SLAMF7, CD319), gpNMB, TIM- 1, CD19, CD20, Cadherin-6 (CDH6), P-cadherin (pCAD, CDH3), C4.4a, DPEP3, MFI2 (TAA), CD48a (SLAMF2), LRRC15, PRLR (prolactin), DLL3 (delta-like 3), CD324, RNF43, ADAM-9, AMHRII (anti-Müllerian), CD13, CD38, CD45, claudin (CLDN18.2), Gal-3BP (Mac-2 bp), GFRA1, MICA/B, RON, TM4SF, TWEAKR, TROP-2 (EGP-1), BCMA (CD269), B7-H3 (CD276), BMPR1B (bone morphogenetic protein receptor-type IB), E16 (LAT1, SLC7A5), STEAP1 (six transmembrane epithelial antigen of prostate), MUC16 (0772P, CA125), MPF (MPF, mesothelin (MSLN), SMR, megakaryocyte potentiating factor, mesothelin), NaPi2b (NAPI-3B, NPTIIb, SLC34A2, solute carrier family 34 (sodium phosphate), member 2, type II sodium-dependent phosphate transporter 3b), Sema 5b (FLJ10372, KIAA1445, Mm.42015, SEMASB, SEMAG, Semaphorin 5b Hlog, sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B), PSCA hlg (2700050C12Rik, C530008O16Rik, RIKEN cDNA 2700050C12, RIKEN cDNA 2700050C12 gene), ETBR (Endothelin type B receptor), MSG783 (RNF24, hypothetical protein FLJ20315), STEAP2 (HGNC_8639, IPCA-1, PCANAP1, STAMP1, STEAP2, STMP, prostate cancer associated gene 1, prostate cancer associated protein 1, six transmembrane epithelial antigen of prostate 2, six transmembrane prostate protein), TrpM4 (BR22450, F120041, TRPM4, TRPM4B, transient receptor potential cation channel, subfamily M, member 4), CRIPTO (CR, CR1, CRGF, CRIPTO, TDGF, teratocarcinoma-derived growth factor), CD21 (CR2 (Complement receptor 2) or C3DR (C3d/Epstein Barr virus receptor) or Hs 73792), CD79b (CD79B, CD7913, IGb (immunoglobulin-associated beta), B29), FcRH2 (IFGP4, IRTA4, SPAP1A (SH2 domain containing phosphatase anchor protein 1a) , SPAP1B, SPAP1C), HER2, NCA, MDP, IL20Rα, Brevican, EphB2R, ASLG659, PSCA, GEDA, BAFF-R (B cell-activating factor receptor, BLyS receptor 3, BR3), CD22 (B-cell receptor CD22-B isoform), CD79a (CD79A, CD79α, immunoglobulin-associated alpha), CXCR5 (Burkitt’s lymphoma receptor 1), HLA-DOB (Beta subunit of MHC class II molecule (Ia antigen)), P2X5 (Purinergic receptor P2× ligand-gated ion channel 5), CD72 (B-cell differentiation antigen CD72, Lyb-2), LY64 (Lymphocyte antigen 64 (RP105), type I membrane protein of the leucine rich repeat (LRR) family), FcRH1 (Fc receptor-like protein 1), FcRH5 (IRTA2, Immunoglobulin superfamily receptor translocation associated 2), TENB2 (putative transmembrane proteoglycan), PMEL17 (silver homolog; SILV; D12S53E; PMEL17; SI; SIL), TMEFF (transmembrane protein with EGF-like and two follistatin-like domains 1; Tomoregulin-1), GDNF-Ra1 (GDNF family receptor alpha 1, GFRA1, GDNFR, GDNFRA, RETL1, TRNR1, RET1L, GDNFR-alpha1, GFR-ALPHA-1), Ly6E (lymphocyte antigen 6 complex, locus E; Ly67,RIG-E,SCA-2,TSA-1), TMEM46 (shisa homolog 2 (Xenopus laevis); SHISA2), Ly6G6D (lymphocyte antigen 6 complex, locus G6D; Ly6-D, MEGT1), LGR5 (leucine-rich repeat-containing G protein-coupled receptor 5; GPR49, GPR67), RET (ret proto-oncogene; MEN2A; HSCR1; MEN2B; MTC1; PTC; CDHF2; Hs.168114; RET51; RET-ELE1), LY6K (lymphocyte antigen 6 complex, locus K; LY6K; HSJ001348; FLJ35226), GPR19 (G protein-coupled receptor 19; Mm.4787), GPR54 (KISS1 receptor; KISS1R; GPR54; HOT7T175; AXOR12), ASPHD1 (aspartate beta-hydroxylase domain containing 1; LOC253982), Tyrosinase (TYR; OCAIA; OCA1A; tyrosinase; SHEP3), TMEM118 (ring finger protein, transmembrane 2; RNFT2; FLJ14627), GPR172A (G protein-coupled receptor 172A; GPCR41; FLJ11856; D15Ertd747e), CD33, TAG72 (tumour-associated glycoprotein-72), CLL-1, CLEC12A, MOSPD2, EpCAM, CD133, FAP, PD-L1 and SSTR2.

    [0136] The immune cell-engaging polypeptide is preferably selected from the group consisting of Fab, VHH, scFv, diabody, minibody, affibody, affylin, affimers, atrimers, fynomer, Cys-knot, DARPin, adnectin/centryin, knottin, anticalin, FN3, Kunitz domain, OBody, bicyclic peptides and tricyclic peptides. Typically, the immune cell-engaging polypeptide is specific for an extracellular receptor on an immune cell. Associating tumour cells with immune cells such as T-cells, NK-cells, monocytes, macrophages and granulocyte, has been identified as a particularly interesting approach towards the treatment of cancer. Thus, in a preferred embodiment, the immune cell towards which the polypeptide is specific is for an cellular receptor on a T-cell, an NK-cell, a monocyte, a macrophage or a granulocyte, preferably on a T-cell or an NK-cell. In one embodiment, the immune cell-engaging polypeptide is specific for a cellular receptor on a T cell, preferably wherein the cellular receptor on a T cell is selected from the group consisting of CD3, CD28, CD137 (4-1BB), CD134 (OX40), CD27, Vγ9Vδ2 and ICOS. Especially preferred T cell-engaging peptides are selected from OKT3, UCHT1, BMA031 and VHH 6H4, most preferably OKT3 is used. In an alternative embodiment, the cell-engaging polypeptide is specific for a cellular receptor on a NK cell, preferably wherein the cellular receptor on a NK cell is selected from the group consisting of CD16, CD56, CD335 (NKp46), CD336 (NKp44), CD337 (NKp30), CD28, NKG2A, NKG2D (CD94), KIR, DNAM-1 and CD161. Especially preferred NK cell-engaging peptides are selected from IL-2, IL-15, IL-15/IL-15R complex and IL-15/IL-15R fusion, most preferably IL-15/IL-15R fusion. In one embodiment, the immune cell-engaging polypeptide is specific for a cellular receptor on a monocyte or a macrophage, preferably wherein the cellular receptor on the monocyte or macrophage is CD64. In one embodiment, the immune cell-engaging polypeptide is specific for a cellular receptor on a granulocyte, preferably wherein the cellular receptor on the granulocyte is CD89. In one embodiment, the immune cell-engaging polypeptide is an antibody specific for IL-2 or IL-15.

    [0137] In especially preferred embodiment, the immune cell-engaging peptide is selected from OKT3, UCHT1, BMA031, VHH 6H4, IL-2, IL-15, IL-15/IL-15R complex, IL-15/IL-15R fusion, an antibody specific for IL-2 and an antibody specific for IL-15, more preferably selected from OKT3, IL-15/IL-15R fusion, IL-15, mAb602, Nara1 or TCB2. In especially preferred embodiment, the immune cell-engaging peptide is OKT3 or IL-15/IL-15R fusion. In another especially preferred embodiment, the immune cell-engaging peptide is OKT3 or IL-15. Most preferably, the immune cell-engaging polypeptide is OKT3.

    [0138] In one distinct embodiment, the invention also pertains to multispecific antibody constructs according to the invention, wherein the D is not an immune cell-engaging polypeptide as defined herein, but is an antibody as defined here above for the functionalized antibody, wherein both the antibody Ab and D are different antibodies, directed to different targets. Preferably, both targets are selected from the list provided in paragraph [0099] above. Preferred combinations of targets are those of the prior art conjugates disclosed in paragraph [0010] above. In an especially preferred embodiment, one of the antibody targets HER1 and the other one targets cMET.

    [0139] The process according to the invention is versatile in that various constructs can be obtained, depending on the number (x) of reactive groups F present on the functionalized antibody and the number (y) of reactive groups Q present on the immune cell-engaging polypeptide. For example, when x = 1 and y = 1, a 1:1 construct can be obtained. For example, when x = 2 and y = 1, a 2:1 construct can be obtained. When an immune cell-engaging polypeptide having two reactive groups Q (y = 2) is used, a 1:1 construct can be obtained when x = 2.

    [0140] The number of functional groups introduced in the functionalized antibody can be governed by the preparation of the functionalized antibody. For example, random conjugation of an antibody with a chemical construct consisting of reactive moiety F connected to an active ester can be achieved to result in an average number of acylation events per antibody, which can be tailored by adjusting the stoichiometry of the reactive moiety F-active ester construct versus antibody. Similarly, reduction of interchain disulfide bonds of an antibody followed by reaction with a defined number of reactive moiety F containing maleimide constructs (or other thiol-reactive constructs) leads to a loading of groups F that can be tailored by stoichiometry. A more controlled, site-specific process of antibody conjugation can be achieved for example by genetic engineering of the antibody to contain two unpaired cysteines (one per heavy chain or one per light chain), to provide exactly two reactive moieties F onto the antibody upon subjection of the antibody to F containing maleimide constructs. Genetic encoding enables the direct expression of an antibody to contain a predefined number of reactive moieties F at specific sites by applying the AMBER stop codon. A range of enzymatic approaches have been also been reported to install a defined number of reactive moieties F onto an antibody, for example based on transglutaminase (TGase), sortase, formyl-glycine generating enzyme (FGE) and others. Thus, in one embodiment, the functionalized antibody is prepared by random conjugation, reduction of interchain disulfide bonds followed by reaction with F-containing thiol-reactive constructs, introduction of unpaired cysteine residues followed by reaction with F-containing thiol-reactive constructs, enzymatic introduction of reactive moieties F, and introduction of reactive moieties by genetic engineering. The use of genetic engineering is least preferred in the context of the present application, while enzymatic introduction of reactive moieties F is most preferred.

    [0141] For example, GlycoConnect technology (see e.g. WO 2014/065661 and van Geel et al., Bioconj. Chem. 2015, 26, 2233-2242, incorporated by reference) utilizes the naturally present glycans at the heavy chain of monoclonal antibodies to introduce a fixed number of click probes, in particular azides. Thus, in a preferred embodiment, the functionalized antibody is prepared by (i) optionally trimming of the native glycan with a suitable endoglycosidase, thereby liberating the core GlcNAc, which is typically present on Asn-297, followed by (ii) transfer of an unnatural, azido-bearing sugar substrate from the corresponding UDP-sugar under the action of a suitable glycosyltransferase, for example transfer of GalNAz with galactosyltransferase mutant Gal-T(Y289L) or 6-azidoGalNAc with GalNAc-transferase (GalNAc-T). Alternatively, GalNAc-T can also be applied to install onto the core GIcNAc GalNAc derivatives harbouring aromatic moieties or thiol function on the Ac group. The functionalized antibody according to structure (4) can be obtained with this technology, wherein trimming step (i) may be employed to obtained functionalized antibodies having e = 0, or can be omitted to obtain functionalized antibodies having e = 1 - 10. Preferably, step (i) is performed and e = 0.

    [0142] Thus, in a preferred embodiment, the functionalized antibody is according to structure (4)

    ##STR00009##

    [0143] Herein: [0144] AB is the antibody; [0145] D is 0 or 1; [0146] e is an integer in the range of 0 10; [0147] G is a monosaccharide moiety; [0148] GlcNAc is an N-acetylglucosamine moiety; [0149] Su is a monosaccharide derivative; [0150] Fuc is a fucose moiety; [0151] F are reactive groups capable of undergoing a conjugation reaction with Q, wherein they are joined in connecting group Z.

    [0152] Each of the two GlcNAc moieties in (4) are preferably present at a native N-glycosylation site in the Fc-fragment of antibody AB. Preferably, said GIcNAc moieties are attached to an asparagine amino acid in the region 290-305 of AB. In a further preferred embodiment, the antibody is an IgG type antibody, and, depending on the particular IgG type antibody, said GIcNAc moieties are present on amino acid asparagine 297 (Asn297 or N297) of the antibody.

    [0153] G is a monosaccharide moiety and e is an integer in the range of 0 - 10. G is preferably selected from the group consisting of glucose (Glc), galactose (Gal), mannose (Man), fucose (Fuc), N-acetylglucosamine (GIcNAc), N-acetylgalactosamine (GalNAc), N-acetylneuraminic acid (NeuNAc) and sialic acid and xylose (Xyl). More preferably, G is selected from the group consisting of glucose (Glc), galactose (Gal), mannose (Man), fucose (Fuc), N-acetylglucosamine (GlcNAc) and N-acetylgalactosamine (GalNAc).

    [0154] In a preferred embodiment, e is 0 and G is absent. G is typically absent when the glycan of the antibody is trimmed. Trimming refers to treatment with endoglycosidase, such that only the core GlcNAc moiety of the glycan remains.

    [0155] In another preferred embodiment, e is an integer in the range of 1 - 10. In this embodiment it is further preferred that G is selected from the group consisting of glucose (Glc), galactose (Gal), mannose (Man), fucose (Fuc), N-acetylglucosamine (GIcNAc), N-acetylgalactosamine (GalNAc), N-acetylneuraminic acid (NeuNAc) or sialic acid and xylose (Xyl), more preferably from the group consisting of glucose (Glc), galactose (Gal), mannose (Man), fucose (Fuc), N-acetylglucosamine (GIcNAc) and N-acetylgalactosamine (GalNAc).

    [0156] When e is 3 - 10, (G).sub.e may be linear or branched. Preferred examples of branched oligosaccharides (G).sub.e are (a), (b), (c), (d), (e), (f), (g) and (h) as shown below.

    ##STR00010##

    ##STR00011##

    ##STR00012##

    ##STR00013##

    ##STR00014##

    ##STR00015##

    ##STR00016##

    ##STR00017##

    [0157] In case G is present, it is preferred that it ends in GlcNAc. In other words, the monosaccharide residue directly connected to Su is GlcNAc. The presence of a GlcNAc moiety facilitates the synthesis of the functionalized antibody, as monosaccharide derivative Su can readily be introduced by glycosyltransfer onto a terminal GlcNAc residue. In the above preferred embodiments for (G).sub.e, having structure (a) - (h), moiety Su may be connected to any of the terminal GlcNAc residues, i.e. not the one with the wavy bond, which is connected to the core GIcNAc residue on the antibody.

    [0158] It is particularly preferred that G is absent, i.e. that e = 0. An advantage of an antibody-payload-conjugate (1) wherein e = 0 is that when such conjugate is used clinically, binding to Fc gamma receptors CD16, CD32 and CD64 is significantly reduced or fully abrogated.

    [0159] Su is a monosaccharide derivative, also referred to as sugar derivative. Preferably, the sugar derivative is able to be incorporated into the functionalized antibody by means of glycosyltransfer. More preferably, Su is Gal, Glc, GalNAc or GlcNAc, more preferably Gal or GalNAc, most preferably GalNAc. The term derivative refers to the monosaccharide being appropriately functionalized in order to connect to (G).sub.e and F.

    The Immune Cell-engaging Polypeptide

    [0160] Immune cell-engaging polypeptides are known in the art, and include Fab, VHH, scFv, diabody, minibody, affibody, affylin, affimers, atrimers, fynomer, Cys-knot, DARPin, adnectin/centryin, knottin, anticalin, FN3, Kunitz domain, OBody, bicyclic peptides and tricyclic peptides. The immune cell-engaging polypeptide comprising one or two functional moieties Q can be obtained by procedures known in the art, such as by chemical or enzymatic modification of the immune cell-engaging polypeptide.

    [0161] The immune cell-engaging polypeptide in the context of the present invention can be represented by (Q).sub.y-L-D, wherein y is 1 or 2 and D represents the immune cell-engaging polypeptide. L is a bivalent linker (L.sup.A) in case y = 1, which covalently links reactive moiety Q and D, or L is trivalent linker (L.sup.B) in case y = 2, which covalently links both reactive moieties Q and D.

    [0162] In a preferred embodiment, linker L is a trivalent linker L.sup.B according to the structure (9). Similarly, a preferred embodiment of the immune cell-engaging polypeptide comprising two reactive moieties Q is according to structure (12a). In case the multispecific antibody fragments according to the invention are prepared according to Scheme 5, via structure (3), trivalent linker L.sup.C may also be represented by structure (9).

    ##STR00018##

    ##STR00019##

    [0163] Herein, L.sup.1, L.sup.2, L.sup.3 and BM together make up linker L. BM represents a branching moiety, L.sup.1, L.sup.2 and L.sup.3 are each individually linkers and a, b and c are each individually 0 or 1. The wavy bonds represent the connection points with both reactive moieties Q and Z or D.

    The Branching Moiety BM

    [0164] A “branching moiety” in the context of the present invention refers to a moiety that is embedded in a linker connecting three moieties. In other words, the branching moiety comprises at least three bonds to other moieties, one bond to reactive group F, connecting group Z or payload D, one bond to reactive group Q or connecting group Z, and one bond to reactive group Q or connecting group Z.

    [0165] Any moiety that contains at least three bonds to other moieties is suitable as branching moiety in the context of the present invention. Suitable branching moieties include a carbon atom (BM-1), a nitrogen atom (BM-3), a phosphorus atom (phosphine (BM-5) and phosphine oxide (BM-6)), aromatic rings such as a phenyl ring (e.g. BM-7) or a pyridyl ring (e.g. BM-9), a (hetero)cycle (e.g. BM-11 and BM-12) and polycyclic moieties (e.g. BM-13, BM-14 and BM-15). Preferred branching moieties are selected from carbon atoms and phenyl rings, most preferably BM is a carbon atom. Structures (BM-1) to (BM-15) are depicted here below, wherein the three branches, i.e. bonds to other moieties as defined above, are indicated by *-(a bond labelled with *).

    ##STR00020##

    ##STR00021##

    ##STR00022##

    ##STR00023##

    ##STR00024##

    ##STR00025##

    ##STR00026##

    ##STR00027##

    ##STR00028##

    ##STR00029##

    ##STR00030##

    [0166] In (BM-1), one of the branches labelled with * may be a single or a double bond, indicated with

    ##STR00031##

    In (BM-11) to (BM-15), the following applies: [0167] each of n, p, q and q is individually an integer in the range of 0 5, preferably 0 or 1, most preferably 1; [0168] each of W, W and W.sup.3 is independently selected from C(R.sup.21).sub.w and N; [0169] each of W, W.sup.5 and W.sup.6 is independently selected from C(R.sup.21).sub.w+1, N(R.sup.22).sub.w, O and S; [0170] each represents a single or double bond; [0171] w is 0 or 1 or 2, preferably 0 or 1; [0172] each R.sup.21 is independently selected from the group consisting of hydrogen, OH, C.sub.1 - C.sub.24 alkyl groups, C.sub.1 - C.sub.24 alkoxy groups, C.sub.3 - C.sub.24 cycloalkyl groups, C.sub.2 - C.sub.24 (hetero)aryl groups, C.sub.3 - C.sub.24 alkyl(hetero)aryl groups and C.sub.3 - C.sub.24 (hetero)arylalkyl groups, wherein the C.sub.1 - C.sub.24 alkyl groups, C.sub.1 - C.sub.24 alkoxy groups, C.sub.3 - C.sub.24 cycloalkyl groups, C.sub.2 - C.sub.24 (hetero)aryl groups, C.sub.3 - C.sub.24 alkyl(hetero)aryl groups and C.sub.3 - C.sub.24 (hetero)arylalkyl groups are optionally substituted and optionally interrupted by one or more heteroatoms selected from O, S and NR.sup.3 wherein R.sup.3 is independently selected from the group consisting of hydrogen and C.sub.1 - C.sub.4 alkyl groups; and [0173] each R.sup.22 is independently selected from the group consisting of hydrogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.3 - C.sub.24 cycloalkyl groups, C.sub.2 - C.sub.24 (hetero)aryl groups, C.sub.3 - C.sub.24 alkyl(hetero)aryl groups and C.sub.3 - C.sub.24 (hetero)arylalkyl groups, wherein the C.sub.1 - C.sub.24 alkyl groups, C.sub.1 - C.sub.24 alkoxy groups, C.sub.3 - C.sub.24 cycloalkyl groups, C.sub.2 - C.sub.24 (hetero)aryl groups, C.sub.3 - C.sub.24 alkyl(hetero)aryl groups and C.sub.3 - C.sub.24 (hetero)arylalkyl groups are optionally substituted and optionally interrupted by one or more heteroatoms selected from O, S and NR.sup.3 wherein R.sup.3 is independently selected from the group consisting of hydrogen and C.sub.1 - C.sub.4 alkyl groups.

    [0174] The skilled person appreciates that the values of w and the bond order of the bonds represented by

    ##STR00033##

    are interdependent. Thus, whenever an occurrence of W is bonded to an endocyclic double bond, w = 1 for that occurrence of W, while whenever an occurrence of W is bonded to two endocyclic single bonds, w = 0 for that occurrence of W. For BM-12, at least one of o and p is not 0.

    [0175] Representative examples of branching moieties according to structure (BM-11) and (BM-12) include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, cyclopropenyl, cyclobutenyl, cyclopentenyl, cyclohexenyl, cycloheptenyl, cyclooctenyl, aziridine, azetidine, diazetidine, oxetane, thietane, pyrrolidine, dihydropyrrolyl, tetrahydrofuranyl, dihydrofuranyl, thiolanyl, imidazolinyl, pyrazolidinyl, oxazolidinyl, isoxazolidinyl, thiazolidinyl, isothiazolidinyl, dioxolanyl, dithiolanyl, piperidinyl, oxanyl, thianyl, piperazinyl, morpholino, thiomorpholino, dioxanyl, trioxanyl, dithyanyl, trithianyl, azepanyl, oxepanyl and thiepanyl. Preferred cyclic moieties for use as branching moiety include cyclopropenyl, cyclohexyl, oxanyl (tetrahydropyran) and dioxanyl. The substitution pattern of the three branches determines whether the branching moiety is of structure (BM-11) or of structure (BM-12).

    [0176] Representative examples of branching moieties according to structure (BM-13) to (BM-15) include decalin, tetralin, dialin, naphthalene, indene, indane, isoindene, indole, isoindole, indoline, isoindoline, and the like.

    [0177] In a preferred embodiment, BM is a carbon atom. In case the carbon atom is according to structure (BM-1) and has all four bonds to distinct moieties, the carbon atom is chiral. The stereochemistry of the carbon atom is not crucial for the present invention, and may be S or R. The same holds for the phosphine (BM-6). Most preferably, the carbon atom is according to structure (BM-1). One of the branches indicated with * in the carbon atom according to structure (BM-1) may be a double bond, in which case the carbon atom may be part of an alkene or imine. In case BM is a carbon atom, the carbon atom may be part of a larger functional group, such as an acetal, a ketal, a hemiketal, an orthoester, an orthocarbonate ester, an amino acid and the like. This also holds in case BM is a nitrogen or phosphorus atom, in which case it may be part of an amide, an imide, an imine, a phosphine oxide (as in BM-6) or a phosphotriester.

    [0178] In a preferred embodiment, BM is a phenyl ring. Most preferably, the phenyl ring is according to structure (BM-7). The substitution pattern of the phenyl ring may be of any regiochemistry, such as 1,2,3-substituted phenyl rings, 1,2,4-substituted phenyl rings, or 1,3,5-substituted phenyl rings. To allow optimal flexibility and conformational freedom, it is preferred that the phenyl ring is according to structure (BM-7), most preferably the phenyl ring is 1,3,5-substituted. The same holds for the pyridine ring of (BM-9).

    [0179] In a preferred embodiment, the branching moiety BM is selected from a carbon atom, a nitrogen atom, a phosphorus atom, a (hetero)aromatic ring, a (hetero)cycle or a polycyclic moiety.

    Linkers

    [0180] L.sup.A, L.sup.B and L.sup.C may be selected from the group consisting of linear or branched C.sub.1-C.sub.200 alkylene groups, C.sub.2-C.sub.200 alkenylene groups, C.sub.2-C.sub.200 alkynylene groups, C.sub.3-C.sub.200 cycloalkylene groups, C.sub.5-C.sub.200 cycloalkenylene groups, C.sub.8-C.sub.200 cycloalkynylene groups, C.sub.7-C.sub.200 alkylarylene groups, C.sub.7-C.sub.200 arylalkylene groups, C.sub.8-C.sub.200 arylalkenylene groups and C.sub.9-C.sub.200 arylalkynylene groups, the alkylene groups, alkenylene groups, alkynylene groups, cycloalkylene groups, cycloalkenylene groups, cycloalkynylene groups, alkylarylene groups, arylalkylene groups, arylalkenylene groups and arylalkynylene groups being optionally substituted and optionally interrupted by one or more heteroatoms selected from the group of O, S and NR.sup.3, wherein R.sup.3 is independently selected from the group consisting of hydrogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.2 - C.sub.24 alkenyl groups, C.sub.2 - C.sub.24 alkynyl groups and C.sub.3 - C.sub.24 cycloalkyl groups, the alkyl groups, alkenyl groups, alkynyl groups and cycloalkyl groups being optionally substituted. When the alkylene groups, alkenylene groups, alkynylene groups, cycloalkylene groups, cycloalkenylene groups, cycloalkynylene groups, alkylarylene groups, arylalkylene groups, arylalkenylene groups and arylalkynylene groups are interrupted by one or more heteroatoms as defined above, it is preferred that said groups are interrupted by one or more O-atoms, and/or by one or more S—S groups.

    [0181] Each of L.sup.1, L.sup.2 and L.sup.3 may be absent or present, but preferably all three linking units are present. In a preferred embodiment, each of L.sup.1, L.sup.2 and L.sup.3, if present, is independently a chain of at least 2, preferably 5 to 100, atoms selected from C, N, O, S and P. Herein, the chain of atoms refers to the shortest chain of atoms going from the extremities of the linking unit. The atoms within the chain may also be referred to as backbone atoms. As the skilled person will appreciate, atoms having more than two valencies, such as C, N and P, may be appropriately functionalized in order to complete the valency of these atoms. In other words, the backbone atoms are optionally functionalized. In a preferred embodiment, each of L.sup.1, L.sup.2 and L.sup.3, if present, is independently a chain of at least 5 to 50, preferably 6 to 25 atoms selected from C, N, O, S and P. The backbone atoms are preferably selected from C, N and O.

    [0182] Linkers L.sup.1 and L.sup.2 connect BM with reactive moieties Q (before reaction) or with connecting groups Z (after reaction). It is preferred that L.sup.1 and L.sup.2 are both present, i.e. a = b = 1, more preferably they are the same. In an especially preferred embodiment, (L.sup.1).sub.a-Q is identical to (L.sup.2).sub.b-Q. Linker connects BM with reactive moiety F.sup.1 (before reaction) or with payload D (after reaction). In one embodiment, L.sup.3is absent and c = 0. In an alternative and more preferred embodiment, L.sup.3 is present and c = 1. If L.sup.3 is present, it may be the same as L.sup.1 and L.sup.2 or different.

    [0183] L.sup.1, L.sup.2 and L.sup.3 may be independently selected from the group consisting of linear or branched C.sub.1-C.sub.200 alkylene groups, C.sub.2-C.sub.200 alkenylene groups, C.sub.2-C.sub.200 alkynylene groups, C.sub.3-C.sub.200 cycloalkylene groups, C.sub.5-C.sub.200 cycloalkenylene groups, C.sub.8-C.sub.200 cycloalkynylene groups, C.sub.7-C.sub.200 alkylarylene groups, C.sub.7-C.sub.200 arylalkylene groups, C.sub.8-C.sub.200 arylalkenylene groups and C.sub.9-C.sub.200 arylalkynylene groups, the alkylene groups, alkenylene groups, alkynylene groups, cycloalkylene groups, cycloalkenylene groups, cycloalkynylene groups, alkylarylene groups, arylalkylene groups, arylalkenylene groups and arylalkynylene groups being optionally substituted and optionally interrupted by one or more heteroatoms selected from the group of O, S and NR.sup.3, wherein R.sup.3 is independently selected from the group consisting of hydrogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.2 - C.sub.24 alkenyl groups, C.sub.2 - C.sub.24 alkynyl groups and C.sub.3 - C.sub.24 cycloalkyl groups, the alkyl groups, alkenyl groups, alkynyl groups and cycloalkyl groups being optionally substituted. When the alkylene groups, alkenylene groups, alkynylene groups, cycloalkylene groups, cycloalkenylene groups, cycloalkynylene groups, alkylarylene groups, arylalkylene groups, arylalkenylene groups and arylalkynylene groups are interrupted by one or more heteroatoms as defined above, it is preferred that said groups are interrupted by one or more O-atoms, and/or by one or more S—S groups.

    [0184] More preferably, L.sup.1, L.sup.2 and L.sup.3, if present, are independently selected from the group consisting of linear or branched C.sub.1-C.sub.100 alkylene groups, C.sub.2-C.sub.100 alkenylene groups, C.sub.2-C.sub.100 alkynylene groups, C.sub.3-C.sub.100 cycloalkylene groups, C.sub.5-C1.sub.00 cycloalkenylene groups, C.sub.8-C.sub.100 cycloalkynylene groups, C.sub.7-C.sub.100 alkylarylene groups, C.sub.7-C.sub.100 arylalkylene groups, C.sub.8-C.sub.100 arylalkenylene groups and C.sub.9-C.sub.100 arylalkynylene groups, the alkylene groups, alkenylene groups, alkynylene groups, cycloalkylene groups, cycloalkenylene groups, cycloalkynylene groups, alkylarylene groups, arylalkylene groups, arylalkenylene groups and arylalkynylene groups being optionally substituted and optionally interrupted by one or more heteroatoms selected from the group of O, S and NR.sup.3, wherein R.sup.3 is independently selected from the group consisting of hydrogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.2 - C.sub.24 alkenyl groups, C.sub.2 - C.sub.24 alkynyl groups and C.sub.3 - C.sub.24 cycloalkyl groups, the alkyl groups, alkenyl groups, alkynyl groups and cycloalkyl groups being optionally substituted.

    [0185] Even more preferably, L.sup.1, L.sup.2 and L.sup.3, if present, are independently selected from the group consisting of linear or branched C.sub.1-C.sub.50 alkylene groups, C.sub.2-C.sub.50 alkenylene groups, C.sub.2-C.sub.50 alkynylene groups, C.sub.3-C.sub.50 cycloalkylene groups, C.sub.5-C.sub.50 cycloalkenylene groups, C.sub.8-C.sub.50 cycloalkynylene groups, C.sub.7-C.sub.50 alkylarylene groups, C.sub.7-C.sub.50 arylalkylene groups, C.sub.8-C.sub.50 arylalkenylene groups and C.sub.9-C.sub.50 arylalkynylene groups, the alkylene groups, alkenylene groups, alkynylene groups, cycloalkylene groups, cycloalkenylene groups, cycloalkynylene groups, alkylarylene groups, arylalkylene groups, arylalkenylene groups and arylalkynylene groups being optionally substituted and optionally interrupted by one or more heteroatoms selected from the group of O, S and NR.sup.3, wherein R.sup.3 is independently selected from the group consisting of hydrogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.2 - C.sub.24 alkenyl groups, C.sub.2 - C.sub.24 alkynyl groups and C.sub.3 - C.sub.24 cycloalkyl groups, the alkyl groups, alkenyl groups, alkynyl groups and cycloalkyl groups being optionally substituted.

    [0186] Yet even more preferably, L.sup.1, L.sup.2 and L.sup.3, if present, are independently selected from the group consisting of linear or branched C.sub.1-C.sub.20 alkylene groups, C.sub.2-C.sub.20 alkenylene groups, C.sub.2-C.sub.20 alkynylene groups, C.sub.3-C.sub.20 cycloalkylene groups, C.sub.5-C.sub.20 cycloalkenylene groups, C.sub.8-C.sub.20 cycloalkynylene groups, C.sub.7-C.sub.20 alkylarylene groups, C.sub.7-C.sub.20 arylalkylene groups, C.sub.8-C.sub.20 arylalkenylene groups and C.sub.9-C.sub.20 arylalkynylene groups, the alkylene groups, alkenylene groups, alkynylene groups, cycloalkylene groups, cycloalkenylene groups, cycloalkynylene groups, alkylarylene groups, arylalkylene groups, arylalkenylene groups and arylalkynylene groups being optionally substituted and optionally interrupted by one or more heteroatoms selected from the group of O, S and NR.sup.3, wherein R.sup.3 is independently selected from the group consisting of hydrogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.2 - C.sub.24 alkenyl groups, C.sub.2 - C.sub.24 alkynyl groups and C.sub.3 - C.sub.24 cycloalkyl groups, the alkyl groups, alkenyl groups, alkynyl groups and cycloalkyl groups being optionally substituted.

    [0187] In these preferred embodiments it is further preferred that the alkylene groups, alkenylene groups, alkynylene groups, cycloalkylene groups, cycloalkenylene groups, cycloalkynylene groups, alkylarylene groups, arylalkylene groups, arylalkenylene groups and arylalkynylene groups are unsubstituted and optionally interrupted by one or more heteroatoms selected from the group of O, S and NR.sup.3, preferably O, wherein R.sup.3 is independently selected from the group consisting of hydrogen and C.sub.1 - C.sub.4 alkyl groups, preferably hydrogen or methyl.

    [0188] Most preferably, L.sup.1, L.sup.2 and L.sup.3, if present, are independently selected from the group consisting of linear or branched C.sub.1-C.sub.20 alkylene groups, the alkylene groups being optionally substituted and optionally interrupted by one or more heteroatoms selected from the group of O, S and NR.sup.3, wherein R.sup.3 is independently selected from the group consisting of hydrogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.2 - C.sub.24 alkenyl groups, C.sub.2 - C.sub.24 alkynyl groups and C.sub.3 - C.sub.24 cycloalkyl groups, the alkyl groups, alkenyl groups, alkynyl groups and cycloalkyl groups being optionally substituted. In this embodiment, it is further preferred that the alkylene groups are unsubstituted and optionally interrupted by one or more heteroatoms selected from the group of O, S and NR.sup.3, preferably O and/or or S—S, wherein R.sup.3 is independently selected from the group consisting of hydrogen and C.sub.1 - C.sub.4 alkyl groups, preferably hydrogen or methyl.

    [0189] Preferred linkers L.sup.1, L.sup.2 and L.sup.3 include -(CH.sub.2).sub.n1-, -(CH.sub.2CH.sub.2).sub.n1-, -(CH.sub.2CH.sub.2O).sub.n1-, -(OCH.sub.2CH.sub.2).sub.n1-, -(CH.sub.2CH.sub.2O).sub.n1CH.sub.2CH.sub.2-, -CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2).sub.n1-, -(CH.sub.2CH.sub.2CH.sub.2O).sub.n1-, -(OCH.sub.2CH.sub.2CH.sub.2).sub.n1-, -(CH.sub.2CH.sub.2CH.sub.2o).sub.n1CH.sub.2CH.sub.2CH.sub.2- and -CH.sub.2CH.sub.2CH.sub.2(OCH.sub.2CH.sub.2CH.sub.2).sub.n1-, wherein n1 is an integer in the range of 1 to 50, preferably in the range of 1 to 40, more preferably in the range of 1 to 30, even more preferably in the range of 1 to 20 and yet even more preferably in the range of 1 to 15. More preferably n1 is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, more preferably 1, 2, 3, 4, 5, 6, 7 or 8, even more preferably 1, 2, 3, 4, 5 or 6, yet even more preferably 1, 2, 3 or 4.

    [0190] In a preferred embodiment, at least one of L.sup.1, L.sup.2 and L.sup.3 contains a peptide spacer as known in the art, preferably comprising 2 - 5 amino acids, more preferably a dipeptide or tripeptide spacer, most preferably a dipeptide spacer. Although any peptide spacer may be used, preferably the peptide spacer is selected from Val-Cit, Val-Ala, Val-Lys, Val-Arg, Phe-Cit, Phe-Ala, Phe-Lys, Phe-Arg, Ala-Lys, Leu-Cit, Ile-Cit, Trp-Cit, Ala-Ala-Asn, Ala-Asn, more preferably Val-Cit, Val-Ala, Val-Lys, Phe-Cit, Phe-Ala, Phe-Lys, Ala-Ala-Asn, more preferably Val-Cit, Val-Ala, Ala-Ala-Asn. In one embodiment, the peptide spacer is Val-Cit. In one embodiment, the peptide spacer is Val-Ala.

    [0191] In a preferred embodiment, the peptide spacer is represented by general structure (27):

    ##STR00034##

    [0192] Herein, R.sup.17 = CH.sub.3 or CH.sub.2CH.sub.2CH.sub.2NHC(O)NH.sub.2. The wavy lines indicate the connection to (L.sub.4).sub.n and (L.sup.6).sub.p, preferably L.sup.5 according to structure (27) is connected to (L.sup.4).sub.n via NH and to (L.sup.6).sub.p via C(O).

    [0193] In case linker L.sup.3 is part of linker L.sup.B, i.e. when it provides a link between BM and D, it typically contains a connecting group Z that is formed when D is connected to both reactive moieties Q. The connecting group within linker L.sup.3 may be part of the moieties defined above, or may separately be present within linker L.sup.3. Thus, L.sup.3 as part of linker L.sup.B may contain a moiety Z, which may take any form, and is preferably as defined further below for the connecting group obtained by the reaction of Q and F.

    Reactive Moieties Q and F

    [0194] In the context of the present invention, the term “reactive moiety” may refer to a chemical moiety that comprises a functional group, but also to a functional group itself. For example, a cyclooctynyl group is a reactive group comprising a functional group, namely a C—C triple bond. Similarly, an N-maleimidyl group is a reactive group, comprising a C—C double bond as a functional group. However, a functional group, for example an azido functional group, a thiol functional group or an alkynyl functional group, may herein also be referred to as a reactive group.

    [0195] In order to be reactive in the process according to the invention, reactive moiety Q should be capable of reacting with reactive moiety F present on the functionalized antibody. In other words, reactive moiety Q is reactive towards reactive moiety F present on the functionalized antibody. Herein, a reactive moiety is defined as being “reactive towards” another reactive moiety when said first reactive moiety reacts with said second reactive moiety selectively, optionally in the presence of other functional groups. Complementary reactive moiety are known to a person skilled in the art, and are described in more detail below and are exemplified in FIG. 1. As such, the conjugation reaction is a chemical reaction between Q and F forming a conjugate comprising a covalent connection between the antibody and the polypeptide. The definition of the reactive moiety Q provided here equally applies to F, Q.sup.1 and F.sup.1, except where denoted otherwise.

    [0196] In a preferred embodiment, reactive moiety Q is selected from the group consisting of, optionally substituted, N-maleimidyl groups, ester groups, carbonate groups, protected thiol groups, alkenyl groups, alkynyl groups, tetrazinyl groups, azido groups, phosphine groups, nitrile oxide groups, nitrone groups, nitrile imine groups, diazo groups, ketone groups, (O-alkyl)hydroxylamino groups, hydrazine groups, allenamide groups, triazine groups, phosphonamidite groups. In an especially preferred embodiment, reactive moiety Q is an N-maleimidyl group, a phosphonamidite group, an azide group or an alkynyl group, most preferably reactive moiety Q is an alkynyl group. In case Q is an alkynyl group, it is preferred that Q is selected from terminal alkyne groups, (hetero)cycloalkynyl groups and bicyclo[6.1.0]non-4-yn-9-yl] groups.

    [0197] In a preferred embodiment, Q comprises or is an N-maleimidyl group, preferably Q is a N-maleimidyl group. In case Q is an N-maleimidyl group, Q is preferably unsubstituted. Q is thus preferably according to structure (Q1), as shown below.

    [0198] In another preferred embodiment, Q comprises or is an alkenyl group, including cycloalkenyl groups, preferably Q is an alkenyl group. The alkenyl group may be linear or branched, and is optionally substituted. The alkenyl group may be a terminal or an internal alkenyl group. The alkenyl group may comprise more than one C—C double bond, and preferably comprises one or two C-C double bonds. When the alkenyl group is a dienyl group, it is further preferred that the two C- C double bonds are separated by one C—C single bond (i.e. it is preferred that the dienyl group is a conjugated dienyl group). Preferably said alkenyl group is a C.sub.2 - C.sub.24 alkenyl group, more preferably a C.sub.2 - C.sub.12 alkenyl group, and even more preferably a C.sub.2 - C.sub.6 alkenyl group. It is further preferred that the alkenyl group is a terminal alkenyl group. More preferably, the alkenyl group is according to structure (Q8) as shown below, wherein I is an integer in the range of 0 to 10, preferably in the range of 0 to 6, and p is an integer in the range of 0 to 10, preferably 0 to 6. More preferably, I is 0, 1, 2, 3 or 4, more preferably I is 0, 1 or 2 and most preferably I is 0 or 1. More preferably, p is 0, 1, 2, 3 or 4, more preferably p is 0, 1 or 2 and most preferably p is 0 or 1. It is particularly preferred that p is 0 and I is 0 or 1, or that p is 1 and I is 0 or 1.

    [0199] A particularly preferred alkenyl group is a cycloalkenyl group, including heterocycloalkenyl groups, wherein the cycloalkenyl group is optionally substituted. Preferably said cycloalkenyl group is a C.sub.3 - C.sub.24 cycloalkenyl group, more preferably a C.sub.3 - C.sub.12 cycloalkenyl group, and even more preferably a C.sub.3 - C.sub.8 cycloalkenyl group. In a preferred embodiment, the cycloalkenyl group is a trans-cycloalkenyl group, more preferably a trans-cyclooctenyl group (also referred to as a TCO group) and most preferably a trans-cyclooctenyl group according to structure (Q9) or (Q10) as shown below. In another preferred embodiment, the cycloalkenyl group is a cyclopropenyl group, wherein the cyclopropenyl group is optionally substituted. In another preferred embodiment, the cycloalkenyl group is a norbornenyl group, an oxanorbornenyl group, a norbornadienyl group or an oxanorbornadienyl group, wherein the norbornenyl group, oxanorbornenyl group, norbornadienyl group or an oxanorbornadienyl group is optionally substituted. In a further preferred embodiment, the cycloalkenyl group is according to structure (Q11), (Q12), (Q13) or (Q14) as shown below, wherein X.sub.4 is CH.sub.2 or O, R.sup.27 is independently selected from the group consisting of hydrogen, a linear or branched C.sub.1 - C.sub.12 alkyl group or a C.sub.4 - C.sub.12 (hetero)aryl group, and R.sup.14 is selected from the group consisting of hydrogen and fluorinated hydrocarbons. Preferably, R.sup.27 is independently hydrogen or a C.sub.1 - C.sub.6 alkyl group, more preferably R.sup.27 is independently hydrogen or a C.sub.1 - C.sub.4 alkyl group. Even more preferably R.sup.27 is independently hydrogen or methyl, ethyl, n-propyl, i-propyl, n-butyl, s-butyl or t-butyl. Yet even more preferably R.sup.27 is independently hydrogen or methyl. In a further preferred embodiment, R.sup.14 is selected from the group of hydrogen and —CF.sub.3, —C.sub.2F.sub.5, —C.sub.3F.sub.7 and —C.sub.4F.sub.9, more preferably hydrogen and —CF.sub.3. In a further preferred embodiment, the cycloalkenyl group is according to structure (Q11), wherein one R.sup.27 is hydrogen and the other R.sup.27 is a methyl group. In another further preferred embodiment, the cycloalkenyl group is according to structure (Q12), wherein both R.sup.27 are hydrogen. In these embodiments it is further preferred that I is 0 or 1. In another further preferred embodiment, the cycloalkenyl group is a norbornenyl (X.sup.4 is CH.sub.2) or an oxanorbornenyl (X.sup.4 is O) group according to structure (Q13), or a norbornadienyl (X.sup.4 is CH.sub.2) or an oxanorbornadienyl (X.sup.4 is O) group according to structure (Q14), wherein R.sup.27 is hydrogen and R.sup.14 is hydrogen or —CF.sub.3, preferably —CF.sub.3.

    [0200] In another preferred embodiment, Q comprises or is an alkynyl group, including cycloalkynyl groups, preferably Q comprises an alkynyl group. The alkynyl group may be linear or branched, and is optionally substituted. The alkynyl group may be a terminal or an internal alkynyl group. Preferably said alkynyl group is a C.sub.2 - C.sub.24 alkynyl group, more preferably a C.sub.2 - C.sub.12 alkynyl group, and even more preferably a C.sub.2 - C.sub.6 alkynyl group. It is further preferred that the alkynyl group is a terminal alkynyl group. More preferably, the alkynyl group is according to structure (Q15) as shown below, wherein I is an integer in the range of 0 to 10, preferably in the range of 0 to 6. More preferably, I is 0, 1, 2, 3 or 4, more preferably I is 0, 1 or 2 and most preferably I is 0 or 1.

    [0201] A particularly preferred alkynyl group is a cycloalkynyl group, wherein the cycloalkynyl group is heterocycloalkynyl group or cycloalkynyl group, and is optionally substituted. Preferably, the (hetero)cycloalkynyl group is a (hetero)cyclooctynyl group, i.e. a heterocyclooctynyl group or a cyclooctynyl group, wherein the (hetero)cyclooctynyl group is optionally substituted. In a further preferred embodiment, the (hetero)cyclooctynyl group is according to structure (Q36) and defined further below. Preferred examples of the (hetero)cyclooctynyl group include structure (Q16), also referred to as a DIBO group, (Q17), also referred to as a DIBAC group, or (Q18), also referred to as a BARAC group, (Q19), also referred to as a COMBO group, and (Q20), also referred to as a BCN group, all as shown below, wherein X.sup.5 is O or N R.sup.27, and preferred embodiments of R.sup.27 are as defined above. The aromatic rings in (Q16) are optionally O-sulfonylated at one or more positions, preferably at two positions, most preferably as in (Q40) (sulfonylated dibenzocyclooctyne (s-DIBO)), whereas the rings of (Q17) and (Q18) may be halogenated at one or more positions. A particularly preferred cycloalkynyl group is a bicyclo[6.1.0]non-4-yn-9-yl] group (BCN group), which is optionally substituted. Preferably, the bicyclo[6.1.0]non-4-yn-9-yl] group is according to structure (Q20) as shown below.

    [0202] In another preferred embodiment, Q comprises or is a conjugated (hetero)diene group, preferably Q is a conjugated (hetero)diene group capable of reacting in a Diels-Alder reaction. Preferred (hetero)diene groups include optionally substituted tetrazinyl groups, optionally substituted 1,2-quinone groups and optionally substituted triazine groups. More preferably, said tetrazinyl group is according to structure (Q21), as shown below, wherein R.sup.27 is selected from the group consisting of hydrogen, a linear or branched C.sub.1 - C.sub.12 alkyl group or a C.sub.4 - C.sub.12 (hetero)aryl group. Preferably, R.sup.27 is hydrogen, a C.sub.1 - C.sub.6 alkyl group or a C.sub.4 - C.sub.10 (hetero)aryl group, more preferably R.sup.27 is hydrogen, a C.sub.1 - C.sub.4 alkyl group or a C.sub.4 - C.sub.6 (hetero)aryl group. Even more preferably R.sup.27 is hydrogen, methyl, ethyl, n-propyl, i-propyl, n-butyl, s-butyl, t-butyl or pyridyl. Yet even more preferably R.sup.27 is hydrogen, methyl or pyridyl. More preferably, said 1,2-quinone group is according to structure (Q22) or (Q23). Said triazine group may be any regioisomer. More preferably, said triazine group is a 1,2,3-triazine group or a 1,2,4-triazine group, which may be attached via any possible location, such as indicated in structure (Q24). The 1,2,3-triazine is most preferred as triazine group.

    [0203] In another preferred embodiment, Q comprises or is an azido group, preferably Q is an azido group. Preferably, the azide group is according to structure (Q25) as shown below.

    [0204] In another preferred embodiment, Q comprises or is an allenamide group, preferably Q is an allenamide group. Preferably, the allenamide group is according to structure (Q35).

    [0205] In another preferred embodiment, Q comprises or is an phosphonamidate group, preferably Q is an phosphonamidate group. Preferably, the phosphonamidate group is according to structure (Q36).

    ##STR00035##

    ##STR00036##

    ##STR00037##

    ##STR00038##

    ##STR00039##

    ##STR00040##

    ##STR00041##

    ##STR00042##

    ##STR00043##

    ##STR00044##

    ##STR00045##

    ##STR00046##

    ##STR00047##

    ##STR00048##

    ##STR00049##

    ##STR00050##

    ##STR00051##

    ##STR00052##

    ##STR00053##

    ##STR00054##

    ##STR00055##

    ##STR00056##

    [0206] Herein, the aromatic rings in (Q16) are optionally O-sulfonylated at one or more positions, 5 whereas the rings of (Q17) and (Q18) may be halogenated at one or more positions.

    [0207] In case Q is a cycloalkynyl group, it is preferred to Q is selected from the group consisting of (Q42) - (Q60):

    ##STR00057##

    ##STR00058##

    ##STR00059##

    ##STR00060##

    ##STR00061##

    ##STR00062##

    ##STR00063##

    ##STR00064##

    ##STR00065##

    ##STR00066##

    ##STR00067##

    ##STR00068##

    ##STR00069##

    ##STR00070##

    ##STR00071##

    ##STR00072##

    ##STR00073##

    ##STR00074##

    ##STR00075##

    [0208] Herein, the connection to the remainder of the molecule, depicted with the wavy bond, may be to any available carbon or nitrogen atom of Q. The nitrogen atom of (Q50), (Q53), (Q54) and (Q55) may bear the connection, or may contain a hydrogen atom or be optionally functionalized. B.sup.(-) is an anion, which is preferably selected from .sup.(-)OTf, Cl.sup.(-), Br.sup.(-) or I.sup.(-), most preferably B.sup.(-) is .sup.(-)OTf. In the conjugation reaction, B.sup.(-) does not need to be a pharmaceutically acceptable anion, since B.sup.(-) will exchange with the anions present in the reaction mixture anyway. In case (Q59) is used for Q, the negatively charged counter-ion is preferably pharmaceutically acceptable upon isolation of the antibody construct according to the invention, such that the antibody construct is readily useable as medicament.

    [0209] Q is capable of reacting with a reactive moiety F that is present on an antibody. Complementary reactive groups F for reactive group Q are known to a person skilled in the art, and are described in more detail below. Some representative examples of reaction between F and Q and their corresponding products (connecting group Z) are depicted in FIG. 1.

    [0210] In a preferred embodiment, the conjugation is achieved by cycloaddition or nucleophilic reaction, preferably wherein the cycloaddition is a [4+2] cycloaddition or a 1,3-dipolar cycloaddition and the nucleophilic reaction is a Michael addition or a nucleophilic substitution.

    [0211] Thus, in a preferred embodiment of the conjugation process according to the invention, conjugation is accomplished via a nucleophilic reaction, such as a nucleophilic substitution or a Michael reaction. A preferred Michael reaction is the maleimide-thiol reaction, which is widely employed in bioconjugation. Thus, in a preferred embodiment, Q is reactive in a nucleophilic reaction, preferably in a nucleophilic substitution or a Michael reaction. Herein, it is preferred that Q comprises a maleimide moiety, a haloacetamide moiety, an allenamide moiety, a phosphonamidite moiety, a cyanoethynyl moiety, a vinylsulfone, a vinylpyridine moiety or a methylsulfonylphenyloxadiazole moiety, most preferably a maleimide moiety.

    [0212] In case a nucleophilic reaction is used for the conjugation, it is preferred that the structural moiety Q—(L.sup.1).sub.a—BM—(L.sup.2).sub.b—Q is selected from bromomaleimide, bis-bromomaleimide, bis(phenylthiol)maleimide, bis-bromopyridazinedione, bis(halomethyl)benzene, bis(halomethyl)pyridazine, bis(halomethyl)pyridine or bis(halomethyl)triazole.

    [0213] Thus, in a preferred embodiment of the conjugation process according to the invention, conjugation is accomplished via a cycloaddition, such as a [4+2] cycloaddition or a 1,3-dipolar cycloaddition, preferably the 1,3-dipolar cycloaddition. According to this embodiment, the reactive group Q is selected from groups reactive in a cycloaddition reaction. Herein, reactive groups Q and F are complementary, i.e. they are capable of reacting with each other in a cycloaddition reaction.

    [0214] A typical [4+2] cycloaddition is the Diels-Alder reaction, wherein Q is a diene or a dienophile. As appreciated by the skilled person, the term “diene” in the context of the Diels-Alder reaction refers to 1,3-(hetero)dienes, and includes conjugated dienes (R.sub.2C═CR—CR═CR.sub.2), imines (e.g. R.sub.2C═CR—N═CR.sub.2 or R.sub.2C═CR—CR═NR, R.sub.2C═N—N═CR.sub.2) and carbonyls (e.g. R.sub.2C═CR—CR═O or O═CR—CR═O). Hetero-Diels-Alder reactions with N— and O-containing dienes are known in the art. Any diene known in the art to be suitable for [4+2] cycloadditions may be used as reactive group Q. Preferred dienes include tetrazines as described above, 1,2-quinones as described above and triazines as described above. Although any dienophile known in the art to be suitable for [4+2] cycloadditions may be used as reactive group Q, the dienophile is preferably an alkene or alkyne group as described above, most preferably an alkyne group. For conjugation via a [4+2] cycloaddition, it is preferred that Q is a dienophile (and F is a diene), more preferably Q is or comprises an alkynyl group.

    [0215] For a 1,3-dipolar cycloaddition, Q is a 1,3-dipole or a dipolarophile. Any 1,3-dipole known in the art to be suitable for 1,3-dipolar cycloadditions may be used as reactive group Q. Preferred 1,3-dipoles include azido groups, nitrone groups, nitrile oxide groups, nitrile imine groups and diazo groups. Although any dipolarophile known in the art to be suitable for 1,3-dipolar cycloadditions may be used as reactive groups Q, the dipolarophile is preferably an alkene or alkyne group, most preferably an alkyne group. For conjugation via a 1,3-dipolar cycloaddition, it is preferred that Q is a dipolarophile (and F is a 1,3-dipole), more preferably Q is or comprises an alkynyl group.

    [0216] Thus, in a preferred embodiment, Q is selected from dipolarophiles and dienophiles. Preferably, Q is an alkene or an alkyne group. In an especially preferred embodiment, Q comprises an alkyne group, preferably selected from the alkynyl group as described above, the cycloalkenyl group as described above, the (hetero)cycloalkynyl group as described above and a bicyclo[6.1.0]non-4-yn-9-yl] group. More preferably Q comprises a terminal alkyne or a cyclooctyne moiety, preferably bicyclononyne (BCN), azadibenzocyclooctyne (DIBAC/DBCO), dibenzocyclooctyne (DIBO) or sulfonylated dibenzocyclooctyne (s-DIBO), more preferably BCN or DIBAC/DBCO, most preferably BCN. In alternative preferred embodiment, Q is selected from the formulae (Q5), (Q6), (Q7), (Q8), (Q20) and (Q9), more preferably selected from the formulae (Q6), (Q7), (Q8), (Q20) and (Q9). Most preferably, Q is a bicyclo[6.1.0]non-4-yn-9-yl] group, preferably of formula (Q20). These groups are known to be highly effective in the conjugation with azido-functionalized antibodies.

    [0217] In an especially preferred embodiment, reactive group Q comprises an alkynyl group and is according to structure (Q36):

    ##STR00076##

    Herein: [0218] R.sup.15 is independently selected from the group consisting of hydrogen, halogen, —OR.sup.16, —NO.sub.2, —CN, —S(O).sub.2R.sup.16, C.sub.1 - C.sub.24 alkyl groups, C.sub.6 - C.sub.24 (hetero)aryl groups, C.sub.7 - C.sub.24 alkyl(hetero)aryl groups and C.sub.7 - C.sub.24 (hetero)arylalkyl groups and wherein the alkyl groups, (hetero)aryl groups, alkyl(hetero)aryl groups and (hetero)arylalkyl groups are optionally substituted, wherein two substituents R.sup.15 may be linked together to form an annelated cycloalkyl or an annelated (hetero)arene substituent, and wherein R.sup.16 is independently selected from the group consisting of hydrogen, halogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.6 - C.sub.24 (hetero)aryl groups, C.sub.7 - C.sub.24 alkyl(hetero)aryl groups and C.sub.7 - C.sub.24 (hetero)arylalkyl groups; [0219] X.sub.10 is C(R.sup.17).sub.2, O, S or NR.sup.17, wherein R.sup.17 is R.sup.15; [0220] u is 0, 1, 2, 3, 4 or 5; [0221] u′ is 0, 1, 2, 3, 4 or 5; [0222] wherein u + u′ = 5; [0223] v = 9 or 10.

    [0224] Preferred embodiments of the reactive group according to structure (Q36) are reactive groups according to structure (Q37), (Q6), (Q7), (Q8), (Q9) and (Q20).

    [0225] In an especially preferred embodiment, reactive group Q comprises an alkynyl group and is according to structure (Q37):

    ##STR00077##

    Herein: [0226] R.sup.15 is independently selected from the group consisting of hydrogen, halogen, —OR.sup.16, —NO.sub.2, —CN, —S(O).sub.2R.sup.16, C.sub.1 - C.sub.24 alkyl groups, C.sub.5 - C.sub.24 (hetero)aryl groups, C.sub.7 - C.sub.24 alkyl(hetero)aryl groups and C.sub.7 - C.sub.24 (hetero)arylalkyl groups and wherein the alkyl groups, (hetero)aryl groups, alkyl(hetero)aryl groups and (hetero)arylalkyl groups are optionally substituted, wherein two substituents R.sup.15 may be linked together to form an annelated cycloalkyl or an annelated (hetero)arene substituent, and wherein R.sup.16 is independently selected from the group consisting of hydrogen, halogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.6 - C.sub.24 (hetero)aryl groups, C.sub.7 - C.sub.24 alkyl(hetero)aryl groups and C.sub.7 - C.sub.24 (hetero)arylalkyl groups; [0227] R.sup.18 is independently selected from the group consisting of hydrogen, halogen, C.sub.1 - C.sub.24 25 alkyl groups, C.sub.6 - C.sub.24 (hetero)aryl groups, C.sub.7 - C.sub.24 alkyl(hetero)aryl groups and C.sub.7 - C.sub.24 (hetero)arylalkyl groups; [0228] R.sup.19 is selected from the group consisting of hydrogen, halogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.6 - C.sub.24 (hetero)aryl groups, C.sub.7 - C.sub.24 alkyl(hetero)aryl groups and C.sub.7 - C.sub.24 (hetero)arylalkyl groups, the alkyl groups optionally being interrupted by one of more hetero-atoms selected from the group consisting of O, N and S, wherein the alkyl groups, (hetero)aryl groups, alkyl(hetero)aryl groups and (hetero)arylalkyl groups are independently optionally substituted; and [0229] I is an integer in the range 0 to 10.

    [0230] In a preferred embodiment of the reactive group according to structure (Q37), R.sup.15 is independently selected from the group consisting of hydrogen, halogen, —OR.sup.16, C.sub.1 - C.sub.6 alkyl groups, C.sub.5 - C.sub.6 (hetero)aryl groups, wherein R.sup.16 is hydrogen or C.sub.1 - C.sub.6 alkyl, more preferably R.sup.15 is independently selected from the group consisting of hydrogen and C.sub.1 - C.sub.6 alkyl, most preferably all R.sup.15 are H. In a preferred embodiment of the reactive group according to structure (Q37), R.sup.18 is independently selected from the group consisting of hydrogen, C.sub.1 - C.sub.6 alkyl groups, most preferably both R.sup.18 are H. In a preferred embodiment of the reactive group according to structure (Q37), R.sup.19 is H. In a preferred embodiment of the reactive group according to structure (Q37), I is 0 or 1, more preferably I is 1. An especially preferred embodiment of the reactive group according to structure (Q37) is the reactive group according to structure (Q20).

    Connecting Group Z

    [0231] Z is a connecting group, that covalently connects both parts of the conjugate according to the invention. The term “connecting group” herein refers to the structural element, resulting from the reaction between Q and F, connecting one part of a compound and another part of the same compound. As will be understood by the person skilled in the art, the nature of a connecting group depends on the type of reaction with which the connection between the parts of said compound was obtained. As an example, when the carboxyl group of R—C(O)—OH is reacted with the amino group of H.sub.2N—R′ to form R—C(O)—N(H)—R′, R is connected to R′ via connecting group Z, and Z is represented by the group —C(O)—N(H)—. Since connecting group Z originates from the reaction between Q and F, it can take any form. Moreover, for the working of the present invention, the nature of connecting group Z is not crucial at all.

    [0232] Since up to 10 reactive moiety F can be present or introduced in an antibody, the conjugate according to the present invention may contain per antibody 10 polypeptides D. This is denoted by the label x, which may be an integer in the range 1 - 10, preferably in the range 1 - 8, more preferably x = 1, 2 or 4 or 8, more preferably x = 1 or 2.

    [0233] In the context of the present invention, connecting group Z connects the antibody, optionally via a spacer, to linker L. Numerous reactions are known in the art for the attachment of a reactive group Q to a reactive group F. Consequently, a wide variety of connecting groups Z may be present in the conjugate according to the invention. In one embodiment, the connecting group Z is selected from the options described above, preferably as depicted in FIG. 1.

    [0234] For example, when F comprises or is a thiol group, complementary groups Q include N-maleimidyl groups and alkenyl groups, and the corresponding connecting groups Z are as shown in FIG. 1. When F comprises or is a thiol group, complementary groups Q also include allenamide groups and phosphonamidate groups.

    [0235] For example, when F comprises or is a ketone group, complementary groups Q include (O-alkyl)hydroxylamino groups and hydrazine groups, and the corresponding connecting groups Z are as shown in FIG. 1.

    [0236] For example, when F comprises or is an alkynyl group, complementary groups Q include azido groups, and the corresponding connecting group Z is as shown in FIG. 1.

    [0237] For example, when F comprises or is an azido group, complementary groups Q include alkynyl groups, and the corresponding connecting group Z is as shown in FIG. 1.

    [0238] For example, when F comprises or is a cyclopropenyl group, a trans-cyclooctene group or a cycloalkyne group, complementary groups Q include tetrazinyl groups, and the corresponding connecting group Z is as shown in FIG. 1. In particular cases, Z is only an intermediate structure and will expel N.sub.2, thereby generating a dihydropyridazine (from the reaction with alkene) or pyridazine (from the reaction with alkyne).

    [0239] For example, when F comprises or is a tetrazinyl group, complementary groups Q include a cyclopropenyl group, a trans-cyclooctene group or a cycloalkyne group, and the corresponding connecting group Z is as shown in FIG. 1. In particular cases, Z is only an intermediate structure and will expel N.sub.2, thereby generating a dihydropyridazine (from the reaction with alkene) or pyridazine (from the reaction with alkyne).

    [0240] Additional suitable combinations of F and Q, and the nature of resulting connecting group Z are known to a person skilled in the art, and are e.g. described in G.T. Hermanson, “Bioconjugate Techniques”, Elsevier, 3rd Ed. 2013 (ISBN:978-0-12-382239-0), in particular in Chapter 3, pages 229 - 258, incorporated by reference. A list of complementary reactive groups suitable for bioconjugation processes is disclosed in Table 3.1, pages 230 - 232 of Chapter 3 of G.T. Hermanson, “Bioconjugate Techniques”, Elsevier, 3rd Ed. 2013 (ISBN:978-0-12-382239-0), and the content of this Table is expressly incorporated by reference herein.

    [0241] In a preferred embodiment, connecting group Z is according to any one of structures (Za) to (Zk), as defined below. Preferably, Z is according to structures (Za), (Ze) or (Zj):

    ##STR00078##

    ##STR00079##

    ##STR00080##

    ##STR00081##

    ##STR00082##

    ##STR00083##

    ##STR00084##

    ##STR00085##

    ##STR00086##

    Herein, [0242] X.sup.8 is O or NH. [0243] X.sup.9 is selected from H, C.sub.1-12 alkyl and pyridyl, wherein the C.sub.1-12 alkyl preferably is C.sub.1-4 alkyl, most preferably methyl. [0244] R.sup.23 is C.sub.1-12 alkyl, preferably C.sub.1-4 alkyl, most preferably ethyl. [0245] In structure (Zg) and (Zh), the bond represents either a single or a double bond, and may be connected via either side of this bond to linkers L. [0246] The wavy lines indicate the connection to linkers L. The connectivity depends on the specific nature of Q and F. Although either site of the connecting groups according to (Za) to (Zg) may be connected to L, it is preferred that the left-most of these groups as depicted is connected to (L.sup.1)a/(L.sup.2)b.

    [0247] Connecting group (Zh) typically rearranges to (Zg) with the liberation of N.sub.2.

    [0248] In a preferred embodiment, each Z is independently selected from the group consisting of —O—, —S—, —S—S—, —NR.sup.2—, —N═N—, —C(O)—, —C(O)—NR.sup.2—, —O—C(O)—, —O—C(O)—O—, —O—C(O)—NR.sup.2, —NR.sub.2—C(O)—,—NR.sup.2—C(O)—O—, —NR.sup.2—C(O)—NR.sup.2—, —S—C(O)—, —S—C(O)—O—, —S—C(O)—NR.sup.2—, —S(O)—, —S(O).sup.2—, —O—S(O).sub.2—, —O—S(O).sub.2—O—, —O—S(O).sub.2—NR.sup.2—, —O—S(O)—, —O—S(O)—O—, —O—S(O)—NR.sup.2—, —O—NR.sup.2—C(O)—, —O—NR.sup.2—C(O)—O—, —O—NR.sup.2—C(O)—NR.sup.2—, —NR.sup.2—O—C(O)—, —NR.sup.2—O—C(O)—O—, —NR.sup.2—O—C(O)—NR.sup.2—, —O—NR.sup.2—C(S)—, —O—NR.sup.2—C(S)—O—, —O—NR.sup.2—C(S)—NR.sup.2—, —NR.sup.2—O—C(S)—, —NR.sup.2—O—C(S)—O—, —NR.sup.2—O—C(S)—NR.sup.2—, —O—C(S)—, —O—C(S)—O—, —O—C(S)—NR.sup.2—, —NR.sup.2—C(S)—, —NR.sup.2—C(S)—O—, —NR.sup.2—C(S)—NR.sup.2—, —S—S(O).sub.2—, —S—S(O).sub.2—O—, —S—S(O).sub.2—NR.sup.2—, —NR.sub.2—O—S(O)—, —NR.sup.2—O—S(O)—O—, —NR.sup.2—O—S(O)—NR.sup.2—, —NR.sup.2—O—S(O).sub.2—, —NR.sup.2—O—S(O).sub.2—O—, —NR.sup.2—O—S(O).sub.2—NR.sup.2—, —O—NR.sup.2—S(O)—, —O—NR.sup.2—S(O)—O—,—O—NR.sup.2—S(O)—NR.sup.2—, —O—NR.sup.2—S(O).sup.2—O—, —O—NR.sup.2—S(O).sub.2—NR.sup.2—, —O—NR.sup.2—S(O).sub.2—, —O—P(O)(R.sup.2).sub.2—, —S—P(O)(R.sup.2).sub.2—, —NR.sub.2—P(O)(R.sup.2).sub.2— and the moieties represented by any one of (Za) -(Zi). Herein, R.sup.2 is independently selected from the group consisting of hydrogen, C.sub.1 - C.sub.24 alkyl groups, C.sub.2 - C.sub.24 alkenyl groups, C.sub.2 - C.sub.24 alkynyl groups and C.sub.3 - C.sub.24 cycloalkyl groups, the alkyl groups, alkenyl groups, alkynyl groups and cycloalkyl groups being optionally substituted.

    [0249] More preferably, each Z contains a moiety selected from the group consisting of a succinimide, a triazole, a cyclohexene, a cyclohexadiene, an isoxazoline, an isoxazolidine, a pyrazoline, a piperazine, a thioether, an amide or an imide group. Preferably, Z comprises a moiety selected from selected from the group consisting of a triazole, a cyclohexene, a cyclohexadiene, an isoxazoline, an isoxazolidine, a pyrazoline, a piperazine, a thioether, an amide or an imide group. In an especially preferred embodiment, Z comprises a triazole moiety or a succinimide moiety. Triazole moieties are especially preferred to be present in Z.

    [0250] In an especially preferred embodiment, connecting group Z comprises a triazole moiety and is according to structure (Zj):

    ##STR00088##

    Herein, R.sup.15, X.sup.10, u, u′ and v are as defined for (Q36), and all preferred embodiments thereof equally apply to (Zj). The wavy lines indicate the connection to adjacent moieties (Su and (L.sup.1).sub.a or (L.sup.2).sub.b), and the connectivity depends on the specific nature of Q and F. Although either site of the connecting group according to (Zj) may be connected to (L.sup.1)a/(L.sup.2)b, it is preferred that the upperwavy bond as depicted represents the connectivity to Su. The connecting groups according to structure (Zf) and (Zk) are preferred embodiments of the connecting group according to (Zj).

    [0251] In an especially preferred embodiment, connecting group Z comprises a triazole moiety and is according to structure (Zk):

    ##STR00089##

    [0252] Herein, R.sup.15, R.sup.18, R.sup.19, and I are as defined for (Q37), and all preferred embodiments thereof equally apply to (Zj). The wavy lines indicate the connection to adjacent moieties (Su and (L.sup.1)a or (L.sup.2)b), and the connectivity depends on the specific nature of Q and F. Although either site of the connecting group according to (Zj) may be connected to (L.sup.1)a, it is preferred that the left wavy bond as depicted represents the connectivity to Su.

    [0253] In a preferred embodiment, Q comprises or is an alkyne moiety and F is an azido moiety, such that connecting group Z comprises an triazole moiety. Preferred connecting groups comprising a triazole moiety are the connecting groups according to structure (Ze) or (Zj), wherein the connecting groups according to structure (Zj) is preferably according to structure (Zk) or (Zf). In a preferred embodiment, the connecting groups is according to structure (Zj), more preferably according to structure (Zk) or (Zf).

    Immune Cell-engaging Polypeptides

    [0254] In a further aspect, the invention concerns immune cell-engaging polypeptides comprising one or two reactive moieties Q. Preferably, the immune cell-engaging polypeptide according to the invention has two moieties Q. The immune cell-engaging polypeptide according to the invention has structure (Q).sub.2—L—D. Herein, D is an immune cell-engaging polypeptide, which is defined above; L is a linker, which is defined above; and Q is a reactive group as defined above. The definitions, including preferred embodiments, recited above are equally applicable to the immune cell-engaging polypeptide according to the invention.

    [0255] In a preferred embodiment, the immune cell-engaging polypeptide according to the invention has structure (12a):

    ##STR00090##

    [0256] The immune cell-engaging polypeptide according to the invention is especially suitable as intermediate in the preparation of multispecific antibody constructs according to the invention.

    Multispecific Antibody Construct

    [0257] The invention further concerns the multispecific antibody construct obtainable by the process according to the invention. In one embodiment, the multispecific antibody construct according to the invention has structure (13a) or (13b). The multispecific antibody construct of structure (13b) preferably has the structure (13c).

    ##STR00091##

    ##STR00092##

    ##STR00093##

    [0258] Herein, Ab, Z, L, D, x, L.sup.1, L.sup.2, L.sup.3, a, b, c and BM are as defined above, including preferred embodiments thereof.

    Application

    [0259] The multispecific antibody constructs according to the invention, or the multispecific antibody constructs obtainable by the process according to the invention, are especially suitable in the treatment of cancer. The invention thus further concerns the use of the multispecific antibody construct according to the invention in medicine. In a further aspect, the invention also concerns a method of treating a subject in need thereof, comprising administering the multispecific antibody construct according to the invention to the subject. The method according to this aspect can also be worded as the multispecific antibody construct according to the invention for use in treatment. The method according to this aspect can also be worded as use of the multispecific antibody construct according to the invention for the manufacture of a medicament. Herein, administration typically occurs with a therapeutically effective amount of the multispecific antibody construct according to the invention.

    [0260] The invention further concerns a method for the treatment of a specific disease in a subject in need thereof, comprising the administration of the multispecific antibody construct according to the invention as defined above. The specific disease may be selected from cancer, a viral infection, a bacterial infection, a neurological disease, an autoimmune disease, an eye disease, hypercholesterolaemia and amyloidosis, more preferable from cancer and a viral infection, most preferably the disease is cancer. The subject in need thereof is typically a cancer patient. The use of multispecific antibody construct according to the invention is well-known in such treatments, especially in the field of cancer treatment, and the multispecific antibody constructs according to the invention are especially suited in this respect. In the method according to this aspect, the multispecific antibody construct is typically administered in a therapeutically effective amount. The present aspect of the invention can also be worded as a multispecific antibody construct according to the invention for use in the treatment of a specific disease in a subject in need thereof, preferably for the treatment of cancer. In other words, this aspect concerns the use of a multispecific antibody construct according to the invention for the preparation of a medicament or pharmaceutical composition for use in the treatment of a specific disease in a subject in need thereof, preferably for use in the treatment of cancer.

    [0261] It is preferred that the multispecific antibody construct according to the invention is Fc-silent, i.e. does not significantly bind to Fc gamma receptors CD16 when used in clinically. This is the case when G is absent, i.e. that e = 0. Preferably, also the binding towards CD32 and CD64 is significantly reduced.

    [0262] The invention further concerns a method for associating an immune cell with a tumour cell. A sample comprising the immune cell and the tumour cell is contacted with the multispecific antibody construct according to the invention. The immune cell binds to the immune cell-engaging peptide and the tumour cell to the antibody, as such a complex association of tumour cell, immune cell and multispecific antibody construct. This contacting may take place in a sample in vitro, e.g. taking from a subject, or in vivo within a subject, in which case the multispecific antibody construct according to the invention is administered to the subject.

    [0263] Administration in the context of the present invention refers to systemic administration. Hence, in one embodiment, the methods defined herein are for systemic administration of the multispecific antibody construct. In view of the specificity of the multispecific antibody constructs, they can be systemically administered, and yet exert their activity in or near the tissue of interest (e.g. a tumour). Systemic administration has a great advantage over local administration, as the drug may also reach tumour metastasis not detectable with imaging techniques and it may be applicable to hematological tumours.

    [0264] The invention further concerns a pharmaceutical composition comprising the antibody-payload conjugate according to the invention and a pharmaceutically acceptable carrier.

    EXAMPLES

    [0265] The invention is illustrated by the following examples.

    General Procedures

    [0266] Chemicals were purchased from commonly used suppliers (Sigma-Aldrich, Acros, Alfa Aesar, Fluorochem, Apollo Scientific Ltd and TCI) and were used without further purification. Solvents (including dry solvents) for chemical transformations, work-up and chromatography were purchased from Aldrich (Dorset, UK) at HPLC grade, and used without further distillation. Silica gel 60 F254 analytical thin layer chromatography (TLC) plates were from Merck (Darmstadt, Germany) and visualized under UV light, with potassium permanganate stain or anisaldehyde stain. Chromatographic purifications were performed using Acros silica gel (0.06-0.200, 60A) or prepacked columns (Screening Devices) in combination with a Buchi Sepacore C660 fraction collector (Flawil, Switzerland). Reversed phase HPLC purifications were performed using an Agilent 1200 system equipped with a Waters Xbridge C18 column (5 .Math.m OBD, 30 x 100 mm, PN186002982). Deuterated solvents used for NMR spectroscopy were obtained from Cambridge Isotope Laboratories. Bis-mal-Lys-PEG.sub.4-TFP ester (177) was obtained from Quanta Biodesign, O-(2-aminoethyl)-O′-(2-azidoethyl)diethylene glycol (XL07) and compounds 344 and 179 were obtained from Broadpharm, 2,3-bis(bromomethyl)-6-quinoxalinecarboxylic acid (178) was obtained from ChemScene and 32-azido-5-oxo-3,9,12,15,18,21,24,27,30-nonaoxa-6-azadotriacontanoic acid (348) was obtained from Carbosynth.

    General Procedure for Mass Spectral Analysis of Monoclonal Antibodies and ADCs

    [0267] Prior to mass spectral analysis, IgG was treated with IdeS (Fabricator™) for analysis of the Fc/2 fragment. A solution of 20 .Math.g (modified) IgG was incubated for 1 hour at 37° C. with 0.5 .Math.L IdeS (50 U/.Math.L) in phosphate-buffered saline (PBS) pH 6.6 in a total volume of 10 .Math.L. Samples were diluted to 40 .Math.L followed by electrospray ionization time-of-flight (ESI-TOF) analysis on a JEOL AccuTOF. Deconvoluted spectra were obtained using Magtran software.

    General Procedure for Analytical RP-HPLC

    [0268] Prior to RP-HPLC analysis, IgG was treated with IdeS, which allows analysis of the Fc/2 fragment. A solution of (modified) IgG (100 .Math.L, 1 mg/mL in PBS pH 7.4) was incubated for 1 hour at 37° C. with 1.5 .Math.L IdeSfFabricator™ (50 U/.Math.L) in phosphate-buffered saline (PBS) pH 6.6. The reaction was quenched by adding 49% acetonitrile, 49% water, 2% formic acid (100 .Math.L). RP-HPLC analysis was performed on an Agilent 1100 series (Hewlett Packard). The sample (10 .Math.L) was injected with 0.5 mL/min onto a ZORBAX Poroshell 300SB-C8 column (1x75 mm, 5 .Math.m, Agilent) with a column temperature of 70° C. A linear gradient was applied in 25 minutes from 30 to 54% acetonitrile and water in 0.1% TFA.

    General Procedure for Analytical HPLC-SEC

    [0269] HPLC-SEC analysis was performed on an Agilent 1100 series (Hewlett Packard). The sample (4 .Math.L, 1 mg/mL) was injected with 0.86 mL/min onto a Xbridge BEH200A (3.5 .Math.M, 7.8x300 mm, PN186007640 Waters) column. Isocratic elution using 0.1 M sodium phosphate buffer pH 6.9 (NaH.sub.2PO.sub.4/Na.sub.2HPO.sub.4) was performed for 16 minutes.

    Example 1. Synthesis of Compound 102

    [0270] ##STR00094##

    To a cooled (0° C.) solution of 4-nitrophenyl chloroformate (30.5 g, 151 mmol) in DCM (500 mL) was added pyridine (24.2 mL, 23.7 g, 299 mmol). A solution of BCN-OH (101, 18.0 g, 120 mmol) in DCM (200 mL) was added dropwise to the reaction mixture. After the addition was completed, a saturated aqueous solution of NH.sub.4Cl (500 mL) and water (200 mL) were added. After separation, the aqueous phase was extracted with DCM (2 × 500 mL). The combined organic phases were dried (Na.sub.2SO.sub.4) and concentrated. The crude material was purified by silica gel chromatography and the desired product 102 was obtained as an off-white solid (18.7 g, 59 mmol, 39%). .sup.1H NMR (400 MHz, CDCl.sub.3) δ (ppm) 8.32-8.23 (m, 2H), 7.45-7.34 (m, 2H), 4.40 (d, J = 8.3 Hz, 2H), 2.40-2.18 (m, 6H), 1.69-1.54 (m, 2H), 1.51 (quintet, J= 9.0 Hz, 1H), 1.12-1.00 (m, 2H)

    ##STR00095##

    Example 2. Synthesis of Compound 104

    [0271] To a cooled solution (-5° C.) of azido-PEG.sub.11-amine (103) (182 mg, 0.319 mmol) in THF (3 mL) were added a 10% aqueous NaHCO.sub.3 solution (1.5 mL) and 9-fluorenylmethoxycarbonyl chloride (99 mg, 0.34 mmol) dissolved in THF (2 mL). After 2 h, EtOAc (20 mL) was added and the mixture was washed with brine (2 × 6 mL), dried over MgSO.sub.4, and concentrated. Purification by silica gel column chromatography (0 .fwdarw. 11% MeOH in DCM) gave 104 as a clear oil in 98% yield (251 mg, 0.316 mmol). LCMS (ESI+) calculated for C.sub.39H.sub.60N.sub.4O.sub.13+(M+Na+) 815.42 found 815.53.

    Example 3. Synthesis of Compound 105

    [0272] A solution of 104 (48 mg, 0.060 mmol) in THF (3 mL) and water (0.2 mL) was prepared and cooled down to 0° C. Trimethylphosphine (1 M in toluene, 0.24 mL, 0.24 mmol) was added and the mixture was left stirring for 23 h. The water was removed via extraction with DCM (6 mL). To this solution, (1R,8S,9 s)-bicyclo[6.1.0]non-4-yn-9-ylmethyl (4-nitrophenyl) carbonate (102) (25 mg, 0.079 mmol) and triethylamine (10 .Math.L, 0.070 mmol) were added. After 27 h, the mixture was concentrated and the residue was dissolved in DMF (3 mL), followed by the addition of piperidine (400 .Math.L). After 1 h, the mixture was concentrated and the residue was purified by silica gel column chromatography (0 .fwdarw. 21% MeOH in DCM), which gave 105 as a colorless oil (8.3 mg, 0.0092 mmol). LCMS (ESI+) calculated for C.sub.46H.sub.76N.sub.2O.sub.15+(M+NH.sub.4+) 914.52 found 914.73.

    ##STR00096##

    Example 4. Synthesis of Compound 107

    [0273] A solution of (1R,8S,9 s)-bicyclo[6.1,0]non-4-yn-9-ylmethyl (4-nitrophenyl) carbonate (102) (4.1 mg, 0.013 mmol) in dry DCM (500 .Math.L) was slowly added to a solution of amino-PEG23-amine (106) (12.3 mg, 0.0114 mmol) in dry DCM (500 .Math.L). After 20 h, the mixture was concentrated and the residue was purified by silica gel column chromatography (0 .fwdarw. 25% MeOH in DCM) which gave the desired compound 107 in 73% yield (12 mg, 0.0080 mmol). LCMS (ESI+) calculated for C.sub.70H.sub.124N.sub.2O.sub.27+(M+ NH.sub.4+) 1443.73 found 1444.08.

    ##STR00097##

    Example 5. Synthesis of Compound 108

    [0274] To a solution of BCN-OH (101, 21.0 g, 0.14 mol) in MeCN (450 mL) were added disuccinimidyl carbonate (53.8 g, 0.21 mol) and triethylamine (58.5 mL, 0.42 mol). After the mixture was stirred for 140 minutes, it was concentrated in vacuo and the residue was co-evaporated once with MeCN (400 mL). The residue was dissolved in EtOAc (600 mL) and washed with H.sub.2O (3 × 200 mL). The organic layer was dried over Na.sub.2SO.sub.4 and concentrated in vacuo. The residue was purified by silica gel column chromatography (0 .fwdarw. 4% EtOAc in DCM) and gave 108 (11.2 g, 38.4 mmol, 27% yield) as a white solid. .sup.1H NMR (400 MHz, CDCl.sub.3): δ (ppm) 4.45 (d, 2H, J = 8.4 Hz), 2.85 (s, 4H), 2.38-2.18 (m, 6H), 1.65- 1.44 (m, 3H), 1.12-1.00 (m, 2H).

    Example 6. Synthesis of Compound 110

    [0275] To a solution of (1R,8 S,9 s)-bicyclo[6.1,0]non-4-yn-9-ylmethyl N-succinimidyl carbonate (108) (500 mg, 1.71 mmol) in DCM (15 mL) were added triethylamine (718 uL, 5.14 mmol) and mono-Fmoc ethylenediamine hydrochloride (109) (657 mg, 2.06 mmol). The mixture was stirred for 45 min,diluted with EtOAc (150 mL) and washed with a 50% saturated aqueous NH.sub.4Cl solution (50 mL). The aqueous layer was extracted with EtOAc (50 mL) and the combined organic layers were washed with H.sub.2O (10 mL). The combined organic extracts were concentrated in vacuo and the half of the residue was purified by silica gel column chromatography (0 .fwdarw. 3% MeOH in DCM) which gave the desired compound 110 in 42% yield (332 mg, 0.72 mmol). .sup.1H NMR (400 MHz, CDCl.sub.3) δ (ppm) 7.77 (d, J = 7.5 Hz, 2H), 7.59 (d, J = 7.4 Hz, 2H), 7.44-7.37 (m, 2H), 7.36-7.28 (m, 2H), 5.12 (br s, 1H), 4.97 (br s, 1H), 44.41 (d, J = 6.8 Hz, 2H), 4.21 (t, J = 6.7 Hz, 1H), 4.13 (d, J = 8.0 Hz, 2H), 3.33 (br s, 4H), 2.36-2.09 (m, 6H), 1.67-1.45 (m, 2H), 1.33 (quintet, J = 8.6 Hz, 1H), 1.01-0.85 (m, 2H). LCMS (ESI+) calculated for C.sub.28H.sub.31N.sub.2O.sub.4+(M+ H+) 459.23 found 459.52.

    Example 7. Synthesis of Compound 111

    [0276] Compound 110 (327 mg, 0.713 mmol) was dissolved in DMF (6 mL) and piperidine (0.5 mL) was added. After 2 h, the mixture was concentrated and the residue was purified by silica gel column chromatography (0 .fwdarw. 32% 0.7 N NH.sub.3 MeOH in DCM), which gave the desired compound 111 as a yellow oil (128 mg, 0.542 mmol, 76%). .sup.1H-NMR (400 MHz, CDCl.sub.3) δ (ppm, rotamers) 5.2 (bs, 1H), 4.15 (d, J = 8.0 Hz, 2H), 3.48-3.40 (m, ⅔H), 3.33-3.27 (m, ⅔H), 3.27-3.19 (m, 1⅓H), 2.85-2.80 (m, 1 ⅓H), 2.36-2.17 (m, 6H), 1.67-1.50 (m, 2H), 1.36 (quintet, J= 8.5 Hz, 1H), 1.01-0.89 (m, 2H).

    ##STR00098##

    Example 8. Synthesis of Compound 114

    [0277] To a solution of diethanolamine (112) (208 mg, 1.98 mmol) in water (20 mL) were added MeCN (20 mL), NaHCOs (250 mg, 2.97 mmol) and a solution of Fmoc—OSu (113) (601 mg, 1.78 mmol) in MeCN (20 mL). The mixture was stirred for 2 h and DCM (50 mL) was added. After separation, the organic phase was washed with water (20 mL), dried (Na.sub.2SO.sub.4) and concentrated. The desired product 114 was obtained as a colorless thick oil (573 mg, 1.75 mmol, 98%). .sup.1H NMR (400 MHz, CDCl.sub.3) δ (ppm) 7.79-7.74 (m, 2H), 7.60-7.54 (m, 2H), 7.44-7.37 (m, 2H), 7.36-7.30 (m, 2H), 4.58 (d, J = 5.4 Hz, 2H), 4.23 (t, J = 5.3 Hz, 1H), 3.82-3.72 (m, 2H), 3.48-3.33 (m, 4H), 3.25-3.11 (m, 2H).

    Example 9. Synthesis of Compound 116

    [0278] To a solution of 114 (567 mg, 1.73 mmol) in DCM (50 mL) were added 4-nitrophenyl chloroformate (115) (768 mg, 3.81 mmol) and Et.sub.3N (1.2 mL, 875 mg). The mixture was stirred for 18h and concentrated. The residue was purified by silica gel chromatography (0% .fwdarw. 10% MeOH in DCM, then 20% .fwdarw. 70% EtOAc in heptane, which afforded 32 mg (49 .Math.mol, 2.8%) of the desired product 116. .sup.1H NMR (400 MHz, CDCl.sub.3) δ (ppm) 8.31-8.20 (m, 4H), 7.80-7.74 (m, 2H), 7.59-7.54 (m, 2H), 7.44-7.37 (m, 2H), 7.37-7.29 (m, 6H), 4.61 (d, J = 5.4 Hz, 2H), 4.39 (t, J = 5.1 Hz, 2H), 4.25 (t, J = 5.5 Hz, 1H), 4.02 (t, J = 5.0 Hz, 2H), 3.67 (t, J = 4.8 Hz, 2H), 3.45 (t, J = 5.2 Hz, 2H).

    ##STR00099##

    Example 10. Synthesis of Compound 117

    [0279] To a solution of 116 (34 mg, 0.050 mmol) in DCM (2 mL) were added 111 (49 mg, 0.21 mmol) and triethylamine (20 .Math.L, 0.14 mmol). The mixture was left stirring overnight at room temperature. After 23 h, the mixture was concentrated. Purification by silica gel column chromatography (0 .fwdarw. 40% MeOH in DCM) gave 117 as a white solid in 61% yield (27 mg, 0.031 mmol). LCMS (ESI+) calculated for C.sub.47H.sub.57N.sub.5O.sub.10+(M+H.sup.+) 851.41 found 852.49.

    Example 11. Synthesis of Compound 118

    [0280] Compound 118 was obtained during the preparation of 117 (3.8 mg, 0.0060 mmol). LCMS (ESI+) calculated for C.sub.32H.sub.47N.sub.5O.sub.8.sup.+(M+H.sup.+) 629.34 found 630.54.

    ##STR00100##

    Example 12. Synthesis of Compound 121

    [0281] A solution of diethylenetriamine (119) (73 .Math.L, 0.67 mmol) and triethylamine (283 .Math.L, 2.03 mmol) in THF (6 mL) was cooled down to -5° C. and placed under a nitrogen atmosphere. 2-(Boc-oxyimino)-2-phenylacetonitrile (120) (334 mg, 1.35 mmol) was dissolved in THF (4 mL) and slowly added to the cooled solution. After 2.5 h, the ice bath was removed and the mixture was stirred for an additional of 2.5 h at room temperature, and concentrated in vacuo. The residue was redissolved in DCM (15 mL) and washed with a 5% aqueous NaOH solution (2 × 5 mL), brine (2 × 5 mL) and dried over MgSO.sub.4. Purification by silica gel column chromatography (0 .fwdarw. 14% MeOH in DCM) gave 121 as a colorless oil in 91% yield (185 mg, 0.610 mmol). .sup.1H-NMR (400 MHz, CDCl.sub.3) δ (ppm) 5.08 (s, 2H), 3.30-3.12 (m, 4H), 2.74 (t, J = 5.9 Hz, 4H), 1.45 (s, 18H).

    Example 13. Synthesis of Compound 123

    [0282] To a cooled solution (-10° C.) of 121 (33.5 mg, 0.110 mmol) in THF (2 mL) were added a 10% aqueous NaHCO.sub.3 solution (500 .Math.L) and 9-fluorenylmethoxycarbonyl chloride (122) (34 mg, 0.13 mmol) dissolved in THF (1 mL). After 1 h, the mixture was concentrated and the residue was redissolved in EtOAc (10 mL), washed with brine (2 × 5 mL), dried over Na.sub.2SO.sub.4, and concentrated. Purification by silica gel column chromatography (0 .fwdarw. 50% MeOH in DCM) gave 123 in 86% yield (50 mg, 0.090 mmol). .sup.1H-NMR (400 MHz, CDCl.sub.3) δ (ppm) 7.77 (d, J = 7.4 Hz, 2H), 7.57 (d, J = 7.4 Hz, 2H), 7.43-7.38 (m, 2H), 7.36-7.31 (m, 2H), 5.57 (d, J = 5.2 Hz, 2H), 4.23 (t, J = 5.1 Hz, 1H), 3.40-2.83 (m, 8H), 1.41 (s, 18H).

    ##STR00101##

    Example 14. Synthesis of Compound 124

    [0283] To a solution of 123 (50 mg, 0.095 mmol) in DCM (3 mL) was added 4 M HCl in dioxane (200 .Math.L). The mixture was stirred for 19 h, concentrated and a white solid was obtained (35 mg). without purification, the deprotected intermediate and (1R,8 S,9 s)-bicyclo[6.1.0]non-4-yn-9-ylmethyl (4-nitrophenyl) carbonate (102) (70 mg, 0.22 mmol) were dissolved in DMF (3 mL) and triethylamine (34 .Math.L, 0.24 mmol) was added. After 2 h, the mixture was concentrated and the residue was purified by silica gel column chromatography (0 .fwdarw. 25% MeOH in DCM) to yield 124 in 48% (31 mg, 0.045 mmol). LCMS (ESI+) calculated for C.sub.41H.sub.47N.sub.3O.sub.6.sup.+ (M+H.sup.+) 677.35 found 678.57.

    Example 15. Synthesis of Compound 125

    [0284] To a solution of 124 (10 mg, 0.014 mmol) in DMF (500 .Math.L) was added piperidine (20 .Math.L). After 3.5 h, the mixture was concentrated. Purification by silica gel column chromatography (0 .fwdarw. 20% MeOH in DCM) gave 125 in 58% yield (3.7 mg, 0.0080 mmol). LCMS (ESI+) calculated for C.sub.26H.sub.37N.sub.3O.sub.4.sup.+ (M+H.sup.+) 455.28 found 456.41.

    ##STR00102##

    Example 16. Synthesis of Compound 127 and 128

    [0285] To a solution of diethyleneglycol (126) (446 .Math.L, 0.50 g, 4.71 mmol) in DCM (20 mL) were added 4-nitrophenol chloroformate (115) (1.4 g, 7.07 mmol) and Et.sub.3N (3.3. mL, 2.4 g, 23.6 mmol). The mixture was stirred, filtered and concentrated in vacuo (at 55° C.). The residue was purified by silica gel chromatography (15% .fwdarw. 75% EtOAc in heptane) and two products were isolated. Product 127 was obtained as a white solid (511 mg, 1.17 mmol, 25%)..sup.1H NMR (400 MHz, CDCl.sub.3) δ (ppm) 8.31-8.23 (m, 4H), 7.43-7.34 (m, 4H), 4.54-4.44 (m, 4H), 3.91-3.83 (m, 4H). Product 128 was obtained as a colorless oil (321 mg, 1.18 mmol, 25%)..sup.1H NMR (400 MHz, CDCl.sub.3) δ (ppm) 8.32-8.24 (m, 2H), 7.43-7.36 (m, 2H), 4.50-4.44 (m, 2H), 3.86-3.80 (m, 2H), 3.81-3.74 (m, 2H), 3.69-3.64 (m, 2H).

    ##STR00103##

    Example 17. Synthesis of Compound 132

    [0286] To a solution of 121 (168 mg, 0.554 mmol) in DCM (2 mL), were added a solution of 128 (240 mg, 0.89 mmol) in DCM (1 mL), DCM (1 mL) and Et.sub.3N (169 mg, 233 .Math.L). The mixture was stirred for 17 h, concentrated and purified by silica gel chromatography (gradient of EtOAc in heptane). The desired product 132 was obtained as a slightly yellow oil (85 mg, 0.20 mmol, 35%). .sup.1H NMR (400 MHz, CDCl.sub.3) δ (ppm) 5.24-5.02 (m, 2H), 4.36-4.20 (m, 3H), 3.84-3.67 (m, 4H), 3.65-3.58 (m, 2H), 3.47-3.34 (m, 4H), 3.34-3.18 (m, 4H), 1.44 (bs, 18H).

    Example 18. Synthesis of Compound 134

    [0287] To a solution of 132 (81 mg, 0.19 mmol) in DCM (3 mL) was added 4 N HCl in dioxane (700 .Math.L). The mixture was stirred for 19 h, concentrated and the residue was taken up in DMF (0.5 mL). Et.sub.3N (132 .Math.L, 96 mg, 0.95 mmol), DMF (0.5 mL) and (1R,8 S,9 s)-bicyclo[6.1,0]non-4-yn-9-ylmethyl (4-nitrophenyl) carbonate (102) (132 mg, 0.42 mmol) were added and the resulting mixture was stirred for 2 h. The mixture was concentrated and the residue was purified by silica gel chromatography (0% .fwdarw. 3% MeOH in DCM). The desired product 134 was obtained as a colorless film (64 mg, 0.11 mmol, 57%). .sup.1H NMR (400 MHz, CDCl.sub.3) δ (ppm) 4.31-4.23 (m, 2H), 4.22-4.08 (m, 4H), 3.80-3.68 (m, 4H), 3.66-3.58 (m, 2H), 3.50-3.28 (m, 8H), 2.80-2.65 (m, 1H), 2.40-2.10 (m, 12H), 1.68-1.48 (m, 4H), 1.35 (quintet, J = 8.1 Hz, 1H), 1.02-0.87 (m, 2H). LCMS (ESI+) calculated for C.sub.31H.sub.46N.sub.3O.sub.8.sup.+ (M+H.sup.+) 588.33 found 588.43.

    ##STR00104##

    Example 19. Synthesis of Compound 141

    [0288] To a solution of (1R,8S,9S)-bicyclo[6.1.0]non-4-yn-9-ylmethyl N-succinimidyl carbonate (108) (16.35 g, 56.13 mmol) in DCM (400 ml) were added 2-(2-aminoethoxy)ethanol (140) (6.76 ml, 67.35 mmol) and triethylamine (23.47 ml, 168.39 mmol). The resulting pale yellow solution was stirred at rt for 90 min. The mixture was concentrated in vacuo and the residue was co-evaporated once with acetonitrile (400 mL). The resulting oil was dissolved in EtOAc (400 mL) and washed with H.sub.2O (3 × 200 mL). The organic layer was concentrated in vacuo. The residue was purified by silica gel column chromatography (50% .fwdarw. 88% EtOAc in heptane) and gave 141 (11.2 g, 39.81 mmol, 71% yield) as a pale yellow oil. .sup.1H-NMR (400 MHz, CDCl.sub.3): δ (ppm) 5.01 (br s, 1H), 4.17 (d, 2H, J= 12.0 Hz), 3.79-3.68 (m, 2H), 3.64-3.50 (m, 4H), 3.47-3.30 (m, 2H), 2.36-2.14 (m, 6H), 1.93 (br s, 1H), 1.68-1.49 (m, 2H), 1.37 (quintet, 1H, J= 8.0 Hz), 1.01-0.89 (m, 2H).

    Example 20. Synthesis of Compound 142

    [0289] To a solution of 141 (663 mg, 2.36 mmol) in DCM (15 mL) were added triethylamine (986 uL, 7.07 mmol) and 4-nitrophenyl chloroformate (115) (712 mg, 3.53 mmol). The mixture was stirred for 4 h and concentrated in vacuo. Purification by silica gel column chromatography (0 .fwdarw. 20% EtOAc in heptane) gave 142 (400 mg, 0.9 mmol, yield 38%) as a pale yellow oil. .sup.1H-NMR (400 MHz, CDCl.sub.3) δ (ppm) 8.29 (d, J = 9.4 Hz, 2H), 7.40 (d, J = 9.3 Hz, 2H), 5.05 (br s, 1H), 4.48-4.41 (m, 2H), 4.16 (d, J = 8.0 Hz, 2H), 3.81-3.75 (m, 2H), 3.61 (t, J = 5.0 Hz, 2H), 3.42 (q, J = 5.4 Hz, 2H), 2.35-2.16 (m, 6H), 1.66-1.50 (m, 2H), 1.35 (quintet, J = 8.6 Hz, 1H), 1.02-0.88 (m, 2H). LCMS (ESI+) calculated for C.sub.22H.sub.26N.sub.2NaO.sub.8.sup.+(M+Na.sup.+) 469.16 found 469.36.

    ##STR00105##

    Example 21. Synthesis of Compound 143

    [0290] A solution of 142 (2.7 mg, 6.0 .Math.mol) in DMF (48 .Math.L) and Et.sub.3N (2.1 .Math.L, 1.5 mg, 15 .Math.mol) were added to a solution of 125 (2.3 mg, 5.0 .Math.mol) in DMF (0.32 mL). The mixture was left standing for 4 d, diluted with DMF (100 .Math.L) and purified by RP HPLC (C18, 30% .fwdarw. 100% MeCN (1% AcOH) in water (1% AcOH). The product 143 was obtained as a colorless film (2.8 mg, 3.7 .Math.mol, 74%). LCMS (ESI+) calculated for C.sub.42H.sub.59N.sub.4O.sub.9.sup.+ (M+H.sup.+) 763.43 found 763.53.

    ##STR00106##

    Example 22. Synthesis of Compound 145

    [0291] To a solution of 128 (200 mg, 0.45 mmol) in DCM (1 mL) were added triethylamine (41.6 uL, 0.30 mmol) and tris(2-aminoethyl)amine 144 (14.9 uL, 0.10 mmol). After stirring the mixture for 150 minutes, it was concentrated in vacuo. The residue was purified by silica gel column chromatography (25% .fwdarw. 100% EtOAc in DCM then 0% .fwdarw. 10% MeOH in DCM) and gave 145 in 43% yield (45.4 mg, 42.5 umol) as a yellow oil. .sup.1H NMR (400 MHz, CDCl.sub.3)— δ (ppm) 5.68-5.18 (m, 6H), 4.32-4.18 (m, 6H), 4.18-4.11 (d, J= 7.9 Hz, 6H), 3.74-3.61 (m, 6H), 3.61-3.51 (m, 6H), 3.43-3.29 (m, 6H), 3.29-3.15 (m, 6H), 2.65-2.47 (m, 6H), 2.37-2.16 (m, 18H), 1.69-1.49 (m, 6H), 1.35 (quintet, J= 8.9 Hz, 3H), 1.03-0.87 (m, 6H).

    ##STR00107##

    Example 23. Synthesis of Compound 148

    [0292] To a solution of BCN-OH (101) (3.0 g, 20 mmol) in DCM (300 mL) was added CSI (146) (1.74 mL, 2.83 g, 20 mmol). After the mixture was stirred for 15 min, Et.sub.3N (5.6 mL, 4.0 g, 40 mmol) was added. The mixture was stirred for 5 min and 2-(2-aminoethoxy)ethanol (147) (2.2 mL, 2.3 g, 22 mmol) was added. The resulting mixture was stirred for 15 min and saturated aqueous NH.sub.4Cl (300 mL) was added. The layers were separated, and the aqueous phase was extracted with DCM (200 mL). The combined organic layers were dried (Na.sub.2SO.sub.4) and concentrated. The residue was purified by silica gel chromatography (0% to 10% MeOH in DCM). The fractions, containing the desired product, were concentrated. The residue was taken up in EtOAc (100 mL) and concentrated. The desired product 148 was obtained as a slightly yellow oil (4.24 g, 11.8 mmol, 59%). .sup.1H NMR (400 MHz, CDCl.sub.3) δ (ppm) 5.99-5.79 (bs, 1H), 4.29 (d, J= 8.3 Hz, 2H), 3.78-3.74 (m, 2H), 3.66-3.56 (m, 4H), 3.37-3.30 (m, 2H), 2.36-2.16 (m, 6H), 1.63-1.49 (m, 2H), 1.40 (quintet, J= 8.7 Hz, 1H), 1.05-0.94 (m, 2H).

    Example 24. Synthesis of Compound 149

    [0293] To a solution of 148 (3.62 g, 10.0 mmol) in DCM (200 mL) were added 4-nitrophenyl chloroformate (15) (2.02 g, 10.0 mmol) and Et.sub.3N (4.2 mL, 3.04 g, 30.0 mmol). The mixture was stirred for 1.5 h and concentrated. The residue was purified by silica gel chromatography (20% .fwdarw. 70% EtOAc (1% AcOH) in heptane (1% AcOH). The product 149 was obtained as a white foam (4.07 g, 7.74 mmol, 74%). .sup.1H NMR (400 MHz, CDCl.sub.3) δ (ppm) 8.32-8.26 (m, 2H), 7.45-7.40 (m, 2H), 5.62-5.52 (m, 1H), 4.48-4.42 (m, 2H), 4.28 (d, J = 8.2 Hz, 2H), 3.81-3.76 (m, 2H), 3.70-3.65 (m, 2H), 3.38-3.30 (m, 2H), 2.35-2.16 (m, 6H), 1.62-1.46 (m, 2H), 1.38 (quintet, J= 8.7 Hz, 1H), 1.04-0.93 (m, 2H).

    ##STR00108##

    Example 25. Synthesis of Compound 150

    [0294] To a solution of 149 (200 mg, 0.38 mmol) in DCM (1 mL) were added triethylamine (35.4 uL, 0.24 mmol) and tris(2-aminoethyl)amine (144) (12.6 uL, 84.6 umol). The mixture was stirred for 120 min and concentrated in vacuo. The residue was purified by silica gel column chromatography (25% .fwdarw. 100% EtOAc in DCM then 0% .fwdarw. 10% MeOH in DCM) and gave 150 in 36% yield (40.0 mg, 30.6 umol) as a white foam. 1H NMR (400 MHz, CDCI.sub.3): δ (ppm) 6.34-5.72 (m, 6H), 4.34-4.18 (m, 12H), 3.76-3.58 (m, 12H), 3.43-3.30 (m, 6H), 3.30-3.18 (m, 6H), 2.64-2.49 (m, 6H), 2.38-2.14 (m, 18H), 1.65-1.47 (m, 6H), 1.39 (quintet, J = 9.1 Hz, 3H), 1.06-0.90 (m, 6H).

    ##STR00109##

    Example 26. Synthesis of Compound 153

    [0295] To a mixture of Fmoc—Gly—Gly—Gly—OH (151) (31.2 mg, 75.8 .Math.mol) in anhydrous DMF (1 mL) were added N,N-diisopropylethylamine (40 .Math.L, 29 mg, 0.23 mmol) and HATU (30.3 mg, 79.6 .Math.mol). After 10 min tetrazine-PEG3-ethylamine (152) (30.3 mg, 75.8 .Math.mol) was added and the mixture was vortexed. After 2 h, the mixture was purified by RP HPLC (C18, 30% .fwdarw. 90% MeCN (1% AcOH) in water (1% AcOH). The desired product was obtained as a pink film (24.1 mg, 31.8 .Math.mol, 42%). LCMS (ESI+) calculated for C.sub.38H.sub.45N.sub.8O.sub.9+(M+H+) 757.33 found 757.46.

    Example 27. Synthesis of Compound 154

    [0296] To a solution of 153 (24.1 mg, 31.8 .Math.mol) in DMF (500 .Math.L) was added diethylamine (20 .Math.L, 14 mg, 191 .Math.mol). The mixture was left standing for 2 h and purified by RP HPLC (C18, 5% .fwdarw. 90% MeCN (1% AcOH) in water (1% AcOH). The desired product 154 was obtained as a pink film (17.5 mg, 32.7 .Math.mol, quant). LCMS (ESI+) calculated for C.sub.23H.sub.35N.sub.8O.sub.7+ (M+H+) 535.26 found 535.37.

    ##STR00110##

    Example 28. Synthesis of Compound 156

    [0297] A solution of N-[(1R,8S,9s)-bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl]-1,8-diamino-3,6-dioxaoctane (155) (68 mg, 0.21 mmol) in dry DMF (2 mL) was transferred to a solution of Fmoc—Gly—Gly—Gly—OH (151) (86 mg, 0.21 mmol) in dry DMF (2 mL). DIPEA (100 .Math.L, 0.630 mmol) and HATU (79 mg, 0.21 mmol) were added. After 1.5 h, the mixture was concentrated and the residue was purified by silica gel column chromatography (0 .fwdarw. 11% MeOH in DCM) which gave the desired compound 156 in 34% yield (52 mg, 0.072 mmol). LCMS (ESI+) calculated for C.sub.35H.sub.47N.sub.5O.sub.9+ (M+ H+) 717.34 found 718.39.

    Example 29. Synthesis of Compound 157

    [0298] Compound 156 (21 mg, 0.029 mmol) was dissolved in DMF (2.4 mL) and piperidine (600 .Math.L) was added. After 20 minutes, the mixture was concentrated and the residue was purified by preparative HPLC, which gave the desired compound 157 as a white solid (9.3 mg, 0.018 mmol, 64%). LCMS (ESI+) calculated for C.sub.23H.sub.37N.sub.5O.sub.7+(M+ H+) 495.27 found 496.56.

    ##STR00111##

    Example 30. Synthesis of Compound 159

    [0299] To a solution of amino-PEG.sub.11-amine (158) (143 mg, 0.260 mmol) in DCM (5 mL) was slowly added (1R,8S,9s)-bicyclo[6.1.0]non-4-yn-9-ylmethyl (4-nitrophenyl) carbonate (102) (41 mg, 0.13 mmol) dissolved in DCM (5 mL). After 1.5 h, the mixture was reduced and the residue was purified by silica gel column chromatography (0 .fwdarw. 20% 0.7 N NH.sub.3 MeOH in DCM) which gave the desired compound 159 as a clear oil (62 mg, 0.086 mmol, 66%). LCMS (ESI+) calculated for C.sub.35H.sub.46N.sub.2O.sub.13+(M+ H+) 720.44 found 721.56.

    Example 31. Synthesis of Compound 160

    [0300] A solution of 159 (62 mg, 0.086 mmol) in dry DMF (2 mL) was transferred to a solution of Fmoc— Gly—Gly—Gly—OH (151) (36 mg, 0.086 mmol) in dry DMF (2 mL). DIPEA (43 .Math.L, 0.25 mmol) and HATU (33 mg, 0.086 mmol) were added. After 18 h, the mixture was concentrated and the residue was purified by silica gel column chromatography (0 .fwdarw. 20% MeOH in DCM) which gave the desired compound 160 in 62% yield (60 mg, 0.054 mmol). LCMS (ESI+) calculated for C56H83N5O18+ (M+ H+) 1113.57 found 1114.93.

    Example 32. Synthesis of Compound 161

    [0301] Compound 160 (36 mg, 0.032 mmol) was dissolved in DMF (2 mL) and piperidine (200 .Math.L) was added. After 2 h, the mixture was concentrated and the residue was purified by silica gel column chromatography (0 .fwdarw. 40% 0.7 N NH.sub.3 MeOH in DCM) which gave the desired compound 161 as a yellow oil (16.7 mg, 0.0187 mmol, 58%). LCMS (ESI+) calculated for C.sub.41H.sub.73N.sub.5O.sub.16+ (M+H+) 891.51 found 892.82.

    ##STR00112##

    Example 33. Synthesis of Compound 162

    [0302] To a solution of amino-PEG23-amine (106) (60 mg, 0.056 mmol) in DCM (3 mL) was slowly added (1R,8S,9 s)-bicyclo[6.1.0]non-4-yn-9-ylmethyl (4-nitrophenyl) carbonate (102) (12 mg, 0.037 mmol) dissolved in DCM (5 mL). After 4 h, the mixture was concentrated and redissolved in DMF (2 mL), after which Fmoc—Gly—Gly—Gly—OH (51) (23 mg, 0.056 mmol), HATU (21 mg, 0.056 mmol), and DIPEA (27 .Math.L, 0.16 mmol) were added. After 20 h, the mixture was concentrated and the residue was purified by silica gel column chromatography (0 .fwdarw. 27% MeOH in DCM) which gave the desired compound 162 in 93% (57 mg, 0.043 mmol). LCMS (ESI+) calculated for C.sub.80H.sub.131 N.sub.5O.sub.30+ (M+NH.sub.4+) 1641.89 found 1659.92.

    Example 34. Synthesis of Compound 163

    [0303] Compound 162 (57 mg, 0.034 mmol) was dissolved in DMF (1 mL) and piperidine (120 .Math.L) was added. After 2 h, the mixture was concentrated, redissolved in water and the Fmoc-piperidine byproduct was removed with extraction with diethyl ether (3 x 10 mL). After freeze dry, 163 was obtained as an yellow oil (46.1 mg, 0.032 mmol, 95%). LCMS (ESI+) calculated for C.sub.65H.sub.121NsO.sub.28+ (M+H+) 1419.82 found 1420.91.

    ##STR00113##

    Example 35. Synthesis of Compound 165

    [0304] To a solution of (1R,8S,9s)-bicyclo[6.1.0]non-4-yn-9-ylmethyl (4-nitrophenyl) carbonate (102) (204 mg, 0.650 mmol) were added amino-PEG12-alcohol (164) (496 mg, 0.908 mmol) and triethyl amine (350 .Math.L, 2.27 mmol). After 19 h, the mixture was concentrated and the residue was purified by silica gel column chromatography (2 .fwdarw. 20% MeOH in DCM) which gave 165 as a clear yellow oil (410 mg, 0.560 mmol, 87%). LCMS (ESI+) calculated for C.sub.35H.sub.63NO.sub.14+ (M+ Na+) 721.42 found 744.43.

    Example 36. Synthesis of Compound 166

    [0305] To a solution of 165 (410 mg, 0.560 mmol) in DCM (6 mL) were added 4-nitrophenyl chloroformate (171, 0.848 mmol) and triethyl amine (260 .Math.L, 1.89 mmol). After 18 h, the mixture was concentrated and the residue was purified by silica gel column chromatography (0 .fwdarw. 7% MeOH in DCM) which gave the desired compound 166 as a clear oil (350 mg, 0.394 mmol, 70%). LCMS (ESI+) calculated for C.sub.42H.sub.66N.sub.2O.sub.18+(M+ Na+) 886.43 found 909.61.

    ##STR00114##

    Example 37. Synthesis of Compound 168

    [0306] To a solution of 166 (15 mg, 0.017 mmol) in DMF (2 mL) were added peptide LPETGG (167) (9.7 mg, 0.017 mmol) and triethylamine (7 .Math.L, 0.05 mmol). After 46 h, the mixture was concentrated and the residue was purified by preparative HPLC, which gave the desired compound 168 in 63% (14 mg, 0.010 mmol). LCMS (ESI+) calculated for C.sub.60H.sub.101N.sub.7O.sub.25+ (M+H+) 1319.68 found 1320.92.

    ##STR00115##

    Example 38. Synthesis of XL01

    [0307] To a solution of 155 (9.7 mg, 0.03 mmol) in anhydrous DMF (170 .Math.L) were added 177 (bis-maleimide-lysine-PEG.sub.4-TFP, Broadpharm) (20 mg, 0.024 mmol) and Et.sub.3N (9.9 .Math.L, 0.071 mmol). After stirring at room temperature for 42 h, the mixture was diluted with DCM (0.4 mL) and purified by flash column chromatography over silicagel (0% .fwdarw. 18% MeOH in DCM) to give XL01 as a clear oil (10.2 mg, 0.010 mmol, 43%). LCMS (ESI+) calculated for C.sub.49H.sub.72N.sub.7O.sub.16+ (M+H+) 1003.12 found 1003.62.

    Example 39. Synthesis of Bis-maleimide Azide XL02

    [0308] To a vial containing 177 (32.9 mg, 39.0 .Math.mol, 1.0 equiv.) in dry DMF (400 .Math.L) was added XL07 (9.2 mg, 42.1 .Math.mol, 1.08 equiv.) and the solution was mixed and left at rt for circa 50 min. Next, DiPEA was added and the resulting solution was mixed and left at rt for circa 2 hours. The reaction mixture was then purified directly by silica gel chromatography (DCM .fwdarw. 14% MeOH in DCM). The desired product XL02 was obtained as a colorless oil (28.9 mg, 32.2 .Math.mol, 83% yield). LCMS (ESI+) calculated for C.sub.39H.sub.62N.sub.9O.sub.15+ (M+H+) 896.97. found 896.52.

    ##STR00116##

    Example 40. Synthesis of XL03

    [0309] To a vial containing 2,3-bis(bromomethyl)-6-quinoxalinecarboxylic acid 178 (51.4 mg, 142.8 .Math.mol, 1.00 equiv.) in dry DCM (7.5 mL) was added DIC (9.0 mg, 71.4 .Math.mol, 0.5 equiv.). The resulting mixture was left at rt for 30 minutes, followed by the addition of a solution of XL07 (17.7 mg, 78.5 .Math.mol, 0.55 equiv.) in dry DCM (0.5 mL). The reaction mixture was stirred at rt for circa 35 minutes and then purified directly by silica gel chromatography (DCM .fwdarw. 10% MeOH in DCM) to give impure product (72 mg) as a white solid. The impure product was taken up in 1.0 mL DMF and 50% of this solution was co-evaporated with toluene (2x). The residue was purified by silica gel chromatography (12 .fwdarw. 30% acetone in toluene). The desired product XL03 was obtained as a colorless oil (20.1 mg, 35.9 .Math.mol). LCMS (ESI+) calculated for C.sub.19H.sub.25Br.sub.2N.sub.6o.sub.4+ (M+H+) 561.03. found 561.12

    Example 41. Synthesis of XL05

    [0310] To a solution of 178 (30 mg, 0.09 mmol), in DCM (0.3 mL) were added 3-maleimidopropionic NHS ester (27 mg, 0.10 mmol) and Et.sub.3N (38 .Math.L, 0.27 mmol). After stirring at room temperature for 28 h, the crude mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (0% .fwdarw. 15% MeOH in DCM) to give XL05 as a clear oil (27 mg, 0.056 mmol, 62%). LCMS (ESI+) calculated for C.sub.24H.sub.34N.sub.3O.sub.7+ (M+H+) 476.54 found 476.46.

    ##STR00117##

    Example 42. Synthesis of XL06

    [0311] To a vial containing 24 (17.2 mg, 88 wt% by .sup.1-H-qNMR, 18.4 .Math.mol, 1.00 equiv.) was added a solution of 179 in dry DMF (60 .Math.L). To the resulting colorless solution was added triethylamine (40.6 .Math.L, 15.8 equiv., 291 .Math.mol), generating a yellow solution immediately. The reaction mixture was left at room temperature for circa 28 hours and was then conc. in vacuo until most of the Et.sub.3N had evaporated. The residue was then diluted with DCM (1 mL) and purified directly by silica gel chromatography (1st column: DCM .fwdarw. 20% MeOH in DCM, 2.sub.nd column: DCM .fwdarw. 20% MeOH in DCM). The desired product (XL06) was obtained as a colorless oil (4.3 mg, 18.4 .Math.mol, 26% yield). LCMS (ESI+) calculated for C.sub.34H.sub.62N.sub.7O.sub.19S+ (M+H+) 904.38. found 904.52.

    ##STR00118##

    Example 43. Synthesis of 182

    [0312] To a solution of 180 (methyltetrazine-NHS ester, 19 mg, 0.058 mmol) in DCM (0.8 mL) were added 181 (33.6 mg, 0.061 mmol) and Et.sub.3N (24 .Math.L, 0.17 mmol). After stirring at room temperature for 2.5 h, the mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (0 .fwdarw. 15% MeOH in DCM) which gave the desired compound 182 in 93% yield (41 mg, 0.054 mmol). LCMS (ESI+) calculated for C.sub.35H.sub.60N.sub.5O.sub.13+ (M+H+) 758.88 found 758.64.

    Example 44. Synthesis of 183

    [0313] To a solution of 182 (41 mg, 0.054 mmol) in DCM (3 mL) were added 4-nitrophenyl chloroformate (16 mg, 0.081 mmol) and Et.sub.3N (23 .Math.L, 0.16 mmol). After stirring at room temperature for 21 h, the mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (gradient: A. 0% .fwdarw. 20% EtOAc in DCM (till p-nitrophenol was eluded), followed by gradient B. 0% .fwdarw. 13% MeOH in DCM) which gave the desired compound 183 in 76% yield (37.9 mg, 0.041 mmol). LCMS (ESI+) calculated for C.sub.42H.sub.63N.sub.6O.sub.17+ (M+H+) 923.98 found 923.61.

    Example 45. Synthesis of XL10

    [0314] To a solution of 184 (5.6 mg, 0.023 mmol), prepared according to MacDonald et al., Nat. Chem. Biol. 2015, 11, 326-334, incorporated by reference, in anhydrous DMF (0.1 mL) were added 183 (14.3 mg, 0.015 mmol) dissolved in anhydrous DMF (0.3 ml) and Et.sub.3N (7 .Math.L, 0.046 mmol). After stirring at room temperature for 2 h, the mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (0 .fwdarw. 15% MeOH in DCM) which gave the desired compound XL10 in 50% yield (7.5 mg, 0.0076 mmol). LCMS (ESI+) calculated for C.sub.47H.sub.73N.sub.8O.sub.15+ (M+H+) 990.13 found 990.66.

    ##STR00119##

    Example 46. Synthesis of 186

    [0315] To a solution of octa-ethylene glycol 185 in DCM (10 mL) was added triethylamine (1.0 mL, 7.24 mmol, 2.5 equiv.) followed by dropwise addition of a 4-nitrophenyl chloroformate (0.58 g, 2.90 mmol, 1 equiv.) solution in DCM (5 mL) in 28 minutes. After stirring the mixture for 90 minutes, it was concentrated in vacuo. The residue was purified by silicagel column chromatography (75% .fwdarw. 0% EtOAc in DCM followed by 0% .fwdarw. 7% MeOH in DCM). The product 186 was obtained in 38% yield as a colorless oil (584.6 mg, 1.09 mmol). LCMS (ESI+) calculated for C.sub.23H.sub.38NO.sub.13+(M+H+) 536.23, found 536.93. .sup.1H-NMR (400 MHz, CDCI.sub.3): δ (ppm) 8.28 (d, J = 12.0 Hz, 2H), 7.40 (d, J = 12.0 Hz, 2H), 4.47 - 4.42 (m, 2H), 3.84 - 3.79 (m, 2H), 3.75 - 3.63 (m, 26H), 3.63 - 3.59 (m, 2H), 2.70 -2.55 (bs, 1H).

    Example 47. Synthesis of 188

    [0316] To a solution of 187 (BocNH—PEG.sub.2).sub.2NH, 202 mg, 0.42 mmol) in DCM (1 mL) was added part (0.5 mL, 0.54 mmol 1.3 equiv.) of a prepared stock solution of 186 (584 mg in DCM (1 mL)) followed by triethylamine (176 .Math.L, 1.26 mmol, 3 equiv.) and HOBt (57 mg, 0.42 mmol, 1 equiv.). After stirring the mixture for 8 days, it was concentrated in vacuo. The residue was taken up in a mixture of acetonitrile (4.2 mL) and 0.1N NaOH(.sub.aq) (4.2 mL, 1 equiv.) and additional amount of solid NaOH (91.5 mg). After stirring the mixture for another 21.5 hours the mixture was extracted with DCM (3x 40 mL). The combined organic layers were concentrated in vacuo and the residue was purified by silicagel column chromatography (0% .fwdarw. 15% MeOH in DCM). Product 188 was obtained in 87% yield as a pale yellow oil (320.4 mg, 0.37 mmol). LCMS (ESI+) calculated for C.sub.39H.sub.78N.sub.3o.sub.18+(M+H+) 876.53, found 876.54.

    [0317] .sup.1H-NMR (400 MHz, CDCl.sub.3): δ (ppm) 5.15 - 5.02 (bs, 2H), 4.25 - 4.19 (m, 2H), 3.76 - 3.46 (m, 50H), 3.35 - 3.26 (m, 4H), 2.79 - 2.69 (br. s, 1H), 1.44 (s, 18H).

    Example 48. Synthesis of 189

    [0318] 188 (320 mg, 0.37 mmol) was dissolved in DCM (1 mL). Then 4 M HCI in dioxane (456 .Math.L, 1.83 mmol, 5 equiv.) was added. After stirring the mixture for 3.5 hours, additional 4 M HCI in dioxane (450 .Math.L, 1.80 mmol, 4.9 equiv.) was added. After stirring the mixture for another 3.5 hours, additional 4 M HCI in dioxane (450 .Math.L, 1.80 mmol, 4.9 equiv.) was added. After stirring the mixture for 16.5 hours the mixture was concentrated in vacuo. Product 189 was obtained in quantitative yield as a white sticky solid. This was used directly in the next step. .sup.1H-NMR (400 MHz, DMSO-d6): δ (ppm) 8.07 - 7.81 (bs, 6H), 4.15 - 4.06 (m, 2H), 3.75 - 3.66 (m, 2H), 3.65 - 3.48 (m, 48H), 3.03 - 2.92 (m, 4H).

    ##STR00120##

    Example 49. Synthesis of 190

    [0319] To a solution of BCN-OH (164 mg, 1.10 mmol, 3 equiv.) in DCM (3 mL) was added CSI (76 .Math.L, 0.88 mmol, 2.4 equiv.). After stirring for 15 minutes triethylamine (255 .Math.L, 5.50 mmol, 5 equiv.) was added. A solution of 189 was prepared by adding DCM (3 mL) and triethylamine (508 .Math.L, 11.0 mmol, 10 equiv.). This stock solution was added to the original reaction mixture after 6 minutes. After stirring the mixture for 21.5 hours, it was concentrated in vacuo. The residue was purified by silicagel column chromatography (0% .fwdarw. 10% MeOH in DCM). Product 190 was obtained in 39% yield as pale yellow oil (165.0 mg, 139 .Math.mol). LCMS (ESI+) calculated for C.sub.43H.sub.72N.sub.5O.sub.18S.sub.2+(M+H+) 1186.54, found 1186.65.

    [0320] .sup.1H-NMR (400 MHz, CDCl.sub.3): δ (ppm) 6.09 - 5.87 (m, 2H), 4.31 - 4.19 (m, 6H), 3.76 - 3.50 (m, 50H), 3.40 - 3.29 (m, 4H), 2.38 - 2.16 (m, 12H), 1.66 - 1.47 (m, 4H), 1.40 (quintet, J = 8.0 Hz, 2H), 1.04 - 0.94 (m, 4H).

    Example 50. Synthesis of 191

    [0321] To a solution of 190 (101 mg, 0.085 mmol) in DCM (2.0 mL) were added bis(4-nitrophenyl) carbonate (39 mg, 0.127 mmol) and Et.sub.3N (36 uL, 0.25 mmol). After stirring at room temperature for 42 h, the crude mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (A. 0% .fwdarw. 25% EtOAc in DCM (till p-nitrophenol was eluded), followed by gradient B. 0% .fwdarw. 12% MeOH in DCM) to give 191 as a clear oil (49 mg, 0.036 mmol, 42%). LCMS (ESI+) calculated for C.sub.58H.sub.9iN.sub.6O.sub.26S.sub.2+ (M+H+) 1352.50 found 1352.78.

    Example 51. Synthesis of XL 11

    [0322] To a solution of 191 (7 mg, 0.0059 mmol) in anhydrous DMF (130 .Math.L) were added Et.sub.3N (2.2 uL, 0.015 mmol) and TCO-amine hydrochloride (Broadpharm) (1.8 mg, 0.0068 mmol). After stirring at room temperature for 19 h, the crude mixture was purified by flash column chromatography over silicagel (0% .fwdarw. 15% MeOH in DCM) to give XL11 as a clear oil (1.5 mg, 0.001 mmol, 17%). LCMS (ESI+) calculated for C.sub.64H.sub.111N.sub.8O.sub.25S.sub.2+ (M+NH.sub.4+) 1456.73 found 1456.81.

    ##STR00121##

    Example 52. Synthesis of 194

    [0323] To a solution of available 187 (638 mg, 1.33 mmol) in DCM (8.0 mL) were added 128 (470 mg, 1.73 mmol), Et.sub.3N (556.0 .Math.L, 4.0 mmol), and 1-hydroxybenzotriazole (179.0 mg, 1.33 mmol). After stirring for 41 h at ambient temperature, the mixture was concentrated in vacuo and redissolved in MeCN (10 mL) followed by the addition of aqueous 0.1 M NaOH solution (10 mL) and solid NaOH pellets (100.0 mg). After 1.5 h, DCM (20 mL) was added and the desired compound was extracted four times. The organic layers were concentrated in vacuo and the residue was purified by flash column chromatography over silicagel (0% .fwdarw. 12% MeOH in DCM) to give 194 as a clear yellow oil (733 mg, 1.19 mmol, 90%). .sup.1H NMR (400 MHz, CDCl.sub.3) δ (ppm) 4.29 - 4.23 (m, 2H), 3.77 - 3.68 (m, 4H), 3.65 - 3.56 (m, 14H), 3.56 - 3.49 (m, 8H), 3.37 - 3.24 (m, 4H), 1.45 (s, 18H). LCMS (ESI+) calculated for C.sub.27H.sub.54N.sub.3O.sub.12+ (M+H+) 612.73 found 612.55.

    Example 53. Synthesis of 195

    [0324] To a solution of 194 (31.8 mg, 0.052 mmol) in DCM (1.0 mL) was added 4.0 M HCI in dioxane (0.4 mL). After stirring for 2.5 h at ambient temperature, the reaction mixture was concentrated in vacuo and in between redissolved in DCM (2 mL) and concentrated. Compound 195 was obtained as a clear oil in quantitative yield. LCMS (ESI+) calculated for C.sub.17H.sub.38N.sub.3O.sub.8+(M+H+) 412.50 found 412.45

    Example 54. Synthesis of 196

    [0325] To a cold solution (0° C.) of 195 (21.4 mg, 0.052 mmol) in DCM (1.0 mL) were added Et.sub.3N (36 .Math.L, 0.26 mmol) and 2-bromoacetyl bromide (10.5 .Math.L, 0.12 mmol). After stirring for 10 min on ice, the ice bath was removed and aqueous 0.1 M NaOH solution (0.8 mL) was added. After stirring at room temperature for 20 min, the water layer was extracted with DCM (2x 5 mL). The organic layers were combined and concentrated in vacuo. The crude brown oil was purified by flash column chromatography over silicagel (0% .fwdarw. 18% MeOH in DCM) to give 196 as a clear oil (6.9 mg, 0.011 mmol, 20%). LCMS (ESI+) calculated for C.sub.21H.sub.4oBr.sub.2N.sub.3O.sub.10+ (M+H+) 654.36 found 654.29.

    Example 55. Synthesis of XL12

    [0326] To a solution of 196 (6.9 mg, 0.011 mmol) in DCM (0.8 mL) were added bis(4-nitrophenyl) carbonate (3.8 mg, 0.012 mmol) and Et.sub.3N (5 .Math.L, 0.03 mmol). After stirring at room temperature for 18 h, 155 (BCN-PEG.sub.2-NH.sub.2, 3.3 mg, 0.01 mmol) dissolved in DCM (0.5 mL) was added. After stirring for an additional of 2 h, the mixture was concentrated in vacuo and purified by flash column chromatography over silica gel (gradient: A. 0% .fwdarw. 30% EtOAc in DCM (till p-nitrophenol was eluded), followed by gradient B. 0% .fwdarw. 20% MeOH in DCM) to give XL12 as a clear oil (1.0 mg, 0.001 mmol, 9%). LCMS (ESI+) calculated for C.sub.39H.sub.66Br.sub.2N.sub.5O.sub.15+ (M+H+) 1004.77 found 1004.51.

    ##STR00122##

    Example 56. Synthesis of 197

    [0327] To a solution of 102 (204 mg, 0.647 mmol) in DCM (20 mL) were added 181 (496 mg, 0.909 mmol) and Et.sub.3N (350 .Math.L, 2.27 mmol). After stirring at room temperature for 19 h, solvent was reduced in vacuo and the residue was purified by flash column chromatography over silicagel (2 .fwdarw. 20% MeOH in DCM) which gave the desired compound 197 as a yellow oil in 87% yield (410 mg, 0.567 mmol). LCMS (ESI+) calculated for C.sub.35H.sub.63NO.sub.14Na+ (M+Na+) 744.86 found 744.43.

    Example 57. Synthesis of 198

    [0328] To a solution of 197 (410 mg, 0.567 mmol) and 4-nitrophenyl chloroformate (172 mg, 0.853 mmol) in DCM (6 mL) was added Et.sub.3N (260 .Math.L, 1.88 mmol). After stirring at room temperature for 18 h, solvent was reduced in vacuo and the residue was purified by flash column chromatography over silicagel (0 .fwdarw. 7% MeOH in DCM) which gave the desired compound 198 as a clear oil in 70% yield (350 mg, 0.394 mmol). LCMS (ESI+) calculated for C.sub.42H.sub.66N.sub.2O.sub.18Na+ (M+Na+) 909.96 found 909.61.

    Example 58. Synthesis of XL13

    [0329] To a solution of 198 (44.2 mg, 0.05 mmol) in DCM (5 mL) were added 199(bis-aminooxy-PEG.sub.2, 33.3 mg, 0.18 mmol) and Et.sub.3N (11 .Math.L, 0.07 mmol). After stirring at room temperature for 67 h, the mixture was concentrated in vacuo and purified by RP HPLC (Column Xbridge prep C18 5 um OBD, 30x100 mm, 5% .fwdarw. 90% MeCN in H.sub.2O (both containing 1% acetic acid)). The product XL13 was obtained as a clear oil (8.1 mg, 0.0087 .Math.mol, 17%). LCMS (ESI+) calculated for C.sub.42H.sub.78N.sub.3O.sub.19+ (M+H+) 929.08 found 928.79.

    ##STR00123##

    Example 60. Synthesis of 314

    [0330] A solution of 3-mercaptopropanoic acid (200 mg, 1.9 mmol) in water (6 mL) was cooled to 0° C., followed by the addition of methyl methanethiosulfonate (263 mg, 2.1 mmol) in ethanol (3 mL). The reaction was stirred overnight and warmed to room temperature. Subsequently, the reaction was quenched by saturated aqueous NaCl (10 mL) and Et.sub.2O (20 mL). The water layer was extracted with Et.sub.2O (3 x 20 mL), and the combined organic layers were dried over Na.sub.2SO.sub.4, filtrated and concentrated to yield the crude disulfide product (266 mg, 1.7 mmol, 93%). .sup.1H-NMR (400 MHz, CDCl.sub.3): δ 7.00 (bs, 1H), 2.96-2.92 (m, 2H), 2.94-2.80 (m, 2H), 2.43 (s, 3H).

    [0331] The crude disulfide derived from 3-mercaptopropanoic acid (266 mg, 1.7 mmol) was dissolved in CH.sub.2Cl.sub.2 (20 mL) followed by the addition of EDC.HCl (480 mg, 2.2 mmol) and N-hydroxy succinimide (270 mg, 2.1 mmol). The reaction was stirred for 90 minutes and quenched with water (20 mL). The organic layer was washed with saturated aqueous NaHCO.sub.3 (2 x 20 mL). The organic layer was dried over Na.sub.2SO.sub.4, filtrated and concentrated to give crude 314 (346 mg, 1.4 mmol, 81%). .sup.1H-NMR (400 MHz, CDCl.sub.3): δ 3.12-3.07 (m, 2H), 3.02-2.99 (m, 2H), 2.87 (bs, 4H), 2.44 (s, 3H).

    Example 61. Synthesis of 316

    [0332] To a solution of 315 (prepared according WO2015057063 example 40, incorporated by reference) (420 mg, 1.14 mmol) in CH.sub.2Cl.sub.2/DMF (5 mL each) were added crude 314 (425 mg, 1.71 mmol) and Et.sub.3N (236 .Math.L, 1.71 mmol). The reaction mixture was stirred overnight followed by concentration under reduced pressure. Flash chromatography (1:0-6:4 MeCN:MeOH) afforded 316 (358 mg, 0.7 mmol, 60%). .sup.1H-NMR (400 MHz, CD.sub.3OD): δ 5.46-5.45 (m, 1H), 5.33-5.27 (m, 1H), 5.15-5.11 (m, 1H), 4.43-4.41 (m, 1H), 4.17-4.06 (m, 2H), 3.97-3.88 (m, 1H), 2.89-2.83 (m, 2H), 2.69-2.53 (m, 2H), 2.32 (s, 3H), 2.04 (s, 3H), 1.91 (s, 3H), 1.86 (s, 3H).

    Example 62. Synthesis of UDP GalNProSSMe (318)

    [0333] To a solution of UMP.NBus (632 mg, 1.12 mmol) in DMF (5 mL) CDI (234 mg, 1.4 mmol) was added and stirred for 30 minutes. Methanol (25 .Math.L, 0.6 mmol) is added and after 15 minutes the reaction is placed under high vacuum for 15 minutes. Subsequently, 316 (358 mg, 0.7 mmol) and NMI.HCl (333 mg, 2.8 mmol) are dissolved in DMF (2 mL) and added to the reaction mixture. After stirring overnight, the reaction mixture is concentrated under reduced pressure to give crude 317. The crude product 317 is dissolved in MeOH:H.sub.2O:Et.sub.3N (7:3:3, 10 mL) and stirred overnight followed by the addition of additional MeOH:H.sub.2O:Et.sub.3N (7:3:3, 5 mL). After 48 h, total reaction time the reaction mixture was concentrated under reduced pressure. The crude product was purified via anion exchange column (Q HITRAP, 3 x 5 mL, 1 x 20 mL column) in two portions. First binding on the column was achieved via loading with buffer A (10 mM NaHCO.sub.3) and the column was rinsed with 50 mL buffer A. Next a gradient to 70% B (250 mM NaHCO.sub.3) was performed to elute UDP GaINProSSMe 318 (355 mg, 0.5 mmol, 72%). 1H-NMR (400 MHz, D.sub.2O): δ 7.86-7.84 (m, 1H), 5.86-5.85 (m, 1H), 5.44 (bs, 1H), 4.26-4.22 (m, 2H), 4.17-4.08 (m, 6H), 3.92 (m, 1H), 3.84-3.83 (m, 1H), 3.66-3.64 (m, 2H), 2.88 (t, J = 7.2 Hz, 2H), 2.68 (t, J = 7.2 Hz, 2H), 2.31 (s, 3H).

    ##STR00124##

    Example 63. Synthesis of 350

    [0334] To a solution of methyltetrazine-NHS ester 349 (19 mg, 0.057 mmol) in DCM (400 .Math.L) was added amino-PEG.sub.11-amine (47 mg, 0.086 mmol) dissolved in DCM (800 .Math.L). After stirring at room temperature for 20 min, the mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (0 .fwdarw. 50% MeOH (0.7 M NH.sub.3) in DCM) which gave the desired compound 350 as a pink oil (17 mg, 0.022 mmol, 39%). LCMS (ESI+) calculated for C.sub.35H.sub.61N.sub.6O.sub.12+ (M+H+) 757.89 found 757.46.

    Example 64. Synthesis of 351

    [0335] To a stirred solution of 151 (Fmoc—Gly—Gly—Gly—OH, 10 mg, 0.022 mmol) in anhydrous DMF (500 .Math.L) were added DIPEA (11 .Math.L, 0.067 mmol) and HATU (8.5 mg, 0.022 mmol). After 10 min, 350 (17 mg, 0.022 mmol) dissolved in anhydrous DMF (500 .Math.L) was added. After stirring at room temperature for 18.5 h, the mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (0 .fwdarw. 17% MeOH in DCM) which gave the desired compound 351 as a pink oil (26 mg, 0.022 mmol, quant.). LCMS (ESI+) calculated for C.sub.56H.sub.83N.sub.10O.sub.17+ (M+NH.sub.4+) 1168.32 found 1168.67

    Example 65. Synthesis of 169

    [0336] To a solution of 351 (26 mg, 0.022 mmol) in anhydrous DMF (500 .Math.L) was added diethylamine (12 .Math.L, 0.11 mmol). After stirring at room temperature for 1.5 h, the crude mixture was purified by RP HPLC (Column Xbridge prep C18 5 .Math.m OBD, 30x100 mm, 5% .fwdarw. 90% MeCN in H.sub.2O (both containing 1% acetic acid)). The product 169 was obtained as a clear pink oil (10.9 mg, 0.011 mmol, 53%). LCMS (ESI+) calculated for C.sub.41H.sub.70N.sub.9O.sub.15+ (M+H+) 929.05 found 929.61.

    ##STR00125##

    Example 66. Synthesis of 352

    [0337] To a solution of 349 (methyltetrazine-NHS ester, 10.3 mg, 0.031 mmol) in DCM (200 .Math.L) was added amino-PEG.sub.23-amine (50 mg, 0.046 mmol) dissolved in DCM (200 .Math.L). After stirring at room temperature for 50 min, the mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (0 .fwdarw. 60% MeOH (0.7 M NH.sub.3) in DCM) which gave the desired compound 352 as a pink oil (17.7 mg, 0.013 mmol, 44%). LCMS (ESI+) calculated for C.sub.59H.sub.109N.sub.6O.sub.24+ (M+H+) 1286.52 found 1286.72.

    Example 67. Synthesis of 353

    [0338] To a stirred solution of 151 (5.7 mg, 0.013 mmol) in anhydrous DMF (500 .Math.L) were added DIPEA (7 .Math.L, 0.04 mmol) and HATU (5.3 mg, 0.013 mmol). After 10 min, 352 (17.7 mg, 0.013 mmol) dissolved in anhydrous DMF (500 .Math.L) was added. After stirring at room temperature for 6 h, the mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (0 .fwdarw. 18% MeOH in DCM) which gave the desired compound 353 as a pink oil (21 mg, 0.012 mmol, 91%). LCMS (ESI+) calculated for C.sub.80H.sub.131N.sub.10O.sub.29+ (M/2+NH.sub.4+) 857.45 found 857.08

    Example 68. Synthesis of 170

    [0339] To a solution of 353 (21 mg, 0.012 mmol) in anhydrous DMF (500 .Math.L) was added diethylamine (6.7 .Math.L, 0.06 mmol). After stirring at room temperature for 4 h, the crude mixture was purified by RP HPLC (Column Xbridge prep C18 5 .Math.m OBD, 30x100 mm, 5% .fwdarw. 90% MeCN in H.sub.2O (both containing 1% acetic acid)). The product 170 was obtained as a pink oil (11.6 mg, 0.008 mmol, 66%). LCMS (ESI+) calculated for C.sub.65H.sub.118N.sub.9O.sub.27+ (M+H+) 1457.68 found 1457.92.

    ##STR00126##

    Example 69. Synthesis of 356

    [0340] To a solution of 354 (tetrafluorophenylazide-NHS ester, 40 mg, 0.12 mmol) in DCM (1 mL) were added 355 (Boc—NH—PEG.sub.2—NH.sub.2, 33 mg, 0.13 mmol) and Et.sub.3N (50 .Math.L, 0.36 mmol). After stirring in the dark at room temperature for 30 min, the mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (0 .fwdarw. 7% MeOH in DCM) which gave the desired compound 356 as a clear oil (47 mg, 0.10 mmol, 84%). LCMS (ESI+) calculated for C.sub.18H.sub.24F.sub.4N.sub.5O.sub.5+ (M+H+) 466.41 found 466.23.

    Example 70. Synthesis of 357

    [0341] To a solution of 356 (47 mg, 0.10 mmol) in DCM (2 mL) was added 4.0 M HCI in dioxane (300 .Math.L). After stirring in the dark at room temperature for 17.5 h, the mixture was concentrated and 357 was obtained as a white solid in quantitative yield (36 mg, 0.10 mmol). LCMS (ESI+) calculated for C.sub.13H.sub.16F.sub.4N.sub.5O.sub.3+ (M+H+) 366.29 found 366.20.

    Example 71. Synthesis of 358

    [0342] To a stirred solution of 151 (Fmoc—Gly—Gly—Gly—OH, 42 mg, 0.10 mmol) in anhydrous DMF (600 .Math.L) were added DIPEA (50 .Math.L, 0.30 mmol) and HATU (39 mg, 0.10 mmol). After 15 min in the dark, 357 (36 mg, 0.10 mmol) dissolved in anhydrous DMF (500 .Math.L) was added. After stirring in the dark at room temperature for 41 h, the mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (0 .fwdarw. 20% MeOH in DCM) which gave the desired compound 358 as a clear oil (36 mg, 0.047 mmol, 47%). LCMS (ESI+) calculated for C.sub.34H.sub.35F.sub.4N.sub.8O.sub.8+ (M+H+) 759.68 found 759.38.

    Example 72. Synthesis of 171

    [0343] To a solution of 358 (36 mg, 0.047 mmol) in anhydrous DMF (750 .Math.L) was added diethylamine (24 .Math.L, 0.24 mmol). After stirring in the dark at room temperature for 55 min, the crude mixture was purified by RP HPLC (Column Xbridge prep C18 5 .Math.m OBD, 30x100 mm, 5% .fwdarw. 90% MeCN in H.sub.2O (both containing 1% acetic acid)). The product 171 was obtained as a clear oil (18.7 mg, 0.034 mmol, 74%). LCMS (ESI+) calculated for C.sub.19H.sub.25F.sub.4N.sub.8O.sub.6+ (M+H+) 537.45 found 537.29.

    Example 73. Synthesis of BCN-LPETGG (172)

    [0344] To a solution of 102 (10 mg, 0.031 mmol) in anhydrous DMF (500 .Math.L) were added peptide 167(H-LPETGG-OH, 18 mg, 0.031 mmol) and Et.sub.3N (13 .Math.L, 0.095 mmol). After stirring at room temperature for 93 h, the crude mixture was purified by RP HPLC (Column Xbridge prep C18 5 .Math.m OBD, 30x100 mm, 5% .fwdarw. 90% MeCN in H.sub.2O (both containing 1% acetic acid)). The product 172 was obtained as a clear oil (16.8 mg, 0.022 mmol, 72%). LCMS (ESI+) calculated for C.sub.35H.sub.53N.sub.6O.sub.12+ (M+H+) 749.83 found 749.39.

    ##STR00127##

    Example 74. Synthesis of 359

    [0345] To a solution of 102 (56 mg, 0.17 mmol) in DCM (8 mL) were added amino-PEG.sub.24-alcohol (214 mg, 0.199 mmol) and Et.sub.3N (80 .Math.L, 0.53 mmol). After stirring at room temperature for 20 h, solvent was reduced in vacuo and the residue was purified by flash silica gel column chromatography (2 .fwdarw. 30% MeOH in DCM) which gave the desired compound 359 as a yellow oil in 95% yield (210 mg, 0.168 mmol). LCMS (ESI+) calculated for C.sub.59H.sub.111NO.sub.26Na+ (M+Na+) 1273.50 found 1273.07.

    Example 75. Synthesis of 360

    [0346] To a solution of 359 (170 mg, 0.136 mmol) and 4-nitrophenyl chloroformate (44 mg, 0.22 mmol) in DCM (7 mL) was added Et.sub.3N (63 .Math.L, 0.40 mmol). After stirring at room temperature for 41 h, solvent was reduced and the residue was purified by flash silica gel column chromatography (0 .fwdarw. 10% MeOH in DCM) which gave the desired compound 360 as a clear oil in 67% yield (129 mg, 0.091 mmol). LCMS (ESI+) calculated for C.sub.66H.sub.114N.sub.2O.sub.30Na+ (M+Na+) 1438.59 found 1438.13.

    Example 76. Synthesis of 173

    [0347] To a solution of 360 (16 mg, 0.011 mmol) in anhydrous DMF (800 .Math.L) were added 167 (peptide H-LPETGG-OH, 6.5 mg, 0.011 mmol) and Et.sub.3N (5 .Math.L, 0.04 mmol). After stirring at room temperature for 95 h, the crude mixture was purified by RP HPLC (Column Xbridge prep C18 5 .Math.m OBD, 30x100 mm, 5% .fwdarw. 90% MeCN in H.sub.2O (both containing 1% acetic acid)). The product 173 was obtained as a clear oil (12.6 mg, 0.0068 mmol, 62%). LCMS (ESI+) calculated for C.sub.84H.sub.153N.sub.8O.sub.37+ (M/2+NH.sub.4+) 942.55 found 924.26.

    Example 77. Synthesis of 174

    [0348] ##STR00128##

    To a solution of 361 (methyltetrazine-PEGs-NHS ester, 6.1 mg, 0.011 mmol) in anhydrous DMF (230 .Math.L) were added peptide H-LPETGG-OH (6.5 mg, 0.011 mmol) and Et.sub.3N (4 .Math.L, 0.028 mmol). After stirring at room temperature for 22 h, the crude mixture was purified by RP HPLC (Column Xbridge prep C18 5 .Math.m OBD, 30x100 mm, 5% .fwdarw. 90% MeCN in H.sub.2O (both containing 1% acetic acid)). The product 174 was obtained as a clear pink oil (9.9 mg, 0.01 mmol, 91%). LCMS (ESI+) calculated for C.sub.44H.sub.70N.sub.11O.sub.16+ (M+NH.sub.4+) 1009.09 found 1009.61.

    ##STR00129##

    Example 78. Synthesis of 362

    [0349] To a solution of 354 (31 mg, 0.093 mmol) in DCM (1 mL) were added 181 (56 mg, 0.10 mmol) and Et.sub.3N (40 .Math.L, 0.28 mmol). After stirring in the dark at room temperature for 25 min, the mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (0 .fwdarw. 15% MeOH in DCM) which gave the desired compound 362 as a clear oil (55 mg, 0.072 mmol, 77%). LCMS (ESI+) calculated for C.sub.31H.sub.51F.sub.4N.sub.4O.sub.13+ (M+H+) 763.75 found 763.08.

    Example 79. Synthesis of 363

    [0350] To a solution of 362 (55 mg, 0.072 mmol) in DCM (2 mL) were added 4-nitrophenyl chloroformate (13 mg, 0.064 mmol) and Et.sub.3N (30 .Math.L, 0.21 mmol). After stirring in the dark at room temperature for 21 h, the mixture was concentrated in vacuo and purified by RP HPLC (Column Xbridge prep C18 5 .Math.m OBD, 30x100 mm, 5% .fwdarw. 90% MeCN (1% AcOH) in water (1% AcOH). The product 363 was obtained as a yellow oil (13.3 mg, 0.014 mmol, 20%). LCMS (ESI+) calculated for C.sub.38H.sub.54F.sub.4N.sub.5O.sub.17+ (M+H+) 928.85 found 928.57.

    Example 80. Synthesis of 175

    [0351] To a solution of 363 (13.3 mg, 0.014 mmol) in anhydrous DMF (300 .Math.L) were added 167 (peptide H-LPETGG-OH, 8.2 mg, 0.014 mmol) and Et.sub.3N (6 .Math.L, 0.043 mmol). After 26 h in the dark, the crude mixture was purified by RP HPLC (Column Xbridge prep C18 5 .Math.m OBD, 30x100 mm, 5% .fwdarw. 90% MeCN in H.sub.2O (both containing 1% acetic acid)). The product 175 was obtained as a clear oil (11.4 mg, 0.0084 mmol, 59%). LCMS (ESI+) calculated for C.sub.56H.sub.89F.sub.4N.sub.10O.sub.24+ (M+H+) 1362.35 found 1362.81.

    ##STR00130##

    ##STR00131##

    Example 81. Synthesis of 365

    [0352] To a stirred solution of 151 (Fmoc—Gly—Gly—Gly—OH, 20 mg, 0.049 mmol) in anhydrous DMF (350 .Math.L) were added DIPEA (25 .Math.L, 0.15 mmol) and HATU (18 mg, 0.049 mmol). After 10 min, compound 364 (/V-Boc-ethylenediamine, 7.8 mg, 0.049 mmol) dissolved in anhydrous was added. After stirring at room temperature for 45 min, the mixture was concentrated in vacuo and purified by flash column chromatography over silicagel (0 .fwdarw. 30% MeOH in DCM) which gave the desired compound 365 as a clear oil (12.4 mg, 0.022 mmol, 46%). LCMS (ESI+) calculated for C.sub.28H.sub.36N.sub.5O.sub.7+ (M+H+) 554.61 found 554.46.

    Example 82. Synthesis of 366

    [0353] To a stirred solution of 365 (12.4 mg, 0.022 mmol) in DCM (0.7 mL) was added 4.0 M HCI in dioxane (400 .Math.L). After stirring at room temperature for 1 h, the mixture was concentrated and 366 was obtained as a white solid (11 mg, 0.022 mmol, quant.). LCMS (ESI+) calculated for C.sub.23H.sub.28N.sub.5O.sub.7+ (M+H+) 545.50 found 454.33.

    Example 83. Synthesis of 176

    [0354] To a solution of 191 (8 mg, 0.0059 mmol) in anhydrous DMF (300 .Math.L) were added Et.sub.3N (2.5 .Math.L, 0.017 mmol) and stock of 366 in anhydrous DMF (110 .Math.L, 3.0 mg, 0.0059 mmol). After stirring at room temperature for 18 h, diethylamine (2 uL) was added. After an additional of 2 h, the mixture was purified by RP HPLC (Column Xbridge prep C18 5 .Math.m OBD, 30x100 mm, 5% .fwdarw. 90% MeCN in H.sub.2O (both containing 1% acetic acid)). The product 176 was obtained as a clear oil (1.3 mg, 0.0009 mmol, 15%). LCMS (ESI+) calculated for C.sub.60H.sub.103N.sub.10O.sub.26S.sub.2+ (M+H+) 1444.64 found 1444.75.

    Example 84. Anti-4-1BB PF31

    [0355] Anti1BB scFv was designed with a C-terminal sortase A recognition sequence followed by a His tag (amino acid sequence being identified by SEQ ID NO: 4). Anti1BB scFv was transiently expressed in HEK293 cells followed by IMAC purification by Absolute Antibody Ltd (Oxford, United Kingdom). Mass spectral analysis showed one major product (observed mass 28013 Da, expected mass 28018 Da).

    Example 85. Cloning of SYR—(G4S).SUB.3.—IL15 (PF18) into pET32a Expression Vector

    [0356] The SYR-(G4S).sub.3-IL15 (PF18) (amino acid sequence being identified by SEQ ID NO: 5) was designed with an N-terminal (M)SYR sequence, where the methionine will be cleaved after expression leaving an N-terminal serine, and a flexible (G4S).sub.3 spacer between the SYR sequence and IL15. The codon-optimized DNA sequence was inserted into a pET32A expression vector between Ndel and Xhol, thereby removing the sequence encoding the thioredoxin fusion protein, and was obtained from Genscript, Piscataway, USA.

    Example 86. E. Coli Expression of SYR-(G4S).SUB.3.-IL15 (PF18) and Inclusion Body Isolation

    [0357] Expression of SYR-(G4S).sub.3-IL15 (PF18) starts with the transformation of the plasmid (pET32a-SYR-(G4S)3-IL15) into BL21 cells (Novagen). Transformed cells were plated on LB-agar with ampicillin and incubated overnight at 37° C. A single colony was picked and used to inoculate 50 mL of TB medium + ampicillin followed by incubated overnight at 37° C. Next, the overnight culture was used to inoculation 1000 mL TB medium + ampicillin. The culture was incubated at 37° C. at 160 RPM and, when OD600 reached 1.5, induced with 1 mM IPTG (1 mL of 1 M stock solution). After >16 hour induction at 37° C. at 160 RPM, the culture was pelleted by centrifugation (5000 xg - 5 min). The cell pellet gained from 1000 mL culture was lysed in 60 mL BugBuster™ with 1500 units of Benzonase and incubated on roller bank for 30 min at room temperature. After lysis the insoluble fraction was separated from the soluble fraction by centrifugation (15 minutes, 15000 x g). Half of the insoluble fraction was dissolved in 30 mL BugBuster™ with lysozyme (final concentration: 200 .Math.g/mL) and incubated on the roller bank for 10 min. Next the solution was diluted with 6 volumes of 1:10 diluted BugBuster™ and centrifuged 15 min, 15000 x g . The pellet was resuspended in 200 mL of 1:10 diluted BugBuster™ by using the homogenizer and centrifuged at 10 min, 12000 x g . The last step was repeated 3 times.

    Example 87. Refolding of SYR-(G.SUB.4.S)3- IL15 (PF18) from Isolated Inclusion Bodies

    [0358] The purified inclusion bodies containing SYR-(G4S)3- IL15 (PF18), were dissolved and denatured in 30 mL 5 M guanidine with 40 mM Cysteamine and 20 mM Tris pH 8.0. The suspension was centrifuged at 16.000 x g for 5 min to pellet the remaining cell debris. The supernatant was diluted to 1 mg/mL with 5 M guanidine with 40 mM Cysteamine and 20 mM Tris pH 8.0, and incubated for 2 hours at RT on a rollerbank. The 1 mg/mL solution is added dropwise to 10 volumes of refolding buffer (50 mM Tris, 10.53 mM NaCl, 0.44 mM KCI, 2.2 mM MgCl.sub.2, 2.2 mM CaCI.sub.2, 0.055% PEG-4000, 0.55 M L-arginine, 4 mM cysteamine, 4 mM cystamine, at pH 8.0) in a cold room at 4° C., stirring required. Leave solution at least 24 hours at 4° C. Dialyze the solution to 10 mM NaCl and 20 mM Tris pH 8.0, 1x overnight and 2 x4 hours, using a Spectrum™ SpectrafPor™ 3 RC Dialysis Membrane Tubing 3500 Dalton MWCO. Refolded SYR-(G4S)3- IL15 (PF18) was loaded onto a equilibrated Q-trap anion exchange column (GE health care) on an AKTA Purifier-10 (GE Healthcare). The column was first washed with buffer A (20 mM Tris, 10 mM NaCl, pH 8.0). Retained protein was eluted with buffer B (20 mM Tris buffer, 1 M NaCl, pH 8.0) on a gradient of 30 mL from buffer A to buffer B. Mass spectrometry analysis showed a weight of 14122 Da (expected mass: 14122 Da) corresponding to PF18. The purified SYR-(G4S)3- IL15 (PF18) was buffer exchanged to PBS using HiPrep™ 26/10 Desalting column (Cytiva) on a AKTA Purifier-10 (GE Healthcare).

    Example 88. Cloning of SYR-(G4S)3-IL15Ra-linker-IL15 (PF26) Into pET32a Expression Vector

    [0359] The SYR-(G4S)3-IL15Ra-linker-IL15 (PF26) (amino acid sequence being identified by SEQ ID NO: 6) was designed with an N-terminal (M)SYR sequence, where the methionine will be cleaved after expression leaving an N-terminal serine, and a flexible (G.sub.4S).sub.3 spacer between the SYR sequence and IL15Ra-linker-IL15. The codon-optimized DNA sequence was inserted into a pET32A expression vector between Ndel and Xhol, thereby removing the sequence encoding the thioredoxin fusion protein, and was obtained from Genscript, Piscataway, USA.

    Example 89. E. Coli Expression of SYR-(G4S)3-IL15Ra-linker-IL15 (PF26) and Inclusion Body isolation

    [0360] Expression of SYR-(G4S)3-IL15Ra-linker-IL15 (PF26) starts with the transformation of the plasmid (pET32a- SYR-(G4S)3-IL15Ra-linker-IL15) into BL21 cells (Novagen). Next step was the inoculation of 1000 mL culture (TB medium + ampicillin) with BL21 cells. When OD600 reached 1.5 , cultures were induced with 1 mM IPTG (1 mL of 1 M stock solution). After >16 hour induction at 37° C. at 160 RPM, the culture was pelleted by centrifugation (5000 xg - 5 min). The cell pellet gained from 1000 mL culture was lysed in 60 mL BugBuster™ with 1500 units of Benzonase and incubated on roller bank for 30 min at room temperature. After lysis the insoluble fraction was separated from the soluble fraction by centrifugation (15 minutes, 15000 x g). Half of the insoluble fraction was dissolved in 30 mL BugBuster™ with lysozyme (final concentration: 200 .Math.g/mL) and incubated on the roller bank for 10 min. Next the solution was diluted with 6 volumes of 1:10 diluted BugBuster™ and centrifuged 15 min, 15000 x g . The pellet was resuspended in 200 mL of 1:10 diluted BugBuster™ by using the homogenizer and centrifuged at 10 min, 12000 x g . The last step was repeated 3 times.

    Example 90. Refolding of SYR-(G4S)3-IL15Ra-linker-IL15 (PF26) From Isolated Inclusion Bodies

    [0361] The purified inclusion bodies containing SYR-(G4S)3-IL15Ra-linker-IL15 (PF26), were dissolved and denatured in 30 mL 5 M guanidine with 40 mM Cysteamine and 20 mM Tris pH 8.0. The suspension was centrifuged at 16.000 x g for 5 min to pellet the remaining cell debris. The supernatant was diluted to 1 mg/mL with 5 M guanidine with 40 mM Cysteamine and 20 mM Tris pH 8.0, and incubated for 2 hours at RT on a rollerbank. The 1 mg/mL solution is added dropwise to 10 volumes of refolding buffer (50 mM Tris, 10.53 mM NaCl, 0.44 mM KCI, 2.2 mM MgCl.sub.2, 2.2 mM CaCl.sub.2, 0.055% PEG-4000, 0.55 M L-arginine, 4 mM cysteamine, 4 mM cystamine, at pH 8.0) in a cold room at 4° C., stirring required. Leave solution at least 24 hours at 4° C. Dialyze the solution to 10 mM NaCl and 20 mM Tris pH 8.0, 1x overnight and 2 x4 hours using a Spectrum™ Spectra/Por™ 3 RC Dialysis Membrane Tubing 3500 Dalton MWCO. Refolded SYR-(G4S)3-IL15Ra-linker-IL15 (PF26) was loaded onto a equilibrated Q-trap anion exchange column (GE health care) on an AKTA Purifier-10 (GE Healthcare). The column was first washed with buffer A (20 mM Tris, 10 mM NaCl, pH 8.0). Retained protein was eluted with buffer B (20 mM Tris buffer, 1 M NaCl, pH 8.0) on a gradient of 30 mL from buffer A to buffer B. Mass spectrometry analysis showed a weight of 24146 Da (expected mass: 24146 Da) corresponding to PF26. The purified SYR-(G4S)3-IL15Ra-linker-IL15 (PF26) was buffer exchanged to PBS using HiPrep™ 26/10 Desalting column from cytiva on a AKTA Purifier-10 (GE Healthcare).

    Example 91. Humanized OKT3 200

    [0362] Humanized OKT3 (hOKT3) with C-terminal sortase A recognition sequence (C-terminal tag being identified by SEQ ID NO: 1) was obtained from Absolute Antibody Ltd (Oxford, United Kingdom). Mass spectral analysis showed one major product (observed mass 28836 Da).

    Example 92. C-terminal Sortagging of Compound GGG-PEG.SUB.2.-BCN (157) to hOKT3 200 Using Sortase A to Obtain hOKT3-PEG.SUB.2.-BCN 201

    [0363] A bioconjugate according to the invention was prepared by C-terminal sortagging using sortase A (identified by SEQ ID NO: 2). To a solution of hOKT3 200 (500 .Math.L, 500 .Math.g, 35 .Math.M in PBS pH 7.4) was added sortase A (58 .Math.L, 384 .Math.g, 302 .Math.M in TBS pH 7.5 + 10% glycerol), GGG-PEG.sub.2-BCN (157, 28 .Math.L, 50 mM in DMSO), CaCl.sub.2 (69 .Math.L, 100 mM in MQ) and TBS pH 7.5 (39 .Math.L). The reaction was incubated at 37° C. overnight followed by purification on a His-trap excel 1 mL column (GE Healthcare) on an AKTA Explorer-100 (GE Healthcare). The column was equilibrated with buffer A (20 mM Tris, 200 mM NaCl, 20 mM Imidazole, pH 7.5) and the sample was loaded with 1 mL/min. The flowthrough was collected and mass spectral analysis showed one major product (observed mass 27829 Da), corresponding to 201. The sample was dialyzed against PBS pH 7.4 and concentrated by spinfiltration (Amicon Ultra-0.5, Ultracel-10 Membrane, Millipore) to obtain hOKT3-PEG2-BCN 201 (60 .Math.L, 169 .Math.g, 101 .Math.M in PBS pH 7.4).

    Example 93. C-terminal Sortagging of Compound GGG-PEG.SUB.2.-BCN (157) to hOKT3 200 Using sortase A Pentamutant to Obtain hOKT3-PEG.SUB.2.-BCN 201

    [0364] A bioconjugate according to the invention was prepared by C-terminal sortagging using sortase A pentamutant (BPS Bioscience, catalog number 71046). To a solution of hOKT3 200 (14.3 .Math.L, 14 .Math.g, 35 .Math.M in PBS pH 7.4) was added sortase A pentamutant (0.5 .Math.L, 1 .Math.g, 92 .Math.M in 40 mM Tris pH8.0, 110 mM NaCl, 2.2 mM KCI, 400 mM imidazole and 20% glycerol), GGG-PEG.sub.2-BCN (157, 2 .Math.L, 20 mM in DMSO:MQ=2:3), CaCl.sub.2 (2 .Math.L, 100 mM in MQ) and TBS pH 7.5 (1.2 .Math.L). The reaction was incubated at 37° C. overnight. Mass spectral analysis showed one major product (observed mass 27829 Da), corresponding to hOKT3-PEG.sub.2-BCN 201.

    Example 94. C-terminal Sortagging of Compound GGG-PEG.SUB.11.-BCN (161) to hOKT3 200 using sortase A to obtain hOKT3-PEG.SUB.11.-BCN 202

    [0365] A bioconjugate according to the invention was prepared by C-terminal sortagging using sortase A (identified by SEQ ID NO: 2). To a solution of hOKT3 200 (14.3 .Math.L, 14 .Math.g, 35 .Math.M in PBS pH 7.4) was added sortase A (0.9 .Math.L, 12 .Math.g, 582 .Math.M in TBS pH 7.5 + 10% glycerol), GGG-PEG.sub.11-BCN (161, 2 .Math.L, 20 mM in MQ), CaCl.sub.2 (2 .Math.L, 100 mM in MQ) and TBS pH 7.5 (0.9 .Math.L). The reaction was incubated at 37° C. overnight. Mass spectral analysis showed one major product (observed mass 21951 Da, approximately 85%), corresponding to sortase A, a minor product (observed masses 28227 Da, approximately 5%), corresponding to hOKT3-PEG.sub.11-BCN 202, and two other minor products (observed masses 28051 Da and 28325 Da, each approximately 5%).

    Example 95. C-terminal Sortagging of Compound GGG-PEG.SUB.11.-BCN (161) to hOKT3 200 Using Sortase a Pentamutant to Obtain hOKT3-PEG.SUB.11.-BCN 202

    [0366] A bioconjugate according to the invention was prepared by C-terminal sortagging using sortase A pentamutant (BPS Bioscience, catalog number 71046). To a solution of hOKT3 200 (14.3 .Math.L, 14 .Math.g, 35 .Math.M in PBS pH 7.4) was added sortase A pentamutant (0.5 .Math.L, 1 .Math.g, 92 .Math.M in 40 mM Tris pH8.0, 110 mM NaCl, 2.2 mM KCI, 400 mM imidazole and 20% glycerol), GGG-PEG.sub.11-BCN (161.2 .Math.L, 20 mM in MQ), CaCl.sub.2 (2 .Math.L, 100 mM in MQ) and TBS pH 7.5 (1.2 .Math.L). The reaction was incubated at 37° C. overnight. Mass spectral analysis showed one major product (observed mass 28225 Da, approximately 60%), corresponding to hOKT3-PEG.sub.11-BCN 202, and one minor product (observed mass 28326 Da, approximately 40%).

    Example 96. C-terminal Sortagging of Compound GGG-PEG.SUB.23.-BCN (163) to hOKT3 200 Using Sortase A to Obtain hOKT3-PEG.SUB.23.-BCN 203

    [0367] A bioconjugate according to the invention was prepared by C-terminal sortagging using sortase A (identified by SEQ ID NO: 2). To a solution of hOKT3 200 (14.3 .Math.L, 14 .Math.g, 35 .Math.M in PBS pH 7.4) was added sortase A (0.9 .Math.L, 12 .Math.g, 582 .Math.M in TBS pH 7.5 + 10% glycerol), GGG-PEG.sub.23-BCN (163, 2 .Math.L, 20 mM in MQ), CaCl.sub.2 (2 .Math.L, 100 mM in MQ) and TBS pH 7.5 (0.9 .Math.L). The reaction was incubated at 37° C. overnight. Mass spectral analysis showed one major product (observed mass 21951 Da, approximately 70%), corresponding to sortase A, and one minor product (observed mass 28755 Da, approximately 30%), corresponding to hOKT3-PEG.sub.23-BCN 203.

    Example 97. C-terminal Sortagging of Compound GGG-PEG.SUB.23.-BCN (163) to hOKT3 200 Using Sortase A Pentamutant to Obtain hOKT3-PEG.SUB.23.-BCN 203

    [0368] A bioconjugate according to the invention was prepared by C-terminal sortagging using sortase A pentamutant (BPS Bioscience, catalog number 71046). To a solution of hOKT3 200 (14.3 .Math.L, 14 .Math.g, 35 .Math.M in PBS pH 7.4) was added sortase A pentamutant (0.5 .Math.L, 1 .Math.g, 92 .Math.M in 40 mM Tris pH8.0, 110 mM NaCl, 2.2 mM KCI, 400 mM imidazole and 20% glycerol), GGG-PEG.sub.23-BCN (163, 2 .Math.L, 20 mM in MQ), CaCl.sub.2 (2 .Math.L, 100 mM in MQ) and TBS pH 7.5 (1.2 .Math.L). The reaction was incubated at 37° C. overnight. Mass spectral analysis showed one major product (observed mass 28754 Da), corresponding to hOKT3-PEG.sub.23-BCN 203.

    Example 98. C-terminal Sortagging of Compound GGG-PEG.SUB.4.-tetrazine (154) to hOKT3 200 Using Sortase A to Obtain hOKT3-PEG.SUB.4.-tetrazine 204

    [0369] A bioconjugate according to the invention was prepared by C-terminal sortagging using sortase A (identified by SEQ ID NO: 2). To a solution of hOKT3 200 (500 .Math.L, 500 .Math.g, 35 .Math.M in PBS pH 7.4) was added sortase A (58 .Math.L, 384 .Math.g, 302 .Math.M in TBS pH 7.5 + 10% glycerol), GGG-PEG.sub.4-tetrazine (154, 35 .Math.L, 40 mM in MQ), CaCl.sub.2 (69 .Math.L, 100 mM in MQ) and TBS pH 7.5 (32 .Math.L). The reaction was incubated at 37° C. overnight followed by purification on a His-trap excel 1 mL column (GE Healthcare) on an AKTA Explorer-100 (GE Healthcare). The column was equilibrated with buffer A (20 mM Tris, 200 mM NaCl, 20 mM Imidazole, pH 7.5) and the sample was loaded with 1 mL/min. The flowthrough was collected and mass spectral analysis showed one major product (observed mass 27868 Da), corresponding to 104. The sample was dialyzed against PBS pH 7.4 and concentrated by spinfiltration (Amicon Ultra-0.5, Ultracel-10 Membrane, Millipore) to obtain hOKT3-PEG.sub.4-tetrazine 204 (70 .Math.L, 277 .Math.g, 143 .Math.M in PBS pH 7.4).

    Example 99. C-terminal Sortagging of Compound GGG-PEG.SUB.4.-tetrazine (154) to hOKT3 200 Using Sortase A Pentamutant to Obtain hOKT3-PEG.SUB.4.-tetrazine 204

    [0370] A bioconjugate according to the invention was prepared by C-terminal sortagging using sortase A pentamutant (BPS Bioscience, catalog number 71046). To a solution of hOKT3 200 (14.3 .Math.L, 14 .Math.g, 35 .Math.M in PBS pH 7.4) was added sortase A pentamutant (0.5 .Math.L, 1 .Math.g, 92 .Math.M in 40 mM Tris pH8.0, 110 mM NaCl, 2.2 mM KCI, 400 mM imidazole and 20% glycerol), GGG-PEG.sub.4-tetrazine (154, 2 .Math.L, 20 mM in MQ), CaCl.sub.2 (2 .Math.L, 100 mM in MQ) and TBS pH 7.5 (1.2 .Math.L). The reaction was incubated at 37° C. overnight. Mass spectral analysis showed one major product (observed mass 27868 Da), corresponding to hOKT3-PEG.sub.4-tetrazine 204.

    Example 100. C-terminal Sortagging of GGG-PEG.SUB.11.-tetrazine (169) to hOKT3 200 with Sortase A to Obtain hOKT3-PEG.SUB.11.-tetrazine PF01

    [0371] A bioconjugate according to the invention was prepared by C-terminal sortagging with sortase A (identified by SEQ ID NO: 2). To a solution of hOKT3 200 (1908 .Math.L, 5 mg, 91 .Math.M in PBS pH 7.4) was added sortase A (81 .Math.L, 948 .Math.g, 533 .Math.M in TBS pH 7.5 + 10% glycerol), GGG-PEG.sub.11-tetrazine (169, 347 .Math.L, 20 mM in MQ), CaCl.sub.2 (347 .Math.L, 100 mM in MQ) and TBS pH 7.5 (789 .Math.L). The reaction was incubated at 37° C. overnight. Mass spectral analysis showed one major product (observed mass 28258 Da), corresponding to hOKT3-PEG.sub.11-tetrazine PF01. The reaction was purified on a His-trap excel 1 mL column (GE Healthcare) on an AKTA Explorer-100 (GE Healthcare). The column was equilibrated with buffer A (20 mM Tris, 200 mM NaCl, 20 mM Imidazole, pH 7.5) and the sample was loaded with 1 mL/min. The flowthrough was collected and buffer exchanged to PBS pH 6.5 using a HiPrep 26/10 desalting column (GE Healthcare). Addition dialysis was performed to PBS pH 6.5 for 3 days at 4° C. to remove residual 169.

    Example 101. C-terminal Sortagging of GGG-PEG.SUB.23.-tetrazine (170) to hOKT3 200 with Sortase A to Obtain hOKT3-PEG.SUB.23.-tetrazine PF02

    [0372] A bioconjugate according to the invention was prepared by C-terminal sortagging with sortase A (identified by SEQ ID NO: 2). To a solution of hOKT3 200 (1908 .Math.L, 5 mg, 91 .Math.M in PBS pH 7.4) was added sortase A (81 .Math.L, 948 .Math.g, 533 .Math.M in TBS pH 7.5 + 10% glycerol), GGG-PEG.sub.23-tetrazine (170, 347 .Math.L, 20 mM in MQ), CaCl.sub.2 (347 .Math.L, 100 mM in MQ) and TBS pH 7.5 (789 .Math.L). The reaction was incubated at 37° C. overnight. Mass spectral analysis showed one major product (observed mass 28787 Da), corresponding to hOKT3-PEG.sub.23-tetrazine PF02. The reaction was purified on a His-trap excel 1 mL column (GE Healthcare) on an AKTA Explorer-100 (GE Healthcare). The column was equilibrated with buffer A (20 mM Tris, 200 mM NaCl, 20 mM Imidazole, pH 7.5) and the sample was loaded with 1 mL/min. The flowthrough was dialyzed to PBS pH 6.5 followed by purification on a Superdex75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 6.5 as mobile phase.

    Example 102. C-terminal Sortagging of GGG-PEG.SUB.2.-arylazide (171) to hOKT3 200 with Sortase A to Obtain hOKT3-PEG.SUB.2.-arylazide PF03

    [0373] A bioconjugate according to the invention was prepared by C-terminal sortagging with sortase A (identified by SEQ ID NO: 2). To a solution of hOKT3 200 (2092 .Math.L, 5 mg, 83 .Math.M in PBS pH 7.4) was added sortase A (95 .Math.L, 950 .Math.g, 456 .Math.M in TBS pH 7.5 + 10% glycerol), GGG-PEG.sub.2-arylazide (171, 347 .Math.L, 20 mM in MQ), CaCl.sub.2 (347 .Math.L, 100 mM in MQ) and TBS pH 7.5 (591 .Math.L). The reaction was incubated at 37° C. overnight. Mass spectral analysis showed one major product (observed mass 27865 Da), corresponding to hOKT3-PEG.sub.2-arylazide PF03. The reaction was purified on a His-trap excel 1 mL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare). The column was equilibrated with buffer A (20 mM Tris, 200 mM NaCl, 20 mM Imidazole, pH 7.5) and the sample was loaded with 1 mL/min. The flowthrough purified on a Superdex75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase.

    Example 103. C-terminal Sortagging of Compound GGG-PEG.SUB.23.-BCN (163) anti-4-1BB PF31 With Sortase A to Obtain Anti-4-1BB PF07

    [0374] A bioconjugate according to the invention was prepared by C-terminal sortagging with sortase A (identified by SEQ ID NO: 2). To a solution of anti-4-1BB-PF31 (665 .Math.L, 2 mg, 107 .Math.M in PBS pH 7.4) was added sortase A (100 .Math.L, 1 mg, 357 .Math.M in TBS pH 7.5 + 10% glycerol), GGG-PEG.sub.23-BCN (163, 140 .Math.L, 20 mM in MQ), CaCl.sub.2 (140 .Math.L, 100 mM in MQ) and TBS pH 7.5 (355 .Math.L). The reaction was incubated at 37° C. overnight followed by purification on a His-trap excel 1 mL column (GE Healthcare) on an AKTA Explorer-100 (GE Healthcare). The column was equilibrated with buffer A (20 mM Tris, 200 mM NaCl, 20 mM Imidazole, pH 7.5) and the sample was loaded with 1 mL/min. The flowthrough was collected and after concentration purified on a Superdex75 10/300 column (Cytiva). Mass spectral analysis showed one major product (observed mass 28478 Da) corresponding to anti-4-1BB-BCN PF07.

    Example 104. C-Terminal Sortagging of GGG-PEG.SUB.11.-tetrazine (169) in Anti-4-1BB PF31 with Sortase A to Obtain Anti-4-1BB-PEG.SUB.11.-tetrazine PF08

    [0375] To a solution containing protein PF31 (1151 .Math.L, 93 .Math.M in TBS pH 7.5) was added TBS pH 7.5 (512 .Math.L), CaCl.sub.2 (214 .Math.L, 100 mM) and GGG-PEG.sub.11-tetrazine (169, 220 .Math.L, 20 mM in MQ) and Sortase A (50 .Math.L, 533 .Math.M in TBS pH 7.5). The reaction was incubated at 37° C. overnight followed by purification on a His-trap excel 1 mL column (GE Healthcare) on an AKTA Explorer-100 (GE Healthcare). The column was equilibrated with buffer A (20 mM Tris, 200 mM NaCl, 20 mM Imidazole, pH 7.5) and the sample was loaded with 1 mL/min. The flowthrough was collected and mass spectral analysis showed one major product (Observed mass 27989 Da) corresponding to 4-1BB-tetrazine PF08.

    Example 105. C-terminal Sortagging of Compound GGG-PEG.SUB.2.-arylazide (171) Anti-4-1BB-PF31 with Sortase A to Obtain Anti-4-1BB PF09

    [0376] A bioconjugate according to the invention was prepared by C-terminal sortagging with sortase A (identified by SEQ ID NO: 2). To a solution of anti-4-1BB-PF31 (665 .Math.L, 2 mg, 107 .Math.M in PBS pH 7.4) was added sortase A (100 .Math.L, 1 mg, 357 .Math.M in TBS pH 7.5 + 10% glycerol), GGG-PEG.sub.2-arylazide (171, 140 .Math.L, 20 mM in MQ), CaCl.sub.2 (140 .Math.L, 100 mM in MQ) and TBS pH 7.5 (355 .Math.L). The reaction was incubated at 37° C. overnight followed by purification on a His-trap excel 1 mL column (GE Healthcare) on an AKTA Explorer-100 (GE Healthcare). The column was equilibrated with buffer A (20 mM Tris, 200 mM NaCl, 20 mM Imidazole, pH 7.5) and the sample was loaded with 1 mL/min. The flowthrough was collected and mass spectral analysis showed one major product (observed mass 27592 Da) corresponding to anti-4-1BB-azide PF09.

    Example 106. N-Terminal Sortagging of BCN-LPETGG (172) in GGG-IL15Rα-IL15 (208) with Sortase A to Obtain BCN-IL15Rα-IL15 (PF10)

    [0377] To a solution containing protein 208 (465 .Math.L, 133 .Math.M in TBS pH 7.5) was added TBS pH 7.5 (1400 .Math.L), CaCl.sub.2 (124 .Math.L, 100 mM), 172 (371 .Math.L, 5 mM in DMSO) and Sortase A (115 .Math.L, 537 .Math.M in TBS pH 7.5) and incubated 3 hours at 37° C. After incubation, Sortase A was removed from the solution using Ni-NTA beads (300 .Math.L Beads= 600 .Math.L). The solution was incubated 1 hour with Ni-NTA beads on a roller bank, whereafter the solution was centrifuged (5 min, 7.000 xg). The supernatant, which contained the product PF10, was collected by separation of the supernatant from the pellet. The reaction mixture was loaded on to a Superdex 75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase and a flow of 0.5 mL/min. Mass spectrometry analysis showed a weight of 23582 Da (expected mass: 23579 Da) corresponding to PF10.

    Example 107. N-Terminal Sortagging of BCN-PEG.SUB.24.-LPETGG (173) in GGG-IL15Rα-IL15 (208) with sortase A to obtain BCN-PEG.SUB.24.-IL15Rα-IL15 (PF11)

    [0378] To a solution containing protein 208 (465 .Math.L, 133 .Math.M in TBS pH 7.5) was added TBS pH 7.5 (1400 .Math.L), CaCl.sub.2 (124 .Math.L, 100 mM) and 173 (371 .Math.L, 5 mM in DMSO) and Sortase A (115 .Math.L, 537 .Math.M in TBS pH 7.5) and incubated 3 hours at 37° C. After incubation, Sortase A was removed from the solution using Ni-NTA beads (300 .Math.L Beads= 600 .Math.L). The solution was incubated 1 hour with Ni-NTA beads on a roller bank, whereafter the solution was centrifuged (5 min, 7.000 xg). The supernatant, which contained the product PF11, was collected by separation of the supernatant from the pellet. The reaction mixture was loaded on to a Superdex 75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase and a flow of 0.5 mL/min. Mass spectrometry analysis showed a weight of 24682 Da (expected mass: 24680 Da) corresponding to PF11.

    Example 108. N-Terminal Sortaggingof Tetrazine-PEG.SUB.3.-LPETGG (174) in GGG-IL15Rα-IL15 (208) with Sortase A to Obtain Tetrazine-PEG.SUB.3.-IL15Rα-IL15 (PF12)

    [0379] To a solution containing protein 208 (465 .Math.L, 133 .Math.M in TBS pH 7.5) was added TBS pH 7.5 (1400 .Math.L), CaCl.sub.2 (124 .Math.L, 100 mM) and 174 (371 .Math.L, 5 mM in DMSO) and Sortase A (115 .Math.L, 537 .Math.M in TBS pH 7.5) and incubated 3 hours at 37° C. After incubation, Sortase A was removed from the solution using Ni-NTA beads (300 .Math.L Beads= 600 .Math.L slurry). The solution was incubated 1 hour with Ni-NTA beads on a roller bank, whereafter the solution was centrifuged (5 min, 7.000 xg). The supernatant, which contained the product PF12, was collected by separation of the supernatant from the pellet. The reaction mixture was loaded on to a Superdex 75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase and a flow of 0.5 mL/min. Mass spectrometry analysis showed a weight of 23824 Da (expected mass: 23822 Da) corresponding to PF12.

    [0380] Example 109. N-Terminal sortagging of Arylazide-PEG.sub.11-LPETGG (175) in GGG-IL15Rα-IL15 (208) with sortase A to obtain Arylazide-PEG.sub.11-GGG-IL15Rα-IL15 (PF13)

    [0381] To a solution containing protein 208 (2000 .Math.L, 140 .Math.M in TBS pH 7.5) was added TBS pH 7.5 (2686 .Math.L), CaCl.sub.2 (559 .Math.L, 100 mM) and 175 (83 .Math.L, 50 mM in DMSO) and Sortase A (260 .Math.L, 537 .Math.M in TBS pH 7.5) and incubated 3 hours at 37° C. (shielded from light). After incubation, Sortase A was removed from the solution using Ni-NTA beads (500 .Math.L Beads=1mL slurry). The solution was incubated ON at 4° C. with Ni-NTA beads on a roller bank, whereafter the solution was centrifuged (5 min, 7.000 xg). The supernatant, which contained the product PF13, was collected by separation of the supernatant from the pellet. The reaction mixture was loaded on to a Superdex 75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase and a flow of 0.5 mL/min. Mass spectrometry analysis showed a weight of 24193 Da (expected mass: 24193 Da) corresponding to PF13.

    [0382] Example 110. N-Terminal oxime ligation of BCN-PEG.sub.12-aminooxy (XL13) to SYR-(G.sub.4S).sub.3-IL15Rα-IL15 (PF26) to obtain BCN-PEG.sub.12-SYR-(G.sub.4S)3-IL15Rα-IL15 (PF14)

    [0383] Prior to labeling of PF26, the N-terminal serine was oxidated using Sodium periodate. To a solution containing protein PF26 (700 .Math.L, 70 .Math.M in PBS pH 7.4) was added PBS pH 7.4 (286 .Math.L), NalO.sub.4 (0.98 .Math.L, 100 mM in MQ) and L-methionine (5 .Math.L, 100 mM in MQ) and incubated 5 minutes at 4° C. Mass spectrometry analysis showed a weight of 24114 & 24130 Da corresponding to the expected masses of 24114 (aldehyde) and 24132 Da (hydrate). Using a PD-10 desalting column the excess NalO.sub.4 and L-methionine were removed. The oxidated PF26 was concentrated to a concentration of 50 .Math.M using Amicon spin filter 0.5, MWCO 10 kDa (Merck-Millipore). To a solution containing oxidized PF26 (416 .Math.L, 50 .Math.M in PBS pH 7.4) was added, XL13 (41.6 .Math.L, 50 mM in DMSO). After ON incubation at 37° C. the reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. Mass spectrometry analysis showed a weight of 25024 Da (expected mass: 25042 Da) corresponding to PF14.

    Example 111. N-terminal BCN Functionalization of IL15Rα-IL15 PF26 by SPANC to Obtain BCN-IL15Rα-IL15 PF15

    [0384] To IL15Ra-IL15 PF26 (2.9 mg, 50 .Math.M in PBS) was added 2 eq NalO.sub.4 (4.8 .Math.L of 50 mM stock in PBS) and 10 eq L-Methionine (12.5 .Math.L of 100 mM stock in PBS). The reaction was incubated for 5 minutes at 4° C. Mass spectral analysis showed oxidation of the serine into the corresponding aldehyde and hydrate (observed masses 24114 Da and 24132 Da). The reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. To the elute (2.6 mg, 50 .Math.M in PBS) was added 160 eq N-methylhydroxylamine.HCI (340 .Math.L of 50 mM stock in PBS) and 160 eq p-Anisidine (340 .Math.L of 50 mM stock in PBS). The reaction mixture was incubated for 3 hours at 25° C. Mass spectral analysis showed one single peak (observed mass 24143 Da) corresponding to N-methyl-imine-oxide-IL15. The reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. To the elute (2.47 mg, 50 .Math.M in PBS) was added 25 eq Bis-BCN-PEG.sub.11 (105) (51 .Math.L, 50 mM in DMSO) and 150 .Math.L DMF. The reaction was incubated overnight at room temperature. The reaction was purified using a Superdex75 10/300 column (Cytiva). Mass spectral analysis showed one major peak corresponding to BCN-IL15Rα-IL15 PF15 (observed mass 25041 Da).

    Example 112. N-Terminalincorporation of Maleimide-PEG2-BCN (XL05) in SYR-(G.SUB.4.S).SUB.3.-IL15Rα-IL15 (PF26) Using Strain-Promoted Alkyne-Nitrone Cycloaddition to Obtain Maleimide- PEG2-SYR-(G.SUB.4.S).SUB.3.-IL15Ra-IL15 (PF16)

    [0385] To IL15Ra-IL15 PF26 (2560 .Math.L, 50 .Math.M in PBS) was added 2 eq NalO.sub.4 (5.12 .Math.L of 50 mM stock in PBS) and 10 eq L-Methionine (12.8 .Math.L of 100 mM stock in PBS). The reaction was incubated for 5 minutes at 4° C. Mass spectral analysis showed oxidation of the serine into the corresponding aldehyde and hydrate (observed masses 24114 Da and 24132 Da). The reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. To the concentrated elute (2450 .Math.L, 50 .Math.M in PBS) was added 160 eq N-methylhydroxylamine.HCI (196 .Math.L of 100 mM stock in PBS) and 160 eq p-Anisidine (196 .Math.L of 100 mM stock in PBS). The reaction mixture was incubated for 3 hours at 25° C. Mass spectral analysis showed one single peak (observed mass 24143 Da) corresponding to N-methyl-imine-oxide-IL15Rα-IL15. The reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. To the concentrated elute (1134 .Math.L, 50 .Math.M in PBS) was added 25 eq maleimide-PEG.sub.2-BCN (XL05) (7.1 .Math.L, 200 mM in DMF) and 106 .Math.L DMF. The reaction was incubated o/n at RT. The reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. Mass spectral analysis showed the desired maleimide-BCN-SYR-(G.sub.4S).sub.3-IL15Ra-IL15 (PF16) (observed mass 24618 Da, expected mass: 24617 Da).

    Example 113. Diazotransfer to SYR-(G.SUB.4.S).SUB.3.-IL15Rα-IL15 PF26 to Obtain Azido-IL15Rα-IL15 PF17

    [0386] To a solution of SYR-(G.sub.4S).sub.3-IL15Rα-IL15 PF26 (3289 .Math.L, 5 mg, 63 .Math.M in 0.1 M triethanolamine pH 8.0) was added triethanolamine pH 8.0 (461 .Math.L, 0.1 M in MQ) and Imidazole-1-sulfonyl azide hydrochloride (commercially available from Fluorochem Ltd, 417 .Math.L, 50 mM solution dissolved in 50 mM NaOH in MQ, 100 equiv.). The reaction was incubated overnight at 37° C. followed by purification on a Superdex75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase. Mass spectral analysis showed one major product (observed mass 24171 Da), corresponding to azido-IL15Rα-IL15 PF17, and a minor byproduct (observed mass 24412 Da).

    Example 114. N-terminal Diazotransfer Reaction of IL15 PF18 to Obtain azido-IL 15 PF19

    [0387] To IL15 PF18 (5 mg, 50 .Math.M in 0.1 M TEA buffer pH 8.0) imidazole-1-sulfonylazide hydrochloride (708 .Math.L, 50 mM in 50 mM NaOH) was added and incubated overnight at 37° C. The reaction was purified using a HiPrep™ 26/10 Desalting column (Cytiva). Mass spectral analysis showed one main peak (observed mass 14147 Da) corresponding to azido-IL15 PF19.

    Example 115. N-Terminal Incorporation of tetrazine-PEG.SUB.12.-2PCA (XL10) in SYR-(G.SUB.4.S).SUB.3.-IL15 (PF18) using 2PCA to Obtain Tetrazine-PEG.SUB.12.-SYR-(G.SUB.4.S).SUB.3.-IL15 (PF21)

    [0388] To SYR-(G.sub.4S).sub.3-IL15 (PF18) (1052 .Math.L, 50 .Math.M in PBS) was added 20 eq. Tetrazine-PEG12-2PCA (XL10) (112 .Math.L of 50 mM stock in DMSO) and 4359 .Math.L PBS. The reaction was incubated overnight at 37° C. Using spinfiltration (Amicon Ultra-0.5, Ultracel-10 Membrane, Millipore) the sample was concentrated <1 mL and loaded on to a Superdex 75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase and a flow of 0.5 mL/min. Mass spectral analysis showed a weight of 24121 Da corresponding to the start material SYR-(G.sub.4S).sub.3-IL15 (PF18) (Expected mass: 14121 Da) and the a mass of 15093 Da corresponding to the product PF21 (Expected mass: 15094 Da).

    Example 116. Conjugation of tri-BCN (150) to hOKT3-PEG.SUB.2.-arylazide PF03 to Obtain bis-BCN-hOKT3 PF22

    [0389] To a solution of hOKT3-PEG.sub.2-arylazide PF03 (87 .Math.L, 1 mg, 411 .Math.M in PBS pH 7.4) was added PBS pH 7.4 (559 .Math.L), DMF (49 .Math.L) and compound 150 (22 .Math.L, 40 mM solution in DMF, 25 equiv.). The reaction was incubated overnight at RT. Mass spectral analysis showed one major product (observed mass 29171 Da), corresponding to bis-BCN-hOKT3 PF22. The reaction was purified on a Superdex75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase.

    Example 117. C-terminal Sortagging of GGG-bis-BCN 176 to hOKT3 200 With Sortase A to Obtain bis-BCN-hOKT3 PF23

    [0390] A bioconjugate according to the invention was prepared by C-terminal sortagging with sortase A (identified by SEQ ID NO: 2). To a solution of hOKT3 200 (272 .Math.L, 0.7 mg, 83 .Math.M in PBS pH 7.4) was added sortase A (25 .Math.L, 250 .Math.g, 456 .Math.M in TBS pH 7.5 + 10% glycerol), GGG-bis-BCN (176, 45 .Math.L, 20 mM in DMSO), CaCl.sub.2 (45 .Math.L, 100 mM in MQ) and TBS pH 7.5 (64 .Math.L). The reaction was incubated at 37° C. overnight. Mass spectral analysis showed one major product (observed mass 28772 Da), corresponding to bis-BCN-hOKT3 PF23. The reaction was purified on a Superdex75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase.

    Example 118. N-Terminal Incorporation of Tri-BCN (150) in SYR-(G.SUB.4.S).SUB.3.-IL15Rα-IL15 (PF26) Using Strain-Promoted Alkyne-Nitrone Cycloaddition to Obtain Bis-BCN- SYR-(G.SUB.4.S).SUB.3.-IL15Rα-IL15 (PF27)

    [0391] To IL15Rα-IL15 PF26 (3840 .Math.L, 50 .Math.M in PBS) was added 2 eq NalO.sub.4 (7.7 .Math.L of 50 mM stock in PBS) and 10 eq L-Methionine (19.2 .Math.L of 100 mM stock in PBS). The reaction was incubated for 5 minutes at 4° C. Mass spectral analysis showed oxidation of the serine into the corresponding aldehyde and hydrate (observed masses 24114 Da and 24132 Da). The reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. To the concentrated elute (1800 .Math.L, 50 .Math.M in PBS) was added 160 eq N-methylhydroxylamine.HCl (320 .Math.L of 90 mM stock in PBS) and 160 eq p-Anisidine (288 .Math.L of 100 mM stock in PBS). The reaction mixture was incubated for 3 hours at 25° C. Mass spectral analysis showed one single peak (observed mass 24143 Da) corresponding to N-methyl-imine-oxide-IL15Rα-IL15. The reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. To the concentrated elute (3100 .Math.L, 60 .Math.M in PBS) was added 25 eq tri-BCN (150) (116 .Math.L, 40 mM in DMSO), 256 .Math.L DMF and PBS pH 7.4 (248 .Math.L). The reaction was incubated o/n at RT. The reaction mixture was loaded on to a Superdex 75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase and a flow of 0.5 mL/min. Mass spectral analysis showed the desired Bis-BCN-IL15Rα-IL15 PF27 (observed mass 25448 Da, expected mass 25447). RP-HPLC showed a labeling efficiency of 60%.

    Example 119. N-Terminal Incorporation of Bis-Maleimide-PEG.SUB.6.-BCN (XL01) in SYR-(G.SUB.4.S).SUB.3.-IL15Rα-IL15 (PF26) Using Strain-Promoted Alkyne-Nitrone Cycloaddition To Obtain Bis-Maleimide-PEG.SUB.6.-SYR-(G.SUB.4.S).SUB.3.-IL15Rα-IL15 (PF28)

    [0392] To SYR-(G.sub.4S).sub.3-IL15Rα-IL15 PF26 (2560 .Math.L, 50 .Math.M in PBS) was added 2 eq NalO.sub.4 (5.12 .Math.L of 50 mM stock in PBS) and 10 eq L-methionine (12.8 .Math.L of 100 mM stock in PBS). The reaction was incubated for 5 minutes at 4° C. Mass spectral analysis showed oxidation of the serine into the corresponding aldehyde and hydrate (observed masses 24114 Da and 24132 Da). The reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. To the concentrated elute (2450 .Math.L, 50 .Math.M in PBS) was added 160 eq N-methylhydroxylamine.HCI (196 .Math.L of 100 mM stock in PBS) and 160 eq p-anisidine (196 .Math.L of 100 mM stock in PBS). The reaction mixture was incubated for 3 hours at 25° C. Mass spectral analysis showed one single peak (observed mass 24143 Da) corresponding to N-methyl-imine-oxide-IL15Rα-IL15. The reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. To the concentrated elute (1134 .Math.L, 50 .Math.M in PBS) was added 25 eq bis-Maleimide-PEG.sub.6-BCN (XL01) (28.5 .Math.L, 50 mM in DMSO) and 86.5 .Math.L DMF. The reaction was incubated o/n at RT. The reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. Additional washing was performed using spinfiltration (Amicon Ultra-0.5, Ultracel-10 Membrane, Millipore), 6x with 400 .Math.L PBS, to remove remaining Bis-Maleimide-PEG.sub.2-BCN (XL01). Mass spectral analysis showed the desired Bis-maleimide-BCN-SYR-(G.sub.4S).sub.3-IL15Rα-IL15 (PF28) (observed mass 25145 Da, Expected mass 25144 Da).

    Example 120. N-Terminal Incorporation of Tri-BCN (150) in N.SUB.3.-SYR-(G.SUB.4.S).SUB.3.-IL15 (PF19) Using Strain-Promoted Alkyne-Azide Cycloaddition to Obtain Bis-BCN-SYR-(G.SUB.4.S).SUB.3.-IL15 (PF29)

    [0393] To N.sub.3-IL15 PF19 (706 .Math.L, 50 .Math.M in PBS) was added 4 eq tri-BCN (150) (3.5 .Math.L of 40 mM stock in DMF) and 67 .Math.L DMF. The reaction was incubated o/n at RT. Mass spectral analysis confirmed the formation of bis-BCN-SYR-(G.sub.4S).sub.3-IL15 PF29 (observed mass 15453 Da, expected mass 15453 Da). The reaction mixture was purified using PD-10 desalting columns packed with Sephadex G-25 resin (Cytiva) and eluted using PBS. Additional washing was performed using spin-filtration (Amicon Ultra-0.5, Ultracel-10 Membrane, Millipore), 6x with 400 .Math.L PBS, to remove remaining tri-BCN (150).

    Example 121. Enzymatic Deglycosylation of Trastuzumab With PNGase F

    [0394] Trastuzumab (Herzuma) (20 mg, 12.5 mg/mL in PBS pH 7.4) was incubated with PNGase F (16 .Math.L, 8000 units) at 37° C. Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 23787 Da) corresponding to the expected product.

    Example 122. Enzymatic Deglycosylation of Rituximab With PNGase F

    [0395] Rituximab (6 mg, 10 mg/mL in PBS pH 7.4) was incubated with PNGase F (6 .Math.L, 3000 units) at 37° C. Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 23754 Da) corresponding to the expected product.

    Example 123. Enzymatic Remodeling of Trastuzumab to Trastuzumab-(GalNAz).SUB.2 (trast-v1b)

    [0396] Trastuzumab (5 mg, 22.7 mg/mL) was incubated with EndoSH, described in PCT/EP2017/052792 (1% w/w), for 1 hour at room temperature followed by the addition of β(1,4)-Gal-T1(Y289L), (2% w/w) and UDP-GaINAz, (15 eq compared to IgG) in 10 mM MnCI2 and TBS for 16 hours at 30° C. After addition of the components the final concentration of trastuzumab is 19.6 mg/ml. The functionalized IgG was purified using a protA column (5 mL, MabSelect Sure, Cytiva). After loading of the reaction mixture, the column was washed with TBS. The IgG was eluted with 0.1 M NaOAc pH 3.5 and neutralized with 2.5 M Tris-HCI pH 7.2. After three times dialysis to PBS the functionalized trastuzumab was concentrated to 17.2 mg/mL using a Vivaspin Turbo 4 ultrafiltration unit (Sartorius). Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 24380 Da) corresponding to the expected product trast-v1b.

    Example 124. Enzymatic Remodeling of Trastuzumab to trastuzumab-(GalNAz).SUB.2 (trast-v2)

    [0397] Trastuzumab (5 mg, 22.7 mg/mL) was incubated with β(1,4)-Gal-T1(Y289L), (2% w/w) and UDP-GalNAz, (20 eq compared to IgG) in 10 mM MnCl.sub.2 and TBS for 16 hours at 30° C. After addition of the components the final concentration of trastuzumab is 19 mg/ml. The functionalized IgG was three times dialysed to PBS and concentrated to 19.45 mg/mL using a Vivaspin Turbo 4 ultrafiltration unit (Sartorius). Mass spectral analysis of a sample after IdeS treatment showed two major Fc/2 products (observed mass 25718 Da, approximately 50% of total Fc/2) corresponding to G0F with 2 × GalNAz and a minor product (observed mass 25636 Da, approximately 50% of total Fc/2) for G1F with 1 × GalNAz.

    Example 125. MTGase-catalyzed Incorpation of azido-PEG.SUB.3.-amine Onto Deglycosylated Trastuzumab to Give Bis-Azido-Trastuzumab Trast-v3

    [0398] To a solution of deglycosylated trastuzumab (806 .Math.L, 10 mg, 12.4 mg/mL in PBS pH 7.4) was added PBS pH 7.4 (3544 .Math.L), azido-PEG.sub.3-amine (commercially available from BroadPharm, 500 .Math.L, 10 mM solution in MQ, 75 equiv. compared to IgG) and recombinant microbial transglutaminase (commercially available from Zedira, 150 .Math.L, 15 U, 0.1 U/.Math.L). The reaction was incubated overnight at 37° C. Mass spectral analysis of an IdeS-digested sample showed one major product (observed mass 23988 Da), corresponding to bis-azido-trastuzumab trast-v3. The reaction was purified using a protA column (5 mL, MabSelect Sure, GE Healthcare) on an AKTA Explorer-100 (GE Healthcare) followed by dialysis to PBS pH 7.4.

    Example 126. MTGase-Catalyzed Incorpation of azido-Peg.SUB.3.-Amine Onto Deglycosylated Rituximab to Give Bis-Azido-Rituximab rit-v3

    [0399] To a solution of deglycosylated rituximab (90 .Math.L, 1.8 mg, 20.2 mg/mL in PBS pH 7.4) was added PBS pH 7.4 (693 .Math.L), azido-PEG.sub.3-amine (commercially available from BroadPharm, 90 .Math.L, 10 mM solution in MQ, 75 equiv. compared to IgG) and recombinant microbial transglutaminase (commercially available from Zedira, 27 .Math.L, 2.7 U, 0.1 U/.Math.L). The reaction was incubated overnight at 37° C. Mass spectral analysis of an IdeS-digested sample showed one major product (observed mass 23956 Da), corresponding to bis-azido-rituximab rit-v3. The reaction was buffer exchange to PBS pH 7.4 using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore).

    Example 127. Enzymatic Remodeling of Trastuzumab to trastuzumab-(GalNProSSMe).SUB.2 (trast-v5a)

    [0400] Trastuzumab (5 mg, 22.7 mg/mL) was incubated with EndoSH, described in PCT/EP2017/052792 (1% w/w), for 1 hour followed by the addition TnGalNAcT (expressed in CHO), (10% w/w) and UDP-GalProSSMe, (318, 40 eq compared to IgG) in 10 mM MnCl.sub.2 and TBS for 16 hours at 30° C. After addition of the components the final concentration of trastuzumab is 12.5 mg/ml. The functionalized IgG was purified using a protA column (5 mL, MabSelect Sure, Cytiva). After loading of the reaction mixture the column was washed with TBS. The IgG was eluted with 0.1 M NaOAc pH 3.5 and neutralized with 2.5 M Tris-HCI pH 7.2. After three times dialysis to PBS the functionalized trastuzumab was concentrated to 17.4 mg/mL using a Vivaspin Turbo 4 ultrafiltration unit (Sartorius). Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 24430 Da) corresponding to the expected product (trast-v5a).

    Example 128. Enzymatic Remodeling of Trastuzumab to trastuzumab-(GalNAc-Lev).SUB.2 (trast-v8)

    [0401] Trastuzumab (5 mg, 22.7 mg/mL) was incubated with EndoSH, described in PCT/EP2017/052792 (1% w/w), for 1 hour followed by the addition of β(1,4)-Gal-T1(Y289L), (10% w/w) and UDP-GaINAc-Lev (11 g, x = 1) prepared according example 9-17 in WO2014/065661A1), (75 eq compared to IgG) in 10 mM MnCl.sub.2 and TBS for 16 hours at 30° C. After addition of the components the final concentration of trastuzumab is 14.4 mg/ml. The functionalized IgG was purified using a protA column (5 mL, MabSelect Sure, Cytiva). After loading of the reaction mixture, the column was washed with TBS. The IgG was eluted with 0.1 M NaOAc pH 3.5 and neutralized with 2.5 M Tris-HCI pH 7.2. After three times dialysis to PBS the functionalized trastuzumab was concentrated to 10.6 mg/mL using a Vivaspin Turbo 4 ultrafiltration unit (Sartorius). Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 24393 Da) corresponding to the expected product (trast-v8).

    Example 129. Enzymatic Remodeling of Trastuzumab to trastuzumab-(GalNAc-alkyne).SUB.2 (trast-v9)

    [0402] Trastuzumab (5 mg, 22.7 mg/mL) was incubated with EndoSH, described in PCT/EP2017/052792 (1% w/w), for 1 hour followed by the addition of β(1,4)-Gal-T1(Y289L), (2% w/w) and UDP-GaINAc-Alkyne, (11f, x = 1) prepared according example 9-16 in WO2014/065661A1), (15 eq compared to IgG) in 10 mM MnCl.sub.2 and TBS for 16 hours at 30° C. After addition of the components the final concentration of trastuzumab is 19.6 mg/ml. The functionalized IgG was purified using a protA column (5 mL, MabSelect Sure, Cytiva). After loading of the reaction mixture the column was washed with TBS. The IgG was eluted with 0.1 M NaOAc pH 3.5 and neutralized with 2.5 M Tris-HCI pH 7.2. After three times dialysis to PBS the functionalized trastuzumab was concentrated to 12.1 mg/mL using a Vivaspin Turbo 4 ultrafiltration unit (Sartorius). Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 24379 Da) corresponding to the expected product trast-v9.

    Example 130. Conjugation of Trastuzumab(6-N.SUB.3.-GalNAc).SUB.2.205 with 201 to Obtain Conjugate 206

    [0403] A bioconjugate according to the invention was prepared by conjugation of BCN-modified hOKT3 201 to azide-modified trastuzumab 205. To a solution of trastuzumab-(6-N.sub.3-GalNAc)2 prepared according to WO2016170186 (205, 2 .Math.L, 75 .Math.g, 250 .Math.M in PBS pH 7.4) was added hOKT3-PEG.sub.2-BCN 201 (9.9 .Math.L, 28 .Math.g, 101 .Math.M in PBS pH 7.4). The reaction was incubated at rt overnight. Mass spectral analysis of the Fabricator™-digested sample showed two major products (observed masses 24368 Da and 52196 Da, each approximately 50%), corresponding to the azido-modified Fc/2-fragment and conjugate 206, respectively.

    Example 131. Cloning of His.SUB.6.-SSGENLYFQ-GGG-IL15Rα-IL15 into pET32a Expression Vector

    [0404] The IL15Rα-IL15 fusion protein 207 was designed with an N-terminal His-tag (HHHHHH), TEV protease recognition sequence (SSGENLYFQ) and an N-terminal sortase A recognition sequence (GGG). A pET32A-vector containing a DNA sequence encoding His.sub.6-SSGENLYFQ-GGG-IL15RaIL15 (SEQ ID NO: 3) between base pairs 158 and 692, thereby removing the thioredoxin coding sequence, was obtained from Genscript.

    Example 132. E. Coli Expression of His.SUB.6.-SSGENLYFQ-GGG-IL15Rα-IL15 (207) and Inclusion Body Isolation

    [0405] Expression of His.sub.6-SSGENLYFQ-GGG-IL15Rα-IL15 207 starts with the transformation of the plasmid (pET32a-IL15Rα-IL15) into BL21 cells (Novagen). Next step was the inoculation of 500 mL culture (LB medium + ampicillin) with BL21 cells. When OD600 reached 0.7, cultures were induced with 1 mM IPTG (500 .Math.L of 1 M stock solution). After 4 hour induction at 37° C., the culture was pelleted by centrifugation. The cell pellet gained from 500 mL culture was lysed in 25 mL BugBuster™ with 625 units of benzonase and incubated on roller bank for 20 min at room temperature. After lysis the insoluble fraction was separated from the soluble fraction by centrifugation (20 minutes, 12000 x g, 4° C.). The insoluble fraction was dissolved in 25 mL BugBuster™ with lysozyme (final concentration: 200 .Math.g/mL) and incubated on the roller bank for 5 min. Next the solution was diluted with 6 volumes of 1:10 diluted BugBuster™ and centrifuged 15 min, 9000 × g at 4° C. The pellet was resuspended in 250 mL of 1:10 diluted BugBuster™ by using the homogenizer and centrifuged at 15 min, 9000 x g at 4° C. The last step was repeated 3 times.

    Example 133. Refolding of His.SUB.6.-SSGENLYFQ-GGG-IL15Rα-IL15 207 from Isolated Inclusion Bodies

    [0406] The purified inclusion bodies containing His.sub.6-SSGENLYFQ-GGG-IL15Rα-IL15 207, were sulfonated o/n at 4° C. in 25 mL denaturing buffer (5 M guanidine, 0.3 M sodium sulphite) and 2.5 mL 50 mM disodium 2-nitro-5-sulfobenzonate. The solution was diluted with 10 volumes of cold Milli-Q and centrifuged (10 min at 8000 x g). The pellet was solved in 125 mL cold Milli-Q using a homogenizer and centrifuged (10 min at 8000 x g). The last step was repeated 3 times. The purified His.sub.6-SSGENLYFQ-GGG-IL15Rα-IL15 207 was denatured in 5 M guanidine and diluted to a concentration of 1 mg/mL of protein. Using a syringe with a diameter of 0.8 mm, the denatured protein was added dropwise to 10 volumes refolding buffer (50 mM Tris, 10.53 mM NaCl, 0.44 mM KCI, 2.2 mM MgCl.sub.2, 2.2 mM CaCl.sub.2, 0.055% PEG-4000, 0.55 M L-arginine, 8 mM cysteamine, 4 mM cystamine, at pH 8.0) on ice and was incubate 48 hours at 4° C. (stirring not required). The refolded His.sub.6-SSGENLYFQ-GGG-IL15Rα-IL15 207 was loaded on a 20 mL HisTrap excel column (GE health care) on an AKTA Purifier-10 (GE Healthcare). The column was first washed with buffer A (5 mM Tris buffer, 20 mM imidazole, 500 mM NaCl, pH 7.5). Retained protein was eluted with buffer B (20 mM Tris buffer, 500 mM imidazole, 500 mM NaCl, pH 7.5) on a gradient of 25 mL from buffer A to buffer B. Fractions were analysed by SDS-PAGE on polyacrylamide gels (16%). The fractions that contained purified target protein were combined and the buffer was exchanged against TBS (20 mM Tris pH 7.5 and 150 mM NaCl.sub.2) by dialysis performed overnight at 4° C. The purified protein was concentrated to at least 2 mg/mL using Amicon Ultra-0.5, MWCO 3 kDa (Merck-Millipore). Mass spectral analysis showed a weight of 25044 Da (expected: 25044 Da). The product was stored at -80° C. prior to further use.

    Example 134. TEV Cleavage of His.SUB.6.-SSGENLYFQ-GGG-IL15Rα-IL15 207 to Obtain GGG-IL15Rα-IL15 208

    [0407] To a solution of His.sub.6-SSGENLYFQ-GGG-IL15Rα-IL15 (207, 330 .Math.L, 2.3 mg/mL in TBS pH 7.5), was added TEV protease (50.5 .Math.L, 10 Units/.Math.L in 50 mM Tris-HCI, 250 mM NaCl, 1 mM TCEP, 1 mM EDTA, 50% glycerol, pH 7.5, New England Biolabs). The reaction was incubated for 1 hour at 30° C. After TEV cleavage, the solution was purified using size exclusion chromatography. The reaction mixture was loaded on to a Superdex 75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using TBS pH 7.5 as mobile phase and a flow of 0.5 mL/min. GGG-IL15Rα-IL15 208 was eluted at a retention time of 12 mL. The purified protein was concentrated to at least 2 mg/mL using an Amicon Ultra-0.5, MWCO 3 kDa (Merck Millipore). The product was analysed with mass spectrometry (observed mass: 22965 Da, expected mass: 22964 Da), corresponding to GGG-IL15Rα-IL15 208. The product was stored at -80° C. prior to further use.

    Example 135. Incorporation of BCN-PEG.SUB.12.-LPETGG (168) in GGG-IL15Rα-IL15 208 Using Sortase A to Obtain BCN-PEG.SUB.12.-IL15Rα-IL15 (209)

    [0408] To a solution of GGG-IL15Rα-IL15 (208, 219 .Math.L, 91.4 .Math.M in TBS pH 7.5) was added TBS pH 7.5 (321 .Math.L), CaCl.sub.2 (40.0 .Math.L, 100 mM) and BCN-PEG.sub.12-LPETGG (168, 120 .Math.L, 5 mM in DMSO) and incubated 1 hour at 37° C. After incorporation of 168 was complete, sortase A was removed from the solution using the same volume of Ni-NTA beads as reaction volume (800 .Math.L). The solution was incubated for 1 hour in a spinning wheel/or table shaker, afterwards the solution was centrifuged (2 min, 13000 rpm) and the supernatant was discarded. BCN-PEG.sub.12-IL15Rα-IL15 (209) was collected from the beads by incubating the beads 5 min with 800 .Math.L washing buffer (40 mM imidazole, 20 mM Tris, 0.5 M NaCI) in a table shaker at 800 rpm. The beads were centrifuged (2 min, 13000 x rpm), the supernatant containing 209 was separated and the buffer was exchanged to TBS by dialysis o/n at 4° C. Finally, the solution was concentrated to 0.5-1 mg/mL using Amicon spin filter 0.5, MWCO 3 kDa (Merck-Millipore). Mass spectrometry analysis showed a weight of 24155 Da (expected mass: 24152) corresponding to BCN-PEG.sub.12-IL15Rα-IL15 (209).

    Example 136. Conjugation of BCN-PEG.SUB.12.-IL15Ra-IL15 (209) to Trastuzumab(6-N.SUB.3.-GaINAc).SUB.2.205 to Obtain Conjugate 210

    [0409] A bioconjugate according to the invention was prepared by conjugation of 209 to azide-modified trastuzumab (205, trastuzumab(6-N.sub.3-GaINAc).sub.2, prepared according to WO2016170186) in a 2:1 molar ratio. Thus, to a solution of BCN-PEG.sub.12-IL15Rα-IL15 (209, 20 .Math.L, 20 .Math.M in TBS pH 7.4) wasadded trastuzumab(6-N.sub.3-GaINAc).sub.2 (205, 1.2 .Math.L, 82 .Math.M in PBS pH 7.4) and incubated o/n at 37° C. Mass spectral analysis of the IdeS-digested sample showed a mass of 48526 Da (expected mass: 48518 Da) corresponding to the Fc/2-fragment of conjugate 210.

    Example 137. Intramolecular Cross-linking of Trastuzumab-(azide).SUB.2 with Bivalent Linker 105 to Give 211

    [0410] To a solution of trastuzumab-(6-azidoGaINAc).sub.2 (7.5 .Math.L, 150 .Math.g, 17.56 mg/mL in PBS pH 7.4; also referred to as trast-v1a), prepared according to WO2016170186, was added compound 105 (2.5 .Math.L, 0.8 mM solution in DMF, 2 equiv. compared to IgG). The reaction was incubated for 1 day at RT followed by buffer exchange to PBS pH 7.4 using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck-Millipore). Mass spectral analysis of the IdeS digested sample showed one major product (calculated mass 49625 Da, observed mass 49626 Da), corresponding to intramolecularly cross-linked trastuzumab derivative 211. HPLC-SEC showed <4% aggregation, hence excluding intermolecular cross-linking.

    Example 138. Intramolecular Cross-linking of Trastuzumab-(azide).SUB.2 with Bivalent Linker 107 to Give 212

    [0411] To a solution of trastuzumab-(6-azido-GaINAc).sub.2 (7.5 .Math.L, 150 .Math.g, 17.56 mg/mL in PBS pH 7.4) was added compound 107 (2.5 .Math.L, 4 mM solution in DMF, 10 equiv. compared to IgG). The reaction was incubated for 1 day at RT followed by buffer exchange to PBS pH 7.4 using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck-Millipore). Mass spectral analysis of the IdeS digested sample showed the product (calculated mass 50153 Da, observed mass 50158 Da), corresponding to intramolecularly cross-linked trastuzumab derivative 212. HPLC-SEC showed <4% aggregation, hence excluding intermolecular cross-linking.

    Example 139. Intramolecular Cross-Linking of Trastuzumab-(azide).SUB.2 with Bivalent Linker 117 to Give 213

    [0412] To a solution of trastuzumab-(6-azidoGaINAc).sub.2 (7.5 .Math.L, 150 .Math.g, 17.56 mg/mL in PBS pH 7.4) was added compound 117 (2.5 .Math.L, 0.8 mM solution in DMF, 2 equiv. compared to IgG). The reaction was incubated for 1 day at RT followed by buffer exchange to PBS pH 7.4 using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). Mass spectral analysis of the IdeS digested sample showed one major product (calculated mass 49580 Da, observed mass 49626 Da), corresponding to intramolecularly cross-linked trastuzumab derivative 213. HPLC-SEC showed <4% aggregation, hence excluding intermolecular cross-linking.

    Example 140. Intramolecular Cross-Linking of Trastuzumab-(azide).SUB.2 with Bivalent Linker 118 to Give 214

    [0413] To a solution of trastuzumab-(6-azidoGaINAc).sub.2 (7.5 .Math.L, 150 .Math.g, 17.56 mg/mL in PBS pH 7.4) was added compound 118 (2.5 .Math.L, 4 mM solution in DMF, 10 equiv. compared to IgG). The reaction was incubated for 1 day at RT followed by buffer exchange to PBS pH 7.4 using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). Mass spectral analysis of the IdeS digested sample showed the product (calculated mass 49358 Da, observed mass 49361 Da), corresponding to intramolecularly cross-linked trastuzumab derivative 214. HPLC-SEC showed <4% aggregation, hence excluding intermolecular cross-linking.

    Example 141. Intramolecular Cross-Linking of Trastuzumab-(azide).SUB.2 with Bivalent Linker 124 to Give 215

    [0414] To a solution of trastuzumab-(6-azidoGaINAc).sub.2 (7.5 .Math.L, 150 .Math.g, 17.56 mg/mL in PBS pH 7.4) was added compound 124 (2.5 .Math.L, 4 mM solution in DMF, 10 equiv. compared to IgG). The reaction was incubated for 1 day at RT followed by buffer exchange to PBS pH 7.4 using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). Mass spectral analysis of the IdeS digested sample showed the product (calculated mass 49406 Da, observed mass 49409 Da), corresponding to intramolecularly cross-linked trastuzumab derivative 215. HPLC-SEC showed <4% aggregation, hence excluding intermolecular cross-linking.

    Example 142. Intramolecular Cross-linking of Trastuzumab-(azide).SUB.2 with Bivalent Linker 125 to Give 216

    [0415] To a solution of trastuzumab-(6-azidoGaINAc).sub.2 (7.5 .Math.L, 150 .Math.g, 17.56 mg/mL in PBS pH 7.4) was added compound 125 (2.5 .Math.L, 0.8 mM solution in DMF, 2 equiv. compared to IgG). The reaction was incubated for 1 day at RT followed by buffer exchange to PBS pH 7.4 using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). Mass spectral analysis of the IdeS digested sample showed one major product (calculated mass 49184 Da, observed mass 49184 Da), corresponding to intramolecularly cross-linked trastuzumab derivative 216. HPLC-SEC showed <4% aggregation, hence excluding intermolecular cross-linking.

    Example 143. Intramolecular Cross-Linking of Trastuzumab-(azide).SUB.2 with Bivalent Linker 145 to Give 217

    [0416] To a solution of trastuzumab-(6-azidoGaINAc).sub.2 (320 .Math.L, 2 mg, 5.56 mg/mL in PBS pH 7.4) was added compound 145 (80 .Math.L, 1.66 mM solution in DMF, 10 equiv. compared to IgG). The reaction was incubated for 1 day at RT followed by buffer exchange to PBS pH 7.4 using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). Mass spectral analysis of the IdeS digested sample showed one major product (calculated mass 49796 Da, observed mass 49807 Da), corresponding to intramolecularly cross-linked trastuzumab derivative 217. HPLC-SEC showed <4% aggregation, hence excluding intermolecular cross-linking.

    Example 144. Intramolecular Cross-linking of Trastuzumab Derivative 217 (Containing Single BCN) with Tetrazine-Modified Anti-CD3 Immune Cell Engager 204 to Give T Cell Engager 221 with 2:1 Molecular Format

    [0417] To a solution of 217 (8 .Math.L, 141 .Math.g, 17.7 mg/mL in PBS pH 7.4) was added hOKT3-PEG.sub.4-tetrazine (204, 13.15 .Math.L, 280 .Math.g, 21.45 mg/mL in PBS pH 7.4, 2 equiv. compared to IgG). Mass spectral analysis of the IdeS-digested sample showed one major product (calculated mass 77664 Da, observed mass 77647 Da), corresponding to the conjugated Fc-PEG.sub.4-hOKT3 (221).

    Example 145. Intramolecular Cross-linking of Bis-azido-rituximab Rit-v1a With Trivalent Linker 145 to give BCN-rituximab rit-v1a-145

    [0418] To a solution of bis-azido-rituximab rit-v1a (494 .Math.L, 30 mg, 60.7 mg/mL in PBS pH 7.4), prepared according to WO2016170186, was added PBS pH 7.4 (2506 .Math.L), propylene glycol (2980 .Math.L) and trivalent linker 145 (20 .Math.L, 40 mM solution in DMF, 4.0 equiv. compared to IgG). The reaction was incubated overnight at rt followed by purification on a Superdex200 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase. Reducing SDS-PAGE showed one major HC product, corresponding to the crosslinked heavy chain (See FIG. 19, right panel, lane 3), indicating formation of rit-v1a-145. Furthermore, non-reducing SDS-PAGE showed one major band around the same height as rit-v1a (See FIG. 19, left panel, lane 3), demonstrating that only intramolecular cross-linking occurred.

    Example 146. Intramolecular Cross-linking of bis-azido-B12 B12-v1a With Trivalent Linker 145 to Give BCN-B12 B12-v1a-145

    [0419] To a solution of bis-azido-B12 B12-v1a (415 .Math.L, 4 mg, 9.6 mg/mL in PBS pH 7.4), prepared according to WO2016170186, was added propylene glycol (412 .Math.L) and trivalent linker 145 (2.7 .Math.L, 40 mM solution in DMF, 4.0 equiv. compared to IgG). The reaction was incubated overnight at rt followed by purification on a Superdex200 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase. RP-HPLC analysis of an IdeS-digested sample shows formation of B12-v1a-145. (See FIG. 20).

    Example 147. Intramolecular Crosslinking Trastuzumab-GaINProSSMe Trast-v5a With bis-maleimide-BCN XL01

    [0420] Trastuzumab-GaINProSSMe (trast-v5a) (1.2 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v5a) was incubated with TCEP (7.8 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and diluted to 100 .Math.L. Subsequent DHA (6.5 .Math.L, 10 mM in MQ:DMSO (9:1)) was added and the reaction was incubated for 3 hours at room temperature. To a part of the reaction mixture (82 .Math.L, 0.8 mg) was added bis-maleimide-BCN XL01 (8 .Math.L, 2 mM in DMF) followed by incubation for 1 hour at room temperature. The conjugate was spinfiltered to PBS using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). RP-HPLC analysis of DTT treated sample showed the conversion into the conjugate trast-v5b-XL01 (see FIG. 21).

    Example 148. Intramolecular Crosslinking Trastuzumab-S239C Mutant Trast-v6 With bis-maleimide-BCN XL01

    [0421] Trastuzumab S239C mutant (transient expressed in CHO by Evitria, heavy chain mutation S239C) (2 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v6) was incubated with TCEP (13 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and diluted to 200 .Math.L. Subsequent DHA (13 .Math.L, 10 mM in MQ:DMSO (9:1)) was added and the reaction was incubated for 3 hours at room temperature. To a part of the reaction mixture (176 .Math.L, 1.5 mg) was added bis-maleimide-BCN XL01 (15 .Math.L, 2 mM in DMF) followed by incubation for 1 hour at room temperature. The conjugate was spin-filtered to PBS using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). RP-HPLC analysis of DTT treated sample showed 71% conversion into the conjugate trast-v6-XL01 (see FIG. 22).

    Example 149. Intramolecular Crosslinking Trastuzumab Trast-v7 With bis-maleimide-BCN XL01

    [0422] Trastuzumab (1 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v7) was incubated with TCEP (6.5 .Math.L, 10 mM in MQ) for 2 hours at 37° C. To the reaction mixture was added bis-maleimide-BCN XL01 (10 .Math.L, 2 mM in DMF) followed by incubation for 2 hours at room temperature. The conjugate was spinfiltered to PBS using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). SDS-page gel analysis under reducing conditions showed the formation of the conjugate trast-v7-XL01 (see FIG. 23).

    Example 150. Intramolecular Crosslinking Trastuzumab GaINProSSMe Trast-v5a With Bis-maleimide-azide XL02

    [0423] Trastuzumab GaINProSSMe (1.5 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v5a) was incubated with TCEP (9.3 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and diluted to 150 .Math.L. Subsequent DHA (9.3 .Math.L, 10 mM in DMSO) was added and the reaction was incubated for 3 hours at room temperature. To a portion of the reaction (100 .Math.L, 1 mg antibody) was added bis-maleimide azide XL02 (10 .Math.L, 4 mM in DMF) followed by incubation for 1 hour at room temperature. The conjugate was spinfiltered to PBS using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and subsequent analyzed on RP-HPLC and SDS-page gel (see FIG. 24)and 24. RP-HPLC analysis of DTT treated conjugate, showed the conversion into the conjugate trast-v5b-XL02

    Example 151. Intramolecular Crosslinking Trastuzumab S239C Mutant Trast-v6 With Bis-maleimide-azide XL02

    [0424] Trastuzumab S239C mutant (transient expressed in CHO by Evitria, heavy chain mutation S239C) (2 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v6) was incubated with TCEP (13 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and subsequent diluted to 200 .Math.L. Subsequent DHA (13 .Math.L, 10 mM in DMSO) was added and the reaction was incubated for 3 hours at room temperature. To a portion of the reaction (62 .Math.L, 660 .Math.g antibody) was added bis-maleimide azide XL02 (6.6 .Math.L, 4 mM in DMF) followed by incubation for 1 hour at room temperature. The conjugate was spinfiltered to PBS using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and subsequent analyzed on RP-HPLC and SDS-page gel (see FIGS. 25 and 26). RP-HPLC analysis of DTT treated conjugate, showed 74% conversion into the conjugate trast- v6-XL02.

    Example 152. Intramolecular Crosslinking Trastuzumab S239C Mutant Trast-v6 With C-Lock-Azide XL03

    [0425] Trastuzumab S239C mutant (transient expressed in CHO by Evitria, heavy chain mutation S239C) (2 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v6) was incubated with TCEP (13 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and subsequent diluted to 200 .Math.L. Subsequent DHA (13 .Math.L, 10 mM in DMSO) was added and the reaction was incubated for 3 hours at room temperature. To a portion of the reaction (62 .Math.L, 660 .Math.g antibody) was added C— lock azide XL03 (6.6 .Math.L, 2.7 mM in DMF) followed by incubation overnight at 37° C. The conjugate was spinfiltered to PBS using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and subsequent analyzed on RP-HPLC and SDS-page gel (see FIGS. 28 and 29). RP-HPLC analysis of DTT treated conjugate, showed 78% conversion into the conjugate trast-v6-XL03.

    Example 153. Intramolecular Crosslinking Trastuzumab S239C Mutant Trast-v6 With maleimide-BCN (XL05).SUB.2

    [0426] Trastuzumab S239C mutant (transient expressed in CHO by Evitria, heavy chain mutation S239C) (1 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v6) was incubated with TCEP (6.5 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and diluted to 100 .Math.L. Subsequent DHA (6.5 .Math.L, 10 mM in MQ:DMSO (9:1)) was added and the reaction was incubated for 3 hours at room temperature. Next maleimide-BCN XL05 (10 .Math.L, 2.7 mM in DMF) was added followed by incubation for 1 hour at room temperature. The conjugate was spinfiltered to PBS using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). Mass spectral analysis of a sample after IdeS/EndoSH treatment showed one major Fc/2 product (observed mass 24627 Da) corresponding to the expected product trast-v6-(XL05).sub.2.

    Example 154. Intramolecular Crosslinking trastuzumab-GaINProSSMe Trast-v5a With maleimide-BCN XL05

    [0427] Trastuzumab-GaINProSSMe (trast-v5a) (1 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v5a) was incubated with TCEP (6.5 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and diluted to 100 .Math.L. Subsequent DHA (6.5 .Math.L, 10 mM in MQ:DMSO (9:1)) was added and the reaction was incubated for 3 hours at room temperature. Next maleimide-BCN XL05 (10 .Math.L, 2.7 mM in DMF) was added followed by incubation for 1 hour at room temperature. The conjugate was spinfiltered to PBS using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 24861 Da) corresponding to the expected product trast-v5b-(XL05).sub.2.

    Example 155. Conjugation of Bis-Hydroxylamine-BCN XL06 to Trast-v8 via Oxime Ligation

    [0428] Trast-v8 was spin-filtered to 0.1 M Sodium Citrate pH 4.5 using a Vivaspin Turbo 4 ultrafiltration unit (Sartorius) and concentrated to 16.45 mg/mL. Trast-v8 (1 mg, 8.1 mg/mL in 0.1 M Sodium Citrate pH 4.5) was incubated with bis-hydroxylamine-BCN XL06 (50 .Math.L, 200 eq in DMF) and p-anisidine (26.7 .Math.L, 200 eq in 0.1 M Sodium Citrate pH 4.5) overnight at room temperature. SDS-page gel analysis showed the formation of trast-v8-XL06 (see FIG. 30). The reaction was spin-filtered to PBS and concentrated using a Vivaspin Turbo 4 ultrafiltration unit (Sartorius) to 16.85 mg/mL.

    Example 156. Intramolecular Cross-linking of Bis-azido-trastuzumab Trast-v1a With bis-BCN-TCO XL11 to give TCO-trastuzumab trast-v1a-XL11

    [0429] To a solution of bis-azido-trastuzumab trast-v1a (36 .Math.L, 2 mg, 56.1 mg/mL in PBS pH 7.4) was added PBS pH 7.4 (164 .Math.L), propylene glycol (195 .Math.L) and bis-BCN-TCO XL11 (5.3 .Math.L, 10 mM solution in DMF, 4.0 equiv. compared to IgG). The reaction was incubated overnight at rt followed by buffer exchange to PBS pH 7.4 using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). Reducing SDS-PAGE showed two major HC products, corresponding to the nonconjugated heavy chain and the crosslinked heavy chain (See FIG. 31, right panel, lane 2), indicating partial conversion into trast-v1a-XL11. Furthermore, non-reducing SDS-PAGE showed one major band at the height of trast-v1a (See FIG. 31, left panel, lane 2), indicating that only intramolecular crosslinking occurred.

    Example 157. Intramolecular Cross-linking of Bis-azido-rituximab Rit-v1a With bis-BCN-TCO XL11 to give TCO-rituximab rit-v1a-XL11

    [0430] To a solution of bis-azido-rituximab rit-v1a (37 .Math.L, 2 mg, 54.5 mg/mL in PBS pH 7.4) was added PBS pH 7.4 (163 .Math.L), propylene glycol (195 .Math.L) and bis-BCN-TCO XL11 (5.3 .Math.L, 10 mM solution in DMF, 4.0 equiv. compared to IgG). The reaction was incubated overnight at rt followed by buffer exchange to PBS pH 7.4 using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). Reducing SDS-PAGE showed two major HC products, corresponding to the nonconjugated heavy chain and the crosslinked heavy chain (See FIG. 31, right panel, lane 6), indicating partial conversion into rit-v1a-XL11. Furthermore, non-reducing SDS-PAGE showed one major band at the height of rit-v1a (See FIG. 31, left panel, lane 2), indicating that only intramolecular crosslinking occurred.

    Example 158. Intramolecular Crosslinking trastuzumab-S239C Mutant Trast-v6 With bis-bromoacetamide-BCN XL12

    [0431] Trastuzumab S239C mutant (transient expressed in CHO by Evitria, heavy chain mutation S239C) (1 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v6) was incubated with TCEP (6.5 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and diluted to 200 .Math.L. Subsequent DHA (6.5 .Math.L, 10 mM in MQ:DMSO (9:1)) was added and the reaction was incubated for 3 hours at room temperature. To the reaction mixture were added bis-bromoacetamide-BCN XL12 (5.3 .Math.L, 10 mM in DMF), borate buffer (4 .Math.L, 1 M, pH 8.5), PBS (100 .Math.L) and DMF (15 .Math.L) followed by incubation for 3 hours at 37° C. The conjugate was spinfiltered to PBS using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). RP-HPLC analysis of DTT treated sample showed the conversion into the conjugate trast-v6-XL12 (see FIG. 32).

    Example 159. Conjugation of Trast-v1b With anti-4-1BB-BCN PF07 to Give Conjugate trast-v1b-(PF07).SUB.2 (P:A ratio 2:1)

    [0432] To a solution of trast-v1b (4.36 .Math.L, 75 .Math.g, 17.2 mg/mL in PBS pH 7.4) was added anti-4-1BB-BCN (PF07, 12.9 .Math.L, 4.4 mg/mL in PBS pH 7.4, 4 eq compared to IgG). The reaction was incubated for 16 hours at room temperature. Mass spectral analysis of the IdeS digested sample showed one major product (mass 52861 Da), corresponding to conjugate trast-v1b-(PF07).sub.2.

    Example 160. Conjugation of Trast-v1b With BCN-IL15Rα-IL15 PF15 to Give Conjugate trast-v1b-(PF15).SUB.2 (P:A ratio 2:1)

    [0433] To a solution of trast-v1b (4.36 .Math.L, 75 .Math.g, 17.2 mg/mL in PBS pH 7.4) was added BCN-IL15Rα-IL15 (PF15, 13.0 .Math.L, 6.7 mg/mL in PBS pH 7.4, 5 equiv. BCN-labelled IL15Rα-IL15 compared to IgG). The reaction was incubated for 16 hours at room temperature. Mass spectral analysis of the IdeS digested sample showed one major product (observed mass 49419 Da), corresponding to conjugate trast-v1b-(PF15).sub.2.

    Example 161. Conjugation of Trast-v2 With BCN-IL15Rα-IL15 PF15 to Give Conjugate trast-v2-(PF15).SUB.2 (P:A ratio 2:1)

    [0434] To a solution of trast-v2 (3.9 .Math.L, 75 .Math.g, 19.5 mg/mL in PBS pH 7.4) was added BCN-IL15Rα-IL15 PF15 (13 .Math.L, 6.7 mg/mL in PBS pH 7.4, 5 eq. BCN-labelled compared to IgG). The reaction was incubated for 16 hours at room temperature. Native gel analysis confirmed the formation of trast-v2-(PF15).sub.2, see FIG. 33.

    Example 162. Conjugation of BCN-IL15Rα-IL15 PF15 to trast-v6-XL02 via SPAAC (P:A Ratio 1:1)

    [0435] Trast-v6-XL02 (0.1 mg, 10 mg/mL in PBS) was incubated with BCN-IL15Rα-IL15 PF15 (12.4 .Math.L, 6.7 mg/mL, 3 eq. BCN-labelled IL15Rα-IL15 compared to IgG) overnight at room temperature. RP-HPLC analysis showed the formation of trast-v6-XL02-PF15 (see FIG. 25) and SDS-page gel analysis confirmed this conclusion (see FIG. 26).

    Example 163. Conjugation of BCN-IL15Rα-IL15 PF15 to trast-v5b-XL02 via SPAAC (P:A Ratio 1:1)

    [0436] Trast-v5b-XL02 (0.1 mg, 10 mg/mL in PBS) was incubated with BCN-IL15Rα-IL15 PF15 (12.4 .Math.L, 6.7 mg/mL, 3 eq. BCN-labelled IL15Rα-IL15 compared to IgG) overnight at room temperature. RP-HPLC analysis showed the formation of trast-v5b-XL02-PF15 (see FIG. 24) and SDS-page gel analysis confirmed this conclusion (see FIG. 34).

    Example 164. Conjugation of BCN-IL15Rα-IL15 PF15 to trast-v6-XL03 via SPAAC (P:A Ratio 1:1)

    [0437] Trast-v6-XL03 (0.1 mg, 10 mg/mL in PBS) was incubated with BCN-IL15Rα-IL15 PF15 (12.4 .Math.L, 6.7 mg/mL, 3 eq. BCN-labelled IL15Rα-IL15 compared to IgG) overnight at room temperature. SDS-page gel analysis showed the formation of trast-v6-XL03-PF15 (see FIG. 29).

    Example 165. Conjugation of Trast-v3 With BCN-IL15Rα-IL15 PF15 to Give Conjugate trast-v3-(PF15).SUB.2 (P:A ratio 2:1)

    [0438] To a solution of trast-v3 (3.85 .Math.L, 75 .Math.g, 19.5 mg/mL in PBS pH 7.4) was added BCN-IL15Rα-IL15 (PF15, 13.0 .Math.L, 6.7 mg/mL in PBS pH 7.4, 5 eq. BCN labeled IL15Rα-IL15 compared to IgG). The reaction was incubated for 16 hours at room temperature. Mass spectral analysis of the IdeS digested sample showed one major product (observed mass 49030 Da), corresponding to trast-v3-(PF15).sub.2.

    Example 166. Conjugation of Trast-v3 With anti-4-1BB-BCN PF07 to Give Conjugate trast-v3-(PF07).SUB.2 (P:A ratio 2:1)

    [0439] To a solution of trast-v3 (3.85 .Math.L, 75 .Math.g, 19.5 mg/mL in PBS pH 7.4) was added anti-4-1BB-BCN (PF07, 10.5 .Math.L, 6.8 mg/mL in PBS pH 7.4, 5 eq. compared to IgG). The reaction was incubated for 16 hours at room temperature. Mass spectral analysis of the IdeS digested sample showed one major product (observed mass 52468 Da), corresponding to trast-v3-(PF07).sub.2.

    Example 167. Conjugation of Rit-v3 With BCN- IL15Rα-IL15 PF15 to Give Conjugate rit-v3-(PF15).SUB.2 (P:A ratio 2:1)

    [0440] To a solution of rit-v3 (4.70 .Math.L, 75 .Math.g, 13.0 mg/mL in PBS pH 7.4) was added BCN-IL15Rα-IL15 (PF15,13.0 .Math.L, 6.7 mg/mL in PBS pH 7.4, 5 eq. BCN-labelled compared to IgG). The reaction was incubated for 16 hours at room temperature. Mass spectral analysis of the IdeS digested sample showed one major product (observed mass 48999 Da) corresponding to rit-v3-(PF15).sub.2.

    Example 168. Conjugation of azido-IL 15 PF19 to trast-v6-(XL05).SUB.2 via SPAAC (P:A ratio 2:1)

    [0441] Trast-v6-(XL05).sub.2 (0.1 mg, 16 mg/mL in PBS) was incubated with azido-IL15 PF19 (5.6 .Math.L, 7.2 mg/mL) overnight at room temperature. Mass spectral analysis of a sample after IdeS/EndoSH treatment showed one major Fc/2 product (observed mass 38775 Da) corresponding to the expected product trast-v6-(XL05-PF19).sub.2.

    Example 169. Conjugation of hOKT3-tetrazine PF02 to trast-v6-(XL05).SUB.2 via SPAAC (P:A ratio 2:1)

    [0442] Trast-v6-(XL05).sub.2 (0.1 mg, 16 mg/mL in PBS) was incubated with hOKT3-tetrazine PF02 (8.6 .Math.L, 7.7 mg/mL) overnight at room temperature. Mass spectral analysis of a sample after IdeS/EndoSH treatment showed one major Fc/2 product (observed mass 53399 Da) corresponding to the expected product trast-v6-(XL05-PF02).sub.2.

    Example 170. Conjugation of Anti-4-188-azide PF09 to trast-v6-(XL05).SUB.2 via SPAAC (P:A ratio 2:1)

    [0443] Trast-v6-(XL05).sub.2 (0.1 mg, 16 mg/mL in PBS) was incubated with anti-4-1BB-azide PF09 (9.9 .Math.L, 6.2 mg/mL) overnight at room temperature. Mass spectral analysis of a sample after IdeS/EndoSH treatment showed one major Fc/2 product (observed mass 52220 Da) corresponding to the expected product trast-v6-(XL05-PF09).sub.2.

    Example 171. Conjugation of azido-IL15 PF19 to trast-v5b-(XL05).SUB.2 via SPAAC (P:A ratio 2:1)

    [0444] Trast-v5b-(XL05).sub.2 (0.1 mg, 12.7 mg/mL in PBS) was incubated with azido-IL15 PF19 (5.6 .Math.L, 7.2 mg/mL) overnight at room temperature. Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 39009 Da) corresponding to the expected product trast-v5b-(XL05-PF19).sub.2.

    Example 172. Conjugation of hOKT3-tetrazine PF02 to trast-v5b-XL05 via SPAAC (P:A Ratio 2:1)

    [0445] Trast-v5b-(XL05).sub.2 (0.1 mg, 12.7 mg/mL in PBS) was incubated with hOKT3-tetrazine PF02 (8.6 .Math.L, 7.7 mg/mL) overnight at room temperature. Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 52220 Da) corresponding to the expected product trast-v5b-(XL05-PF02).sub.2.

    Example 173. Conjugation of Anti-4-188-azide PF09 to trast-v5b-(XL05).SUB.2 via SPAAC (P:A ratio 2:1)

    [0446] Trast-v5b-(XL05).sub.2 (0.1 mg, 12.7 mg/mL in PBS) was incubated with anti-4-1BB-azide PF09 (9.9 .Math.L, 6.2 mg/mL) overnight at room temperature. Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 52455 Da) corresponding to the expected product trast-v5b-(XL05-PF09).sub.2.

    Example 174. Conjugation of azido-IL15 PF19 to Trast-v9 via CuAAC (P:A Ratio 2:1)

    [0447] A solution was prepared with trast-v9 (0.2 mg, 16.5 .Math.L 12.1 mg/mL) and azido-IL15 (PF19, 11 .Math.L 7.2 mg/mL). In a separate vail a premix was prepared containing copper sulfate (71 .Math.L, 15 mM), THTPA ligand (13 .Math.L, 160 mM) amino guanidine (53 .Math.L, 100 mM) and sodium ascorbate (40 .Math.L, 400 mM). The premix was capped, vortexed and allowed to stand for 10 min. The premix (4.2 .Math.L) was added to the antibody solution and the reaction was incubated for 2 hours followed by the addition of PBS + 1 mM EDTA (300 .Math.L). The diluted solution was spinfiltered with PBS using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore). Analysis on SDS-page gel showed the formation of the expected product trast-v9-(PF19).sub.2, see FIG. 35)

    Example 175. Conjugation of azido-IL15 PF19 to trast-v5b-XL01 via SPAAC (P:A Ratio 1:1) Trast-

    [0448] v5b-XL01 (0.1 mg, 12.9 mg/mL in PBS) was incubated with azido-IL15 PF19 (5.6 .Math.L, 7.2 mg/mL) overnight at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v5b-XL01-PF19 (see FIG. 36).

    Example 176. Conjugation of hOkt3-tetrazine PF02 to trast-v5b-XL01 via SPAAC (P:A Ratio 1:1)

    [0449] Trast-v5b-XL01 (0.1 mg, 12.9 mg/mL in PBS) was incubated with hOKT3-tetrazine PF02 (8.6 .Math.L, 7.7 mg/mL) overnight at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v5b-XL01-PF02 (see FIG. 36).

    Example 177. Conjugation of Anti-4-188-azide PF09 to trast-v5b-XL01 via SPAAC (P:A Ratio 1:1)

    [0450] Trast-v5b-XL01 (0.1 mg, 12.9 mg/mL in PBS) was incubated with anti-4-1BB-azide PF09 (9.9 .Math.L, 6.2 mg/mL) overnight at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v5b-XL01-PF09 (see FIG. 36).

    Example 178. Conjugation of hOKT3-BCN 201 to Deglycosylated Trastuzumab via SPOCQ (P:A ratio 2:1)

    [0451] Deglycosylated trastuzumab (4.0 .Math.L, 0.075 mg, 18.6 mg/mL in PBS 5.5) was incubated with hOKT3-BCN (201, 6.56 .Math.L, 4 eq., 11.0 mg/mL in PBS 5.5) and mushroom tyrosinase (1.5 .Math.L, 10 mg/mL in phosphate buffer pH 6.0, Sigma Aldrich T3824) for 16 hours at room temperature. See also Dutch patent application no. 2026947, incorporated by reference herein. Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 51824 Da) corresponding to the expected product trast-v4-(201).sub.2.

    Example 179. Intramolecular Crosslinking of bis-BCN-IL15Rα-IL15 PF27 to Trast-v3 via SPAAC (P:A ratio 1:1)

    [0452] Trast-v3 (2.57 .Math.L, 0.05 mg, 19.5 mg/mL in PBS) was incubated with bis-BCN-IL15Ra-IL15 (PF27, 5.6 .Math.L, 3 eq. bis-BCN labelled IL15Rα-IL15, 7.6 mg/mL in PBS) for 16 hours at room temperature. Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 73432 Da) corresponding to the expected product trast-v3-PF27.

    Example 180. Intramolecular Crosslinking of hOKT3-bis-BCN PF22 to Trast-v3 via SPAAC (P:A ratio 1:1)

    [0453] Trast-v3 (2.57 .Math.L, 0.05 mg, 19.5 mg/mL in PBS) was incubated with hOKT3-bis-BCN PF22 (5.15 .Math.L, 3 eq., 5.7 mg/mL in PBS) for 16 hours at room temperature. Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 77150 Da) corresponding to the expected product trast-v3-PF22.

    Example 181. Conjugation of hOKT3-BCN 201 to Trast-v3 via SPAAC (P:A Ratio 2:1)

    [0454] Trast-v3 (2.57 .Math.L, 0.05 mg, 19.5 mg/mL in PBS) was incubated with hOKT3-BCN (201,1.87 .Math.L, 3 eq., 15.5 mg/mL in PBS) and 5 .Math.L PBS for 16 hours at room temperature. Mass spectral analysis of a sample after IdeS treatment showed one major Fc/2 product (observed mass 51811 Da) corresponding to the expected product trast-v3-(201).sub.2.

    Example 182. Conjugation of Azido-IL15 PF19 to trast-v6-XL01 via SPAAC (P:A Ratio 1:1) Trast-

    [0455] v6-XL01 (0.1 mg, 21.7 mg/mL in PBS) was incubated with azido-IL15 PF19 (5.6 .Math.L, 7.2 mg/mL) overnight at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v6-XL01-PF19 (see FIG. 37).

    Example 183. Conjugation of hOkt3-tetrazine PF02 to trast-v6-XL01 via SPAAC (P:A Ratio 1:1)

    [0456] Trast-v6-XL01 (0.1 mg, 21.7 mg/mL in PBS) was incubated with hOKT3-tetrazine PF02 (8.6 .Math.L, 7.7 mg/mL) overnight at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v6-XL01-PF02 (see FIG. 37).

    Example 184. Conjugation of Anti-4-188-azide PF09 to trast-v6-XL01 via SPAAC (P:A Ratio 1:1)

    [0457] Trast-v6-XL01 (0.1 mg, 21.7 mg/mL in PBS) was incubated with anti-4-1BB-azide PF09 (9.9 .Math.L, 6.2 mg/mL) overnight at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v6-XL01-PF09 (see FIG. 37).

    Example 185. Conjugation of azido-IL15 PF19 to trast-v7-XL01 via SPAAC (P:A Ratio 1:1) Trast-

    [0458] v7-XL01 (0.1 mg, 20.8 mg/mL in PBS) was incubated with IL15 PF19 (5.6 .Math.L, 7.2 mg/mL) overnight at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v6-XL01-PF19 (see FIG. 23).

    Example 186. Conjugation of hOKT3-tetrazine PF02 to trast-v7-XL01 via SPAAC (P:A Ratio 1:1)

    [0459] Trast-v7-XL01 (0.1 mg, 20.8 mg/mL in PBS) was incubated with hOKT3-tetrazine PF02 (8.6 .Math.L, 7.7 mg/mL) overnight at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v7-XL01-PF02 (see FIG. 23).

    Example 187. Conjugation of Anti-4-188-azide PF09 to trast-v7-XL01 via SPAAC (P:A Ratio 1:1)

    [0460] Trast-v7-XL01 (0.1 mg, 20.8 mg/mL in PBS) was incubated with anti-4-1BB-azide PF09 (9.9 .Math.L, 6.2 mg/mL) overnight at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v7-XL01-PF09 (see FIG. 23).

    Example 188. Conjugation of trastuzumab-GaINProSSMe Trast-v5a With maleimide-IL15Rα-IL15 PF16 (P:A ratio 2:1)

    [0461] Trastuzumab-GaINProSSMe (trast-v5a) (1.2 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v5a) was incubated with TCEP (7.8 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and diluted to 120 .Math.L. Subsequent DHA (7.8 .Math.L, 10 mM in MQ:DMSO (9:1)) was added and the reaction was incubated for 3 hours at room temperature. To a part of the reaction mixture (0.1 mg, 10 .Math.L) maleimide-IL15Rα-IL15 PF16 (6.6 .Math.L 10 mg/mL) was added followed by incubation for 3 hours at room temperature. The conjugate was diluted with PBS to 1 mg/mL and subsequent analysis on SDS-page gel confirmed the formation of the conjugate trast-v5b-(PF16).sub.2 (see FIG. 38).

    Example 189. Conjugation of trastuzumab-GaINProSSMe Trast-v5a With bis-maleimide-IL15Rα-IL15 PF28 (P:A ratio 1:1)

    [0462] Trastuzumab-GaINProSSMe (trast-v5a) (1.2 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v5a) was incubated with TCEP (7.8 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and diluted to 120 .Math.L. Subsequent DHA (7.8 .Math.L, 10 mM in MQ:DMSO (9:1)) was added and the reaction was incubated for 3 hours at room temperature. To a part of the reaction mixture (0.1 mg, 10 .Math.L) bis-maleimide- IL15Rα-IL15 PF28 (9.4 .Math.L 7.1 mg/mL) was added followed by incubation for 3 hours at room temperature. The conjugate was diluted with PBS to 1 mg/mL and subsequent analysis on SDS-page gel confirmed the formation of the conjugate trast-v5b-PF28 (see FIG. 38).

    Example 190. Conjugation of trastuzumab-S239C Mutant Trast-v6 With maleimide-IL15Rα-IL15 PF16 (P:A ratio 2:1)

    [0463] Trastuzumab S239C mutant (transient expressed in CHO by Evitria, heavy chain mutation S239C) (2 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v6) was incubated with TCEP (13 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and diluted to 120 .Math.L. Subsequent DHA (13 .Math.L, 10 mM in MQ:DMSO (9:1)) was added and the reaction was incubated for 3 hours at room temperature. To a part of the reaction mixture (0.1 mg, 11 .Math.L) maleimide-IL15Rα-IL15 PF16 (6.6 .Math.L 10 mg/mL) was added followed by incubation for 3 hours at room temperature. The conjugate was diluted with PBS to 1 mg/mL and subsequent analysis on SDS-page gel confirmed the formation of the conjugate trast-v6-(PF16).sub.2 (see FIG. 38).

    Example 191. Conjugation oftrastuzumab-S239C Mutant Trast-v6 With bis-maleimide-IL15Rα-IL15 PF28 (P:A ratio 1:1)

    [0464] Trastuzumab S239C mutant (transient expressed in CHO by Evitria, heavy chain mutation S239C) (2 mg, 10 mg/mL in PBS + 10 mM EDTA, trast-v6) was incubated with TCEP (13 .Math.L, 10 mM in MQ) for 2 hours at 37° C. The reduced antibody was spinfiltered with PBS + 10 mM EDTA using centrifugal filters (Amicon Ultra-0.5 mL MWCO 10 kDa, Merck Millipore) and diluted to 120 .Math.L. Subsequent DHA (13 .Math.L, 10 mM in MQ:DMSO (9:1)) was added and the reaction was incubated for 3 hours at room temperature. To a part of the reaction mixture (0.1 mg, 11 .Math.L) bis-maleimide- IL15 PF28 (9.4 .Math.L 7.2 mg/mL) was added followed by incubation for 3 hours at room temperature. The conjugate was diluted with PBS to 1 mg/mL and subsequent analysis on SDS-page gel confirmed the formation of the conjugate trast-v6-PF28 (see FIG. 38).

    Example 192. Conjugation of hOkt3-tetrazine PF02 to trast-v6-XL12 via SPAAC (P:A Ratio 1:1)

    [0465] Trast-v6-XL12 (0.1 mg, 15.9 mg/mL in PBS) was incubated with hOKT3-tetrazine PF02 (8.6 .Math.L, 7.7 mg/mL) overnight at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v6-XL12-PF02 (see FIG. 39).

    Example 193. Conjugation of hOkt3-tetrazine PF02 to trast-v8-XL06 via SPAAC (P:A Ratio 2:1)

    [0466] To a solution of trast-v8-XL06 (4.45 .Math.L, 75 .Math.g, 16.85 mg/mL in PBS pH 7.4) was added hOkt3-tetrazine PF02 (8.90 .Math.L, 6.2 mg/mL in PBS, 4 eq compared to IgG). The reaction was incubated for 16 hours at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v8-XL06-PF02 (see FIG. 30).

    Example 194. Conjugation of Anti-4-188-azide PF09 to trast-v8-XL06 via SPAAC (P:A Ratio 2:1)

    [0467] To a solution of trast-v8-XL06 (4.45 .Math.L, 75 .Math.g, 16.85 mg/mL in PBS pH 7.4) was added anti-4-1BB-zide PF09 (7.49 .Math.L, 7.7 mg/mL in PBS, 4 eq compared to IgG). The reaction was incubated for 16 hours at room temperature. Analysis on SDS-page gel showed the formation of the expected product trast-v8-XL06-PF09 (see FIG. 30).

    Example 195. Conjugation of hOKT3-PEG.SUB.2.-BCN 201 to bis-azido-rituximab rit-v1a to give T cell engager rit-v1a-(201).SUB.2 with 2:2 molecular format

    [0468] To a solution of rit-v1a (99 .Math.L, 6.0 mg, 405 .Math.M in PBS pH 7.4) was added hOKT3-PEG.sub.2-BCN 201 (240 .Math.L, 4.4 mg, 666 .Math.M in PBS pH 7.4, 4 equiv. compared to IgG). The reaction was incubated overnight at 37° C. followed by purification on a Superdex200 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase. Non-reducing SDS-PAGE analysis showed one major product consisting of an antibody conjugated to two hOKT3 scFvs (See FIG. 19, left panel, lane 4), thereby confirming formation of rit-v1a-(201).sub.2. Furthermore, reducing SDS-PAGE showed one major HC product, corresponding to the heavy chain conjugated to hOKT3-PEG.sub.2-BCN 201 (See FIG. 19, right panel, lane 4).

    Example 196. Conjugation of hOKT3-PEG.SUB.4.-tetrazine 204 to BCN-rituximab rit-v1a-145 to give T Cell Engager rit-v1a-145-204 with 2:1 Molecular Format

    [0469] To a solution of rit-v1a-145 (287 .Math.L, 6.6 mg, 154 .Math.M in PBS pH 7.4) was added hOKT3-PEG.sub.4-tetrazine 204 (247 .Math.L, 1.9 mg, 269 .Math.M in PBS pH 6.5, 1.5 equiv. compared to IgG). The reaction was incubated overnight at rt followed by purification on a Superdex200 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase. Non-reducing SDS-PAGE analysis showed one major product consisting of an antibody conjugated to a single hOKT3 (See FIG. 19, left panel, lane 5), thereby confirming formation of rit-v1a-145-204. Furthermore, reducing SDS-PAGE confirms one major HC product, corresponding to two heavy chains conjugated to a single hOKT3 (See FIG. 19, right panel, lane 5).

    Example 197. Conjugation of hOKT3-PEG.SUB.11.-tetrazine PF01 to BCN-Rituximab rit-v1a-145 to Give T Cell Engager rit-v1a-145-PF01 with 2:1 Molecular Format

    [0470] To a solution of rit-v1a-145 (247 .Math.L, 6.3 mg, 171 .Math.M in PBS pH 7.4) was added hOKT3-PEG.sub.11-tetrazine PF01 (304 .Math.L, 2.0 mg, 230 .Math.M in PBS pH 6.5, 1.7 equiv. compared to IgG). The reaction was incubated overnight at rt followed by purification on a Superdex200 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase. Non-reducing SDS-PAGE analysis showed one major product consisting of an antibody conjugated to a single hOKT3 (See FIG. 19, left panel, lane 6), thereby confirming formation of rit-v1a-145-PF01. Furthermore, reducing SDS-PAGE confirms one major HC product, corresponding to two heavy chains conjugated to a single hOKT3 (See FIG. 19, right panel, lane 6).

    Example 198. Conjugation of hOKT3-PEG.SUB.11.-tetrazine PF01 to BCN-B12 B12-v1a-145 to Give T Cell Engager B12-v1a-145-PF01 with 2:1 Molecular Format

    [0471] To a solution of B12-v1a-145 (38 .Math.L, 1.0 mg, 178 .Math.M in PBS pH 7.4) was added hOKT3-PEG.sub.11-tetrazine PF01 (44 .Math.L, 0.3 mg, 230 .Math.M in PBS pH 6.5, 1.5 equiv. compared to IgG). The reaction was incubated overnight at rt followed by purification on a Superdex200 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase. Non-reducing SDS-PAGE analysis showed one major product consisting of an antibody conjugated to a single hOKT3 (see FIG. 40, lane 4), thereby confirming formation of B12-v1a-145-PF01.

    Example 199. Conjugation of hOKT3-PEG.SUB.4.-tetrazine 204 to TCO-trastuzumab trast-v1a-XL11 to Give T Cell Engager trast-v1a-XL11-204 with 2:1 Molecular Format

    [0472] To a solution of TCO-trastuzumab trast-v1a-XL11 (5.7 .Math.L, 100 .Math.g, 117 .Math.M in PBS pH 7.4) was added hOKT3-PEG.sub.4-tetrazine 204 (5 .Math.L, 38 .Math.g, 269 .Math.M in PBS pH 6.5, 2.0 equiv. compared to IgG). The reaction was incubated overnight at rt. Non-reducing SDS-PAGE analysis showed two major products corresponding to the non-conjugated antibody and the antibody conjugated to a single hOKT3 (See FIG. 31, left panel, lane 3), thereby confirming formation of trast-v1a-XL11-204. Furthermore, reducing SDS-PAGE confirms that OKT3 is conjugated to the crosslinked heavy chains containing the TCO reactive handle (See FIG. 31, right panel, lane 3).

    Example 200. Conjugation of hOKT3-PEG.SUB.4.-tetrazine 204 to TCO-rituximab rit-v1a-XL11 to Give T Cell engager rit-v1a-XL11-204 with 2:1 Molecular Format

    [0473] To a solution of TCO-rituximab rit-v1a-XL11 (56.3 .Math.L, 100 .Math.g, 106 .Math.M in PBS pH 7.4) was added hOKT3-PEG.sub.4-tetrazine 204 (5 .Math.L, 38 .Math.g, 269 .Math.M in PBS pH 6.5, 2.0 equiv. compared to IgG). The reaction was incubated overnight at rt. Non-reducing SDS-PAGE analysis showed two major products corresponding to the non-conjugated antibody and the antibody conjugated to a single hOKT3 (See FIG. 31, left panel, lane 7), thereby confirming formation of rit-v1a-XL11-204. Furthermore, reducing SDS-PAGE confirms that OKT3 is conjugated to the crosslinked heavy chains containing the TCO reactive handle (See FIG. 31, right panel, lane 7).

    Example 201. Conjugation of hOKT3-PEG.SUB.23.-tetrazine PF02 to BCN-rituximab rit-v1a-145 to Give T Cell Engager rit-v1a-145-PF02 with 2:1 Molecular Format

    [0474] To a solution of rit-v1a-145 (247 .Math.L, 6.3 mg, 171 .Math.M in PBS pH 7.4) was added hOKT3-PEG.sub.23-tetrazine PF02 (262 .Math.L, 2.0 mg, 267 .Math.M in PBS pH 6.5, 1.7 equiv. compared to IgG). The reaction was incubated overnight at rt followed by purification on a Superdex200 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase. Non-reducing SDS-PAGE analysis showed one major product consisting of an antibody conjugated to a single hOKT3 (See FIG. 19, left panel, lane 7), thereby confirming formation of rit-v1a-145-PF02. Furthermore, reducing SDS-PAGE confirms one major HC product, corresponding to two heavy chains conjugated to a single hOKT3 (See FIG. 19, right panel, lane 7).

    Example 202. Conjugation of hOKT3-PEG.SUB.2.-arylazide PF03 to BCN-trastuzumab trast-v1a-145 to Give T Cell Engager trast-v1a-145-PF03 with 2:1 Molecular Format

    [0475] To a solution of trast-v1a-145 (2.9 .Math.L, 150 .Math.g, 347 .Math.M in PBS pH 7.4) was added hOKT3-PEG.sub.2-arylazide PF03 (4.9 .Math.L, 56 .Math.g, 411 .Math.M in PBS pH 7.4, 2.0 equiv. compared to IgG). The reaction was incubated overnight at rt. Mass spectral analysis of the reduced sample showed one major heavy chain product (observed mass 128388 Da), corresponding to trast-v1a-145-PF03.

    Example 203. Conjugation of hOKT3-PEG.SUB.2.-arylazide PF03 to BCN-rituximab rit-v1a-145 to Give T Cell engager rit-v1a-145-PF03 with 2:1 Molecular Format

    [0476] To a solution of rit-v1a-145 (30 .Math.L, 1.5 mg, 337 .Math.M in PBS pH 7.4) was added hOKT3-PEG.sub.2-arylazide PF03 (49 .Math.L, 0.6 mg, 411 .Math.M in PBS pH 7.4, 2.0 equiv. compared to IgG). The reaction was incubated overnight at rt followed by purification on a Superdex200 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase. Mass spectral analysis of the reduced sample showed one major heavy chain product (observed mass 128211 Da), corresponding to rit-v1a-145-PF03.

    Example 204. Conjugation bis-BCN-hOKT3 PF22 to Bis-azido-trastuzumab Trast-v1a to Give T Cell Engager trast-v1a-PF22 with 2:1 Molecular Format

    [0477] To a solution of trast-v1a (1.8 .Math.L, 100 .Math.g, 374 .Math.M in PBS pH 7.4) was added PBS pH 7.4 (4.5 .Math.L) and bis-BCN-hOKT3 PF22 (13.7 .Math.L, 78 .Math.g, 194 .Math.M in PBS pH 7.4, 4.0 equiv. compared to IgG). The reaction was incubated overnight at rt. Non-reducing SDS-PAGE analysis showed one major product consisting of an antibody conjugated to a single hOKT3 (See FIG. 41, lane 5), thereby confirming formation of trast-v1a-PF22.

    Example 205. Conjugation of bis-BCN-hOKT3 PF22 to Bis-azido-rituximab Rit-v1a to Give T Cell Engager rit-v1a-145-PF22 with 2:1 Molecular Format

    [0478] To a solution of rit-v1a (1.8 .Math.L, 100 .Math.g, 363 .Math.M in PBS pH 7.4) was added PBS pH 7.4 (7.9 .Math.L) and bis-BCN-hOKT3 PF22 (10.3 .Math.L, 58 .Math.g, 194 .Math.M in PBS pH 7.4, 3.0 equiv. compared to IgG). The reaction was incubated overnight at rt. Non-reducing SDS-PAGE analysis showed one major product consisting of an antibody conjugated to a single hOKT3 (See FIG. 41, lane 4), thereby confirming formation of rit-v1a-PF22.

    Example 206. Conjugation of bis-BCN-hOKT3 PF23 to Bis-azido-trastuzumab Trast-v1a to Give T Cell Engager trast-v1a-PF23 with 2:1 Molecular Format

    [0479] To a solution of trast-v1a (1.8 .Math.L, 100 .Math.g, 374 .Math.M in PBS pH 7.4) was added PBS pH 7.4 (9.9 .Math.L) and bis-BCN-hOKT3 PF23 (8.4 .Math.L, 58 .Math.g, 239 .Math.M in PBS pH 7.4, 3.0 equiv. compared to IgG). The reaction was incubated overnight at 37° C. Non-reducing SDS-PAGE analysis showed two major products consisting of non-conjugated trastuzumab and trastuzumab conjugated to bis-BCN-hOKT3 PF23 (See FIG. 42, lane 2), thereby confirming partial formation of trast-v1a-PF23.

    Example 207. Conjugation of bis-BCN-hOKT3 PF23 to Bis-azido-rituximab Rit-v1a to Give T Cell Engager rit-v1a-PF23 with 2:1 Molecular Format

    [0480] To a solution of rit-v1a (1.8 .Math.L, 100 .Math.g, 363 .Math.M in PBS pH 7.4) was added PBS pH 7.4 (13.6 .Math.L) and bis-BCN-hOKT3 PF23 (4.3 .Math.L, 30 .Math.g, 239 .Math.M in PBS pH 7.4, 1.5 equiv. compared to IgG). The reaction was incubated overnight at 37° C. Non-reducing SDS-PAGE analysis showed two major products consisting of non-conjugated rituximab and rituximab conjugated once to bis-BCN-hOKT3 PF23 (See FIG. 43, lane 5), thereby confirming partial formation of rit-v1a-PF23.

    Example 208. Conjugation of 4-1BB-PEG.SUB.23.-BCN PF07 to bis-azido-trastuzumab trast-v1a to Give T Cell Engager trast-v1a-(PF07)2 with 2:2 Molecular Format

    [0481] To a solution of trast-v1a (1.8 .Math.L, 100 .Math.g, 374 .Math.M in PBS pH 7.4) was added 4-1BB-PEG.sub.23-BCN PF07 (11.2 .Math.L, 76 .Math.g, 239 .Math.M in PBS pH 7.4, 4.0 equiv. compared to IgG). The reaction was incubated overnight at 37° C. Non-reducing SDS-PAGE analysis showed two major products consisting of trastuzumab conjugated once and twice to 4-1BB-PEG.sub.23-BCN PF07 (See FIG. 44, lane 8), thereby confirming partial formation of trast-v1a-(PF07).sub.2.

    Example 209. Conjugation of 4-1BB-PEG.SUB.23.-BCN PF07 to bis-azido-rituximab rit-v1a to Give T Cell Engager rit-v1a-(PF07).SUB.2 with 2:2 Molecular Format

    [0482] To a solution of rit-v1a (1.8 .Math.L, 100 .Math.g, 363 .Math.M in PBS pH 7.4) was added 4-1BB-PEG.sub.23-BCN PF07 (11.2 .Math.L, 76 .Math.g, 239 .Math.M in PBS pH 7.4, 4.0 equiv. compared to IgG). The reaction was incubated overnight at 37° C. Non-reducing SDS-PAGE analysis showed two major products consisting of rituximab conjugated once and twice to 4-1BB-PEG.sub.23-BCN PF07 (See FIG. 44, lane 6), thereby confirming partial formation of rit-v1a-(PF07).sub.2. Furthermore, mass spectral analysis of the reduced sample showed two major heavy chain products (observed masses of 49640 and 78117 Da, each approximately 50% of total heavy chain), corresponding to the non-conjugated heavy chain and the heavy chain conjugated to 4-1BB-PEG.sub.23-BCN PF07.

    Example 210. Conjugation of 4-1BB-PEG.SUB.11.-tetrazine PF08 to BCN-rituximab rit-v1a-145 to Give T Cell Engager rit-v1a-145-PF08 with 2:1 Molecular Format

    [0483] To a solution of rit-v1a-145 (35 .Math.L, 0.9 mg, 170 .Math.M in PBS pH 7.4) was added 4-1BB-PEG.sub.11-tetrazine PF08 (40 .Math.L, 248 .Math.g, 222 .Math.M in PBS pH 7.4, 1.5 equiv. compared to IgG). The reaction was incubated overnight at rt. Non-reducing SDS-PAGE analysis showed one major product consisting of rituximab conjugated to 4-1BB-PEG.sub.23-BCN PF08 (See FIG. 40, lane 3), thereby confirming partial formation of rit-v1a-145-PF08.

    Example 211. Conjugation of 4-1BB-PEG.SUB.11.-tetrazine PF08 to BCN-B12 B12-v1a-145 to Give T Cell Engager B12-v1a-145-PF08 with 2:1 Molecular Format

    [0484] To a solution of B12-v1a-145 (34 .Math.L, 0.9 mg, 178 .Math.M in PBS pH 7.4) was added 4-1BB-PEG.sub.11-tetrazine PF08 (40 .Math.L, 248 .Math.g, 222 .Math.M in PBS pH 7.4, 1.5 equiv. compared to IgG). The reaction was incubated overnight at rt. Non-reducing SDS-PAGE analysis showed one major product consisting of B12 conjugated to 4-1BB-PEG.sub.23-BCN PF08 (See FIG. 40, lane 5), thereby confirming partial formation of B12-v1a-145-PF08.

    Example 212. Conjugation of 4-1BB-PEG.SUB.2.-arylazide PF09 to BCN-trastuzumab trast-v1a-145 to Give T Cell Engager trast-v1a-145-PF09 with 2:1 Molecular Format

    [0485] To a solution of trast-v1a-145 (1.9 .Math.L, 100 .Math.g, 347 .Math.M in PBS pH 7.4) was added 4-1BB-PEG.sub.2-arylazide PF09 (5.9 .Math.L, 37 .Math.g, 225 .Math.M in PBS pH 7.4, 2.0 equiv. compared to IgG). The reaction was incubated overnight at rt. Non-reducing SDS-PAGE analysis showed one major product consisting of trastuzumab conjugated to a single 4-1BB-PEG.sub.2-arylazide PF09 (See FIG. 44, lane 4), thereby confirming formation of trast-v1a-145-PF09.

    Example 213. Conjugation of 4-1BB-PEG.SUB.2.-arylazide PF09 to BCN-rituximab rit-v1a-145 to Give T Cell Engager rit-v1a-145-PF09 with 2:1 Molecular Format

    [0486] To a solution of rit-v1a-145 (2.0 .Math.L, 100 .Math.g, 337 .Math.M in PBS pH 7.4) was added 4-1BB-PEG.sub.2-arylazide PF09 (5.9 .Math.L, 37 .Math.g, 225 .Math.M in PBS pH 7.4, 2.0 equiv. compared to IgG). The reaction was incubated overnight at rt. Non-reducing SDS-PAGE analysis showed one major product consisting of rituximab conjugated to a single 4-1BB-PEG.sub.2-arylazide PF09 (See FIG. 44, lane 2), thereby confirming formation of rit-v1a-145-PF09.

    Example 214. Conjugation of BCN-GGG-IL15Rα-IL15 (PF10) to Bis-azido-trastuzumab Trast-v1a to Give T Cell Engager trast-v1a-(PF10).SUB.2 with 2:2 Molecular Format

    [0487] Trast-v1a (11.5 .Math.L, 0.305 mg, 27.7 mg/mL in PBS) was incubated with PF10 (35 .Math.L, 4 eq., 5.9 mg/mL in PBS) for 16 h at 37° C. Analysis on non-reducing SDS-page gel confirmed the formation of Trast-v1a-PF10 and Trast-v1a-(PF10).sub.2. (See FIG. 45, lane 1)

    Example 215. Conjugation of BCN-PEG.SUB.24.-GGG-IL15Rα-IL15 (PF11) to bis-azido-trastuzumab trast-v1a to Give T Cell Engager trast-v1a-(PF11).SUB.2 with 2:2 Molecular Format

    [0488] Trast-v1a (12 .Math.L, 0.332 mg, 27.7 mg/mL in PBS) was incubated with PF11 (35 .Math.L, 4 eq., 6.1 mg/mL in PBS) for 16 h at 37° C. Analysis on non-reducing SDS-PAGE confirmed the formation of trast-v1a-PF11 and trast-v1a-(PF11).sub.2 (see FIG. 45, lane 3).

    Example 216. Conjugation of Tetrazine-PEG.SUB.3.-GGG-IL15Rα-IL15 (PF12) to BCN-trastuzumab trast-v1a-145 to Give T Cell Engager trast-v1a-145-PF12 with 2:1 Molecular Format

    [0489] Trast-v1a-145 (75 .Math.L, 1.575 mg, 21 mg/mL in PBS) was incubated with PF12 (80 .Math.L, 2 eq., 6.5 mg/mL in PBS) for 16 h at 37° C. Analysis on non-reducing SDS-PAGE confirmed the formation of Trast-v1a-145-PF12 (see FIG. 45, lane 5).

    Example 217. Conjugation of Arylazide-PEG11-GGG-IL15Rα-IL15 (PF13) to BCN-trastuzumab trast-v1a-145 to Give T Cell Engager trast-v1a-145-PF13 with 2:1 Molecular Format

    [0490] Trast-v1a-145 (280 .Math.L, 5.2 mg, 18.6 mg/mL in PBS) was incubated with PF13 (477 .Math.L, 1.5 eq., 2.6 mg/mL in PBS) for 16 h at 37° C. Mass spectral analysis of a sample after IdeS treatment showed one major product of 73991 Da, corresponding to the crosslinked Fc-fragment conjugated to PF13 (expected mass: 73989 Da), thereby confirming formation of trast-v1a-145-PF13.

    Example 218. Conjugation of Arylazide-PEG11-GGG-IL15Rα-IL15 (PF13) to BCN-Rituximab Rit-v1a-145to give T Cell Engager Rit-v1a-145-PF13 with 2:1 Molecular Format

    [0491] Rit-v1a-145 (0.5 .Math.L, 0.025 mg, 50.6 mg/mL in PBS) was incubated with PF13 (6.6 .Math.L, 4 eq., 2.6 mg/mL in PBS) for 16 h at RT. Mass spectral analysis of a sample after IdeS treatment showed one major product of 73927 Da, corresponding to the crosslinked Fc-fragment conjugated to PF13 (expected mass: 73925 Da), thereby confirming formation of rit-v1a-145-PF13.

    Example 219. Conjugation of BCN-PEG.SUB.12.-SYR-(G.SUB.4.S).SUB.3.-IL15Rα-IL15 (PF14) to bis-azido-trastuzumab trast-v1a to Give T Cell Engager trast-v1a-(PF14).SUB.2 with 2:2 Molecular Format Trast-

    [0492] v1a (5.2 .Math.L, 0.156 mg, 30 mg/mL in PBS) was incubated with PF14 (50 .Math.L, 4 eq., 3.2 mg/mL in PBS) for 16 h at 37° C. Mass spectral analysis of a sample after IdeS treatment showed one major product of 49387 Da, corresponding to the Fc-fragment conjugated to PF14 (expected mass:49387), thereby confirming formation of trast-v1a-(PF14).sub.2.

    Example 220. Conjugation of BCN-SYR-(G.SUB.4.S).SUB.3.-IL15Rα-IL15 (PF15) to bis-azido-trastuzumab trast-v1a to Give T Cell Engager trast-v1a-(PF15).SUB.2 with 2:2 Molecular Format

    [0493] Trast-v1a (0.8 .Math.L, 0.045 mg, 56.1 mg/mL in PBS) was incubated with PF15 (6.9 .Math.L, 4 eq., 6.2 mg/mL in PBS) for 16 h at RT. Mass spectral analysis of a sample after IdeS treatment showed one major product of 49403 Da, corresponding to the Fc-fragment conjugated to PF15 (Expected mass: 49405 Da), thereby confirming formation of trast-v1a-(PF15).sub.2.

    Example 221. Conjugation of BCN-SYR-(G.SUB.4.S).SUB.3.-IL15Rα-IL15 (PF15) to bis-azido-Rituximab rit-v1a to Give T Cell Engager rit-v1a-(PF15).SUB.2 with 2:2 Molecular Format

    [0494] Rit-v1a (0.8 .Math.L, 0.044 mg, 54.6 mg/mL in PBS) was incubated with PF15 (6.7 .Math.L, 4 eq.,6.2 mg/mL in PBS) for 16 h at RT. Mass spectral analysis of a sample after IdeS treatment showed one major product of 49374 Da, corresponding to the Fc-fragment conjugated to PF15 (expected mass: 49373 Da), thereby confirming formation of rit-v1a-(PF15).sub.2.

    Example 222. Conjugation of bis-BCN-SYR-(G.SUB.4.S).SUB.3.-IL15Rα-IL15 (PF27) to bis-azido-trastuzumab trast-v1a to Give T Cell Engager trast-v1a-145-PF27 with 2:1 Molecular Format

    [0495] Trast-v1a (1.78 .Math.L, 0.099 mg, 56.1 mg/mL in PBS) was incubated with PF27 (18.4 .Math.L, 4 eq., 7.62 mg/mL in PBS) and with 2.87 .Math.L PBS for 16 h at 37° C. Mass spectral analysis of a sample after IdeS treatment showed one major product of 74193 Da, corresponding to the crosslinked Fc-fragment conjugated to PF27 (expected mass: 74178 Da), thereby confirming formation of trast-v1a-145-PF27.

    Example 223. Conjugation of bis-BCN-SYR-(G.SUB.4.S).SUB.3.-IL15Rα-IL15 (PF27) to bis-azido-Rituximab Rit-v1a to Give T Cell Engager Rit-v1a-145-PF27 with 2:1 Molecular Format

    [0496] Rit-v1a (1 .Math.L, 0.055 mg, 54.6 mg/mL in PBS) was incubated with PF27 (8.9 .Math.L, 4 eq.,6.2 mg/mL in PBS) and with 1.6 .Math.L PBS for 16 h at 37° C. Mass spectral analysis of a sample after IdeS treatment showed one major product of 74118 Da, corresponding to the crosslinked Fc-fragment conjugated to PF27 (Expected mass: 74114 Da), thereby confirming formation of rit-v1a-145-PF27.

    Example 224. Conjugation of azido-IL15Rα-IL15 PF17 to BCN-trastuzumab Trast-v1a-145 to Give T Cell Engager trast-v1a-145-PF17 with 2:1 Molecular Format

    [0497] To a solution of trast-v1a-145 (29 .Math.L, 1.5 mg, 347 .Math.M in PBS pH 7.4) was added azido-IL15Rα-IL15 PF17 (97 .Math.L, 1.1 mg, 411 .Math.M in PBS pH 7.4, 4.0 equiv. compared to IgG). The reaction was incubated overnight at 37° C. Non-reducing SDS-PAGE analysis showed one major product consisting of trastuzumab conjugated to a single azido-IL15Rα-IL15 PF17 (See FIG. 46, lane 4), thereby confirming formation of trast-v1a-145-PF17.

    Example 225. Conjugation of azido-IL15Rα-IL15 PF17 to BCN-rituximab Rit-v1a-145 to Give T Cell Engager rit-v1a-145-PF17 with 2:1 Molecular Format

    [0498] To a solution of rit-v1a-145 (3 .Math.L, 150 .Math.g, 337 .Math.M in PBS pH 7.4) was added azido-IL15Rα-IL15 PF17 (9.7 .Math.L, 111 .Math.g, 411 .Math.M in PBS pH 7.4, 4.0 equiv. compared to IgG). The reaction was incubated overnight at 37° C. Non-reducing SDS-PAGE analysis showed one major product consisting of rituximab conjugated to a single azido-IL15Rα-IL15 PF17 (See FIG. 46, lane 2), thereby confirming formation of rit-v1a-145-PF17.

    Example 226. Conjugation of azido-IL15 PF19 to BCN-trastuzumab Tras-v1a-145 to Give T Cell Engager tras-v1a-145-PF19 with 2:1 Molecular Format

    [0499] Trast-v1a-145 (4.0 .Math.L, 0.075 mg, 18.6 mg/mL in PBS) was incubated with PF19 (4.6 .Math.L, 5 eq., 7.7 mg/mL in PBS) for 16 h at RT. Mass spectral analysis of a sample after IdeS treatment showed one major product of 63941 Da, corresponding to the crosslinked Fc-fragment conjugated to PF19 (Expected mass: 63936 Da), thereby confirming formation of trast-v1a-145-PF19.

    Example 227. Conjugation of azido-IL15 PF19 to BCN-rituximab Rit-v1a-145 to Give T Cell Engager rit-v1a-145-PF19 with 2:1 Molecular Format

    [0500] Rit-v1a-145 (2.0 .Math.L, 0.112 mg, 50.6 mg/mL in PBS) was incubated with PF19 (5.1 .Math.L, 4 eq., 7.7 mg/mL in PBS) for 16 h at RT. Mass spectral analysis of a sample after IdeS treatment showed one major product of 63882 Da, corresponding to the crosslinked Fc-fragment conjugated to PF19 (Expected mass: 63879 Da), thereby confirming formation of rit-v1a-145-PF19.

    Example 228. Conjugation of bis-BCN-SYR-(G.SUB.4.S).SUB.3.-IL15 (PF29) to bis-azido-trastuzumab tras-v1a to Give T Cell Engager Tras-v1a-PF29 with 2:1 Molecular Format

    [0501] Trast-v1a (1 .Math.L, 0.056 mg, 56.1 mg/mL in PBS) was incubated with PF29 (11 .Math.L, 4 eq., 3.6 mg/mL in PBS) for 16 h at 37° C. Non-reducing SDS-PAGE analysis showed two major products corresponding to non-conjugated trastuzumab and trastuzumab conjugated to a single bis-BCN-SYR-(G.sub.4S).sub.3-IL15 PF29 (See FIG. 47, lane 2), thereby confirming partial conversion into Tras-v1a-PF29.

    Example 229. Conjugation of bis-BCN-SYR-(G.SUB.4.S).SUB.3.-IL15 (PF29) to bis-azido-rituximab Rit-v1a to Give T Cell Engager Rit-v1a-PF29 with 2:1 Molecular Format

    [0502] Rit-v1a (1 .Math.L, 0.055 mg, 54.6 mg/mL in PBS) was incubated with PF29 (11 .Math.L, 4 eq.,3.6 mg/mL in PBS) for 16 h at 37° C. Non-reducing SDS-PAGE analysis showed two major products corresponding to non-conjugated rituximab and rituximab conjugated to a single bis-BCN-SYR-(G.sub.4S).sub.3-IL15 PF29 (See FIG. 47, lane 4), thereby confirming partial conversion into rit-v1a-PF29.

    Example 230. Conjugation of tetrazine-PEG.SUB.12.-SYR-(G.SUB.4.S).SUB.3.-IL15 (PF21) to BCN-trastuzumab trast-v1a-145 to Give T Cell Engager trast-v1a-145-PF21 with 2:1 Molecular Format

    [0503] Trast-v1a (2 .Math.L, 0.042 mg, 21 mg/mL in PBS) was incubated with PF21 (10 .Math.L, 6.7 eq., 2.9 mg/mL in PBS) for 16 h at 37° C. Mass spectral analysis of a sample after IdeS treatment showed one major product of 64865 Da, corresponding to the crosslinked Fc-fragment conjugated to PF21 (Expected mass: 64863 Da), thereby confirming formation of trast-v1a-145-PF21.

    Example 231. BCN-PEG.SUB.11.-BCN (105) Functionalization of Tyrosine Residue in SYR-(G.SUB.4.-S).SUB.3.-IL15 (PF18) Using Mushroom Tyrosinase to Obtain BCN-PEG.SUB.11.-IL15 (PF20)

    [0504] To a solution containing protein SYR-(G.sub.4S).sub.3-IL15 (PF18) (334 .Math.L, 269 .Math.M in PBS pH 7.4) was added PBS pH 7.4 (103.9 .Math.L), BCN-PEG11-BCN (105) (10 eq., 18 .Math.L, 50 mM in DMSO) and mTyrosinase (443.7 .Math.L, 203 .Math.M in PBS pH 7.4) and incubated 4 hours at RT. The reaction mixture was loaded on to a Superdex 75 10/300 GL column (GE Healthcare) on an AKTA Purifier-10 (GE Healthcare) using PBS pH 7.4 as mobile phase and a flow of 0.5 mL/min. Mass spectrometry analysis showed a weight of 15031 Da (expected mass: 15033 Da) corresponding to PF20.

    Example 232. Conjugation of BCN-PEG.SUB.11.-IL15 (PF20) to bis-azido-trastuzumab trast-v1a to Give T Cell Engager trast-v1a-(PF20).SUB.2 with 2:2 Molecular Format

    [0505] Trast-v1a (1.5 .Math.L, 0.084 mg, 56.1 mg/mL in PBS) was incubated with PF20 (7.3 .Math.L, 4 eq., 6.2 mg/mL in PBS) for 16 h at RT. Mass spectral analysis of a sample after DTT treatment showed two major products, corresponding to the heavy chain conjugated to PF20 (observed mass: 64764 Da; expected mass: 64758 Da; approximately 20% of total heavy chain peaks) and the unconjugated heavy chain (49725 Da; approximately 80% of total heavy chain peaks), thereby confirming partial formation of trast-v1a-(PF20).sub.2.

    Example 233. Conjugation of BCN-PEG.SUB.11.-IL15 (PF20) to bis-azido-rituximab rit-v1a to Give T Cell Engager rit-v1a-(PF20).SUB.2 with 2:2 Molecular Format

    [0506] Rit-v1a (1.5 .Math.L, 0.082 mg, 54.6 mg/mL in PBS) was incubated with PF20 (7.1 .Math.L, 4 eq.,6.2 mg/mL in PBS) for 16 h at RT. Mass spectral analysis of a sample after DTT treatment showed two major products, corresponding to the heavy chain conjugated to PF20 (observed mass: 64671 Da; expected mass: 64669 Da; approximately 10% of total heavy chain peaks) and the unconjugated heavy chain (49636 Da; approximately 90% of total heavy chain peaks). thereby confirming partial formation of rit-v1a-(PF20).sub.2.

    Example 234. CD3 Binding Analysis

    [0507] Specific binding to CD3 was assessed using Jurkat E6.1 cells, which express CD3 on the cell surface, and MOLT-4 cells, which do not express CD3 on the cell surface. Both cell lines were cultured in RPMI 1640 supplemented with 1% pen/strep and 10% fetal bovine serum at a concentration of 2 x 10.sup.5 to 1 x 10.sup.6 cells/ml. Cells were washed in fresh medium before the experiment and 100,000 cells per well were seeded in a 96-wells plate (duplicate wells). The dilution series of 6 antibodies were made in phosphate-buffered saline (PBS). The antibodies were diluted 10 times in the cell suspension and incubated at 4° C. in the dark for 30 minutes. After incubation, the cells were washed twice in cold PBS / 0.5% BSA, and incubated with anti-HIS-PE (only for 200) or anti-IgG1-PE (for all other compounds) at 4° C., in the dark for 30 minutes. After the second incubation step, the cells were washed twice. 7AAD was added as a live-dead staining. Detection of the fluorescence in the Yellow-B channel (anti-IgG1-PE and anti-HIS-PE) and the Red-B channel (7AAD) was done with the Guava 5HT flow cytometer. Median fluorescence intensity in the Yellow-B channel (anti-IgG1-PE and anti-HIS-PE) in life cells was determined with Kaluza software. All bispecifics, but not the negative control rituximab, show concentration-dependent binding to the CD3 positive Jurkat E6.1 cell line (Table 1). In contrast, no binding was observed to the CD3 negative MOLT-4 cell line (Table 2).

    TABLE-US-00001 Analysis of antibody binding to CD3-positive cells (Jurkat E6.1) by FACS. The median fluorescence intensity of a duplicate is shown for each concentration tested. Concentration (nM) Rit-v1a-201 Rit-v1a-145-204 Rit-v1a-145-PF01 Rit-v1a-145-PF02 Rituximab 200 0.32 104.79 77.80 80.30 58.79 58.28 63.63 1 90.00 82.15 88.23 71.52 56.55 66.22 3.16 159.28 112.67 116.72 114.55 55.37 83.74 10 160.91 113.22 142.62 168.91 60.83 109.70 31.6 202.99 165.47 221.00 229.84 58.71 154.42 100 248.66 200.74 252.20 278.91 55.49 177.16 316 294.49 263.83 256.79 291.09 54.99 223.52 1000 420.46 315.13 366.89 355.26 66.36 416.61

    TABLE-US-00002 Analysis of antibody binding to CD3 negative cells (MOLT-4) by FACS. The median fluorescence intensity is shown for each concentration tested. Concentration (nM) Rit-v1a-201 Rit-v1a-145-204 Rit-v1a-145- Rit-v1a-145-PF02 Rituximab 200 1 75.76 78.38 79.32 73.79 78.96 79.40 10 72.18 75.93 81.42 72.70 75.92 76.59 100 61.51 62.37 79.01 70.44 68.42 70.49 1000 62.96 73.90 59.89 61.81 67.39 61.37

    Example 235. FcRn Binding Analysis

    [0508] Binding to the FcRn receptor was determined at pH 7.4 and pH 6.0 using a Biacore T200 (serial no. 1909913) using single-cycle kinetics and running Biacore T200 Evaluation Software V 2.0.1. A CM5 chip was coupled with FcRn in sodium acetate pH 5.5 using standard amine chemistry. Serial dilution of bispecifics and controls were measured in PBS pH 7.4 with 0.05% tween-20 (9 points; 2-fold dilution series; 8000 nM Top conc.) and in PBS pH 6.0 with 0.05% tween-20 (3 points; 2-fold dilution series; 4000 nM Top conc.). A flow rate of 30 .Math.l/min was used and an association time of 40 seconds and dissociation time of 75 seconds. Steady state analysis was used to analyze samples. FcRn binding was observed for all bispecifics at pH 6.0, with no binding observed at pH 7.4 (Table 3).

    TABLE-US-00003 Binding of different bispecifics, intermediates and control antibodies to FcRn at pH 6.0 or pH 7.4 as determined by Biacore. Antibody pH 6.0 K.sub.D (M) 1.74E-06 R.sub.MAX (RU) 67 Chi.sup.2 (RU.sup.2) 0.783 Irrelevant IgG1 WT 7.4 - - - Rituximab 6.0 1.57E-06 96.4 2.82 7.4 - - - Rit-v1a-201 6.0 2.16E-06 149.6 8.53 7.4 - - - Rit-v1a-145-204 6.0 1.91E-06 122.9 5.36 7.4 - - - Rit-v1a-145-PF01 6.0 1.90E-06 114.6 4.02 7.4 - - - Rit-v1a-145-PF02 6.0 2.05E-06 123.5 5.47 7.4 - - - Rit-v1a-145 6.0 1.89E-06 89.8 2.01 7.4 - - -

    Example 236. Effect of Bispecifics on Raji-B Tumor Cell Killing With Human PBMCs.

    [0509] Duplicate wells were plated with Raji-B cells (5e4 cells) and human PBMCs (5e5) (1:10 cell ratio) into 96 well plates. Serial dilution of bispecifics (1:10 dilution; 8 points; 10 nM Top conc.) were added to wells and incubated for 24 hours at 37° C. in tissue culture incubator. Samples were stained with CD19, CD20 antibodies and propidium iodide was added prior to acquisition of BD Fortessa Cell Analyzer. Live RajiB cells were quantitated based on PI-/CD19+/CD20+ staining via flow cytometry analysis. The percentage of live RajiB cells was calculated relative to untreated cells. Target-dependent cell killing was demonstrated both for bispecifics based on hOKT3 200 (FIG. 48) and for bispecifics based on anti-4-1BB PF31 (FIG. 49).

    Example 237. Effect of Bispecifics on Cytokine Secretion in a Co-culture of Raji-B Tumor Cells And human PBMCs.

    [0510] Duplicate wells were plated with Raji-B cells (5e4 cells) and human PBMCs (5e5) (1:10 cell ratio) into 96 well plates. Serial dilution of bispecifics (1:10 dilution; 8 points; 10 nM Top conc.) were added to wells and incubated for 24 hours at 37° C. in tissue culture incubator. Cytokine analysis was conducted on the supernatant for TNF-α, IFN-y and IL-10 (Kit: HCYTOMAG-60K-05, Merck Millipore). FIG. 50 shows cytokine levels for bispecifics based on hOKT3 200 and FIG. 51 shows cytokine levels for bispecifics based on anti-4-1BB PF31.

    Sequence List

    [0511] Sequence identification of C-terminal sortase A recognition sequence (SEQ. ID NO: 1):

    TABLE-US-00004 GGGGSGGGGSLPETGGHHHHHHHHHH

    [0512] Sequence identification of sortase A (SEQ. ID NO: 2):

    TABLE-US-00005 TGSHHHHHHGSKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQ IPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQN ISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPT DVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK

    [0513] Sequence identification of His6-TEVsite-GGG-IL15Rα-IL15 (SEQ. ID NO: 3):

    TABLE-US-00006 MGSSHHHHHHSSGENLYFQGGGITCPPPMSVEHADIWVKSYSLYSRERYI CNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPS GGSGGGGSGGGSGGGGSLQNWVNVISDLKKIEDLIQSMHIDATLYTESDV HPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVT ESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

    [0514] Sequence identification of anti-4-1BB PF31 (SEQ. ID NO: 4):

    TABLE-US-00007 DIVMTQSPPTLSLSPGERVTLSCRASQSISDYLHWYQQKPGQSPRLLIKY ASQSISGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQDGHSFPPTFGG GTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCK ASGYTFSSYWMHWVRQAPGQRLEWMGEINPGNGHTNYSQKFQGRVTITVD KSASTAYMELSSLRSEDTAVYYCARSFTTARAFAYWGQGTLVTVSSGGGG SGGGGSLPETGGHHHHHH

    [0515] Sequence identification of SYR-(G.sub.4S).sub.3-IL15 (PF18) (SEQ. ID NO: 5):

    TABLE-US-00008 SYRGGGGSGGGGSGGGGSNWVNVISDLKKIEDLIQSMHIDATLYTESDVH PSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTE SGCKECEELEEKNIKEFLQSFVHIVQMFINTS

    [0516] Sequence identification of SYR-(G.sub.4S).sub.3-IL15Rα-linker-IL15 (PF26) (SEQ. ID NO: 6):

    TABLE-US-00009 SYRGGGGSGGGGSGGGGSITCPPPMSVEHADIWVKSYSLYSRERYICNSG FKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSGGSG GGGSGGGSGGGGSLQNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSC KVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGC KECEELEEKNIKEFLQSFVHIVQMFINTS