BISPECIFIC ANTIBODIES BINDING HVEM AND CD9
20230192900 · 2023-06-22
Inventors
- David Alan COOK (Slough, Berkshire, GB)
- Helen Margaret FINNEY (Slough, Berkshire, GB)
- Stephen Edward RAPECKI (Slough, Berkshire, GB)
Cpc classification
C07K16/468
CHEMISTRY; METALLURGY
C07K2319/70
CHEMISTRY; METALLURGY
C07K2317/94
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/64
CHEMISTRY; METALLURGY
C07K2317/70
CHEMISTRY; METALLURGY
C07K16/2896
CHEMISTRY; METALLURGY
C07K16/2878
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention relates to multispecific antibodies against a novel targets' combination of HVEM and CD9, and their use in the treatment of cancer and infectious diseases.
Claims
1. An antibody which comprises a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9.
2. The antibody according to claim 1, wherein each of the antigen-binding portions is a monoclonal antigen-binding portion.
3. The antibody according to claim 1, wherein each of the antigen-binding portions is independently selected from a Fab, a Fab′, a scFv or a VHH.
4. The antibody according to claim 1, wherein the antigen-binding portions are the antigen-binding portions of an IgG.
5. The antibody according to claim 1 wherein the antibody is chimeric, human or humanised.
6. The antibody according to claim 1, wherein the antibody comprises a heavy chain constant region selected from an IgG1, an IgG2, IgG3 or an IgG4 isotype, or a variant thereof.
7. The antibody according to claim 1, wherein the antibody further comprises at least an additional antigen-binding portion.
8. The antibody according to claim 7, wherein the additional antigen-binding portion is capable of increasing the half-life of the antibody.
9. The antibody according to claim 8, wherein the additional antigen-binding portion binds albumin.
10. The antibody according to claim 1, wherein the second antigen binding portion binds CD9 in CD9 loop 2.
11. The antibody according to claim 1, wherein the first antigen-binding portion binding HVEM comprises a first heavy chain variable region and a first light chain variable region, wherein the second antigen-binding portion binding CD9 comprises a second heavy chain variable region and a second light chain variable region.sub.1 and wherein: a. The first heavy chain variable region comprises a CDR-H1 comprising SEQ ID NO: 3, a CDR-H2 comprising SEQ ID NO: 4 and a CDR-H3 comprising SEQ ID NO: 5; and b. The first light chain variable region comprises a CDR-L1 comprising SEQ ID NO: 6, a CDR-L2 comprising SEQ ID NO: 7 and a CDR-L3 comprising SEQ ID NO: 8; and c. The second heavy chain variable region comprises a CDR-H1 comprising SEQ ID NO: 9, a CDR-H2 comprising SEQ ID NO: 10 and a CDR-H3 comprising SEQ ID NO: 11; and d. The second light chain variable region comprises a CDR-L1 comprising SEQ ID NO: 12, a CDR-L2 comprising SEQ ID NO: 13 and a CDR-L3 comprising SEQ ID NO: 14; or e. The first heavy chain variable region comprises SEQ ID NO: 15 and the first light chain variable region comprises SEQ ID NO: 17; and the second heavy chain variable region comprises SEQ ID NO: 19 and second light chain variable region comprises SEQ ID NO: 21; or f. The first heavy chain variable region is encoded by a nucleotide sequence comprising SEQ ID NO: 16 and the first light chain variable region is encoded by a nucleotide sequence comprising SEQ ID NO: 18; and the second heavy chain variable region is encoded by a nucleotide sequence comprising SEQ ID NO: 20 and second light chain variable region is encoded by a nucleotide sequence comprising SEQ ID NO: 22.
12. A pharmaceutical composition comprising the antibody according to claim 1 and one or more pharmaceutically acceptable excipients.
13. (canceled)
14. (canceled)
15. (canceled)
16. A method for treating a subject afflicted with cancer an infectious disease, or a combination thereof comprising administering to the subject a pharmaceutically effective amount of the antibody according to claim 1 or a pharmaceutical composition comprising the antibody and one or more pharmaceutically acceptable excipients.
17. The method according to claim 16, wherein the antibody or the composition is administered concomitantly or sequentially to one or more additional cancer therapies.
18. The method according to claim 16, wherein the subject is afflicted with cancer.
19. The method according to claim 18, wherein the pharmaceutical composition is administered concomitantly or sequentially to one or more additional cancer therapies.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
DETAILED DESCRIPTION OF THE INVENTION
[0047] The present invention will now be described with respect to particular non-limiting aspects and embodiments thereof and with reference to certain figures and examples.
[0048] Technical terms are used by their common sense unless indicated otherwise. If a specific meaning is conveyed to certain terms, definitions of terms will be given in the context of which the terms are used.
[0049] Where the term “comprising” is used in the present description and claims, it does not exclude other elements. For the purposes of the present disclosure, the term “consisting of” is considered to be a preferred embodiment of the term “comprising of”.
[0050] Where an indefinite or definite article is used when referring to a singular noun, e.g. “a”, “an” or “the”, this includes a plural of that noun unless something else is specifically stated.
[0051] As used herein, the terms “treatment”, “treating” and the like, refer to obtaining a desired pharmacologic and/or physiologic effect. The effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease. Treatment thus covers any treatment of a disease in a mammal, particularly in a human, and includes: (a) preventing the disease from occurring in a subject, i.e. a human, which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development; and (c) relieving the disease, i.e., causing regression of the disease.
[0052] A “therapeutically effective amount” refers to the amount of antibody comprising the distinct antigen-binding portions binding HVEM and CD9 that, when administered to a mammal or other subject for treating a disease, is sufficient to affect such treatment for the disease.
[0053] The present invention provides for antibodies comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9. The first and the second antigen-binding portions are located in the same antibody, i.e. they are part of the same polypeptide chain and/or associate via one or more covalent and/or non-covalent associations (such as the screening format Fab-Kd-Fab described herein or the classic heavy and light chain association forming a full IgG antibody) or are covalently linked so as to form one single molecule (such as cross-linking two separately expressed polypeptide chains, optionally via specific cross-linking agents).
[0054] The herpes virus entry mediator (HVEM) is a member of the tumour necrosis factor receptor superfamily (TNFRSF), and it is also known as TNFRSFI4 or CD270 (Uniprot accession reference Q92956). HVEM is a bidirectional switch regulating T-cell activation in a costimulatory or coinhibitory fashion, whose outcome depends on the binding partner. HVEM can act as both receptor and ligand, the binding of endogenous ligand LIGHT or agonist antibodies to HVEM delivers a costimulatory signal; whereas the binding of HVEM to BTLA (IgSF) or CD160 on Effector T-cells delivers a coinhibitory signal. The sequence of human HVEM, including the signal peptide is shown as SEQ ID NO: 1 (Table 1).
[0055] CD9 and in particular human CD9 (Uniprot accession number P21926) was discovered as a human B-lymphocyte differentiation antigen and it has been found to be widely expressed on many non-hematopoietic tissues including various cancer. It is also known as Tetraspanin-29, motility-related protein-1, 5H9 antigen, cell growth-inhibiting gene 2 protein, leukocyte antigen MIC3 and MRP-1 (Rappa et al., Oncotarget 6:10, 7970-7991 (2015)). CD9 is a tetraspanin that is broadly expressed in a variety of solid tissues and on a multitude of hematopoietic cells (Nature reviews Cancer (9) 40-55 (2009)). CD9 involvement has been shown in the invasiveness and tumorigenicity of human breast cancer cells (Oncotargets, 6:10 (2015)), the suppression of cell motility and metastasis (J. Exp. Med 177:5 (1993)) and to have a role in T cells activation (J. Exp. Med 184:2 (1994)).
[0056] CD9 has also been shown to be present in exosomes (Asia-Pac J Clin Oncol, 2018; 1-9). Exosomes are cell derived nanovesicles with size of 30-120nm. The molecular composition of exosomes reflects their origin and include unique composition of tetraspanins. Exosomes are thoughts to constitute a potent mode of intercellular communication that is important in the immune response, cell-to-cell spread of infectious agents, and tumour progression.
[0057] The sequence of human CD9, including the signal peptide is shown as SEQ ID NO:2 (Table 1).
TABLE-US-00001 TABLE 1 SEQ ID NO: 1 MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEY Human HVEM PVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQ CQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAY ATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSW LVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVK VIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH SEQ ID NO: 2 MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETN Human CD9 NNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVI FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYAL NCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGI GIAVVMIFGMIFSMILCCAIRRNREMV SEQ ID NO: 3 GFSLSTYDMI CDR-H1 VR7660 SEQ ID NO: 4 VITKTTTTYYANWAKG CDR-H2 VR7660 SEQ ID NO: 5 DADDAVYYYFDI CDR-H3 VR7660 SEQ ID NO: 6 QASQSIGSGLA CDR-L1 VR7660 SEQ ID NO: 7 AASTLTS CDR-L2 VR7660 SEQ ID NO: 8 QEGVSRGNIDNA CDR-L3 VR7660 SEQ ID NO: 9 GFSLSSYAMG CDR-H1 VR7272 SEQ ID NO: 10 AIGSITATGYARWAKG CDR-H2 VR7272 SEQ ID NO: 11 EIYVGSAYAFDI CDR-H3 VR7272 SEQ ID NO: 12 QASQSISNYLA CDR-L1 VR7272 SEQ ID NO: 13 LASTLAS CDR-L2 VR7272 SEQ ID NO: 14 QQGYIDNVNKG CDR-L3 VR7272 SEQ ID NO: 15 QSVEESGGRLVTPGTPLTLTCTVAGFSLSTYDMIWVRQAPGKGLEYIG VH VR7660 VITKTTTTYYANWAKGRFTISKTSTTVDLKMTSPTTEDTATYFCARDAD DAVYYYFDIWGPGTLVTVSS SEQ ID NO: 16 AAGCTTCGAAGCCACCATGGAGACTGGGCTGCGCTGGCTTCTCCTG VH nucl. GTCGCTGTGCTCAAAGGTGTCCAGTGTCAGTCGGTGGAGGAGTCC VR7660 GGGGGTCGCCTGGTCACGCCTGGGACACCCCTGACACTCACCTGC ACGGTCGCTGGATTCTCCCTCAGTACCTACGACATGATCTGGGTCC GCCAGGCTCCAGGGAAGGGGCTGGAATACATCGGAGTCATTACTAA AACTACTACCACATACTACGCGAACTGGGCGAAAGGCCGATTCACC ATCTCCAAAACCTCGACCACGGTGGATCTGAAAATGACCAGTCCGA CAACCGAGGACACGGCCACCTATTTCTGTGCCAGAGATGCTGATGA TGCTGTTTATTACTACTTTGACATCTGGGGCCCAGGCACCCTGGTCA CCGTCTCGAGT SEQ ID NO: 17 AYDMTQTPASAEVAVGGTVTINCQASQSIGSGLAWYQQKPGQRPKLLI VL VR7660 YAASTLTSGVSSRFKGSGSGTEFTLTISGVECADAATYYCQEGVSRGNI DNAFGGGTEVVVK SEQ ID NO: 18 AAGCTTCGAAGCCACCATGGACATGAGGGCCCCCACTCAGCTGCTG VL nucl. GGGCTCCTGCTGCTCTGGCTCCCAGGTGCCAGATGTGCCTATGATA VR7660 TGACCCAGACTCCAGCCTCTGCGGAGGTAGCTGTGGGAGGCACAG TCACCATCAATTGCCAGGCCAGTCAGAGCATTGGCAGTGGTTTGGC CTGGTATCAGCAGAAACCAGGGCAGCGTCCCAAACTCCTGATCTAT GCTGCATCCACTCTGACATCTGGGGTCTCATCGCGGTTCAAAGGCA GTGGATCTGGGACAGAGTTCACTCTCACCATCAGCGGCGTGGAGTG TGCCGATGCTGCCACTTACTACTGTCAAGAGGGTGTTAGTCGTGGT AATATTGATAATGCCTTCGGCGGAGGGACCGAGGTGGTGGTCAAAC GTACG SEQ ID NO: 19 QSLEESGGRLVTPGTPLTLTCTVSGFSLSSYAMGWVRQAPGKGLEWI VH VR7272 GAIGSITATGYARWAKGRFSISKTSTTVDLKMTSPTTEDTATYFCAREIY VGSAYAFDIWGPGTLVTVSS SEQ ID NO: 20 AAGCTTCGAAGCCACCATGGAGACTGGGCTGCGCTGGCTTCTCCTG VH nucl. GTCGCTGTGCTCAAAGGTGTCCAGTGTCAGTCGCTGGAGGAGTCC VR7272 GGGGGTCGCCTGGTCACGCCTGGGACACCCCTGACACTCACCTGC ACAGTCTCTGGATTCTCCCTCAGTAGCTATGCAATGGGCTGGGTCC GCCAGGCTCCAGGGAAGGGGCTGGAGTGGATCGGAGCCATTGGTA GTATTACTGCCACTGGCTACGCGCGCTGGGCAAAAGGCCGATTCAG CATCTCCAAGACCTCGACCACGGTGGATCTGAAAATGACCAGTCCG ACAACCGAGGACACGGCCACCTATTTCTGTGCCAGAGAGATTTATG TTGGGTCTGCTTATGCCTTTGACATCTGGGGCCCAGGCACCCTGGT CACCGTCTCGAGT SEQ ID NO: 21 AYDMTQTPASVEVAVGDTVTIKCQASQSISNYLAWYQQKPGQPPKLLIY VL VR7272 LASTLASGVPSRFKGSGSGTEFTLTISDLECADAATYYCQQGYIDNVNK GFGGGTEVVVK SEQ ID NO: 22 AAGCTTCGAAGCCACCATGGACACGAGGGCCCCCACTCAGCTGCT VL nucl. GGGGCTCCTGCTGCTCTGGCTCCCAGGTGCCAGATGTGCCTATGAT VR7272 ATGACCCAGACTCCAGCCTCTGTGGAGGTAGCTGTGGGAGACACTG TCACCATCAAGTGTCAGGCCAGTCAGAGCATTAGTAACTACTTAGCC TGGTATCAGCAGAAACCAGGGCAGCCTCCCAAGCTCCTGATCTATC TGGCATCTACTCTGGCATCTGGGGTCCCATCGCGGTTCAAAGGCAG TGGATCTGGGACAGAGTTCACTCTCACCATCAGCGACCTGGAGTGT GCCGATGCTGCCACTTACTATTGTCAACAGGGTTATATTGATAATGT TAATAAAGGTTTCGGCGGAGGGACCGAGGTGGTGGTCAAACGTAC G
[0058] Within the present invention, unless recited otherwise, human HVEM and CD9 are always intended to be included in the term “HVEM” and CD9″. However, unless “human HVEM” and/or “human CD9” are explicitly used, the terms “HVEM” and/or “CD9” include the same targets in other species, especially non-primate (e.g. rodents) and non-human primate (such as cynomolgus monkey) species.
[0059] The present invention therefore provides for an antibody comprising a first antigen-binding portion binding human HVEM and a second antigen-binding portion binding human CD9. The first and the second antigen-binding portions are located on the same antibody, i.e. they are part of the same polypeptide chain, they associate via one or more non-covalent and/or covalent associations or are linked so as to form one single molecule.
[0060] The present invention also provides for an antibody comprising a first antigen-binding portion binding an extracellular domain region of human HVEM and a second antigen-binding portion binding an extracellular domain region of human CD9.
[0061] In particular, there is provided an antibody comprising a first antigen-binding portion binding human HVEM as defined in SEQ ID NO: 1 or from amino acid 39 to 283 of SEQ ID NO: 1 or from amino acid 39 to 202 of SEQ ID NO: 1 and a second antigen-binding portion binding human CD9 as defined in SEQ ID NO: 2 or from amino acid 2 to 228 of SEQ ID NO: 2, alternatively from amino acid 34 to 55 of SEQ ID NO: 2 or alternatively from amino acid 112-195. The first and the second antigen-binding portions are located on the same antibody, i.e. they are part of the same polypeptide chain, they associate via one or more non-covalent and/or covalent associations or are linked so as to form one single molecule.
[0062] The monoclonal antibody of the present invention, upon binding of HVEM and CD9, stimulates T-cell activation, i.e. further activates T-cells and enhances induction of T-cell proliferation, and in particular, the monoclonal antibody comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9 further activates T-cells and enhances induction of T-cell proliferation in the presence of SEB stimulation. More specifically, the monoclonal antibody comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9 further activates T-cells and enhances induction of T-cell proliferation in the presence of SEB stimulation but it does not activate unstimulated T-cells. More specifically, the T-cell is at least a CD4+ T-cell or at least a CD8+ T-cell or a mixture thereof, more preferably a memory CD4+ T-cell or a memory CD8+ T-cell.
[0063] The term “activate” (and grammatical variations thereof) as used herein, at least includes the upregulation of specific T-cell markers, i.e. increased transcription and/or translation of these markers and/or trafficking of these newly transcribed/translated markers or of any marker already expressed to the cell membrane, and the induction of proliferation.
[0064] Hence, the present invention provides for a monoclonal antibody comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9 capable of activating T-cells in the presence of an anti-SEB stimulation wherein the further activation of T-cell is measured as an upregulation of T-cell markers and the enhancement of T-cell proliferation.
[0065] For maintaining the ability of the immune system to recognise and mount a response to the almost infinite number of possible foreign peptide antigens, a large repertoire of naïve T-cells is required. When a foreign antigen is encountered—for example as presented on virus infected cells or mutated tumour cells—T-cells of that specificity are selectively expanded to allow killing of the virus or tumour. As part of this selective expansion a number of memory T-cells are formed and retained at increased frequency to allow a rapid response should the same threat be re-encountered. This expansion and maintenance of memory T-cells is the basis of acquired immune resistance.
[0066] Stimulation of the cytotoxic activity of T-cells to promote tumour or virus-infected cell killing is a desirable therapeutic approach—but if non-specific can be catastrophic due to massive cytokine release and indiscriminate cell killing (
[0067] Hence, the present invention provides for a monoclonal antibody comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9 capable of further activating memory T-cells, wherein the further activation of T-cell results in an upregulation of T-cell markers and the enhancement of memory T-cell proliferation.
[0068] Specific markers of T-cell activation and proliferation include but are not limited to the upregulation of CD25, CD137 and CD71.
[0069] In one preferred embodiment of the present invention, the monoclonal antibody comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9 is capable of activating T-cells in the presence of SEB stimulation wherein activating T-cell results in an upregulation of CD137, CD71 and CD25.
[0070] The term “antibody” as used herein includes whole immunoglobulin molecules and antigen-binding portions of immunoglobulin molecules associated via non-covalent and/or covalent associations or linked together, optionally via a linker.
[0071] In one embodiment, the antigen-binding portions binding HVEM and CD9 are the antigen-binding portions of an IgG, wherein one arm binds HVEM and the other arm binds CD9.
[0072] In another embodiment, the antigen-biding portions comprised in the antibody are functionally active fragments or derivatives of a whole immunoglobulin and may be, but are not limited to, VH, VL, VHH, Fv, scFv fragment (including dsscFv), Fab fragments, modified Fab fragments, Fab′ fragments, F(ab′).sub.2 fragments, Fv and epitope-binding fragments of any of the above.
[0073] Other antibody fragments include those described in WO2005003169, WO2005003170, WO2005003171, WO2009040562 and WO2010035012. Functionally active fragments or derivative of a whole immunoglobulin and methods of producing them are well known in the art, see for example Verma et al., 1998, Journal of Immunological Methods, 216, 165-181; Adair and Lawson, 2005. Therapeutic antibodies. Drug Design Reviews—Online 2(3):209-217.
[0074] In one embodiment of the invention each of the antigen-binding portions is independently selected from a Fab, a Fab′, a scFv or a VHH. In one embodiment, the antigen-binding portion binding HVEM is a Fab whilst the antigen-binding portion binding CD9 is a scFv. In another embodiment, the antigen-binding portion binding CD9 is a Fab whilst the antigen-binding portion binding HVEM is a scFv. In another embodiment, both antigen-binding portions are a Fab or scFv.
[0075] In one preferred embodiment, the antibody is monoclonal, which means that the antigen-binding portions comprised therein are all monoclonal. Therefore, in one preferred embodiment of the present invention, there is provided a monoclonal antibody comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9. Preferably, this antibody is capable of further activating T-cells and/or enhancing induction of T-cell proliferation in the presence of SEB stimulation wherein activating T-cells results in an upregulation of CD71, CD137 and CD25.
[0076] Monoclonal antibodies may be prepared by any method known in the art such as the hybridoma technique (Kohler & Milstein, 1975, Nature, 256:495-497), the trioma technique, the human B-cell hybridoma technique (Kozbor et al., 1983, Immunology Today, 4:72) and the EBV-hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, pp 77-96, Alan R Liss, Inc.,
[0077] Antibodies for use in the invention may also be generated using single lymphocyte antibody methods by cloning and expressing immunoglobulin variable region cDNAs generated from single lymphocytes selected for the production of specific antibodies by for example the methods described by Babcook, J. et al, 1996, Proc. Natl. Acad. Sci. USA 93(15):7843-78481; WO92/02551; WO2004/051268 and WO2004/106377.
[0078] The antibodies of the present invention can also be generated using various phage display methods known in the art and include those disclosed by Brinkman et al. (in J. Immunol. Methods, 1995, 182: 41-50), Ames et al. (J. Immunol. Methods, 1995, 184: 177-186), Kettleborough et al. (Eur. J. Immunol. 1994, 24:952-958), Persic et al. (Gene, 1997 187 9-18), Burton et al. (Advances in Immunology, 1994, 57: 191-280) and WO 90/02809; WO 91/10737; WO 92/01047; WO 92/18619; WO 93/11236; WO 95/15982; WO 95/20401; and U.S. Pat. Nos. 5,698,426; 5,223,409; 5,403,484; 5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908; 5,516,637; 5,780,225; 5,658,727; 5,733,743 and 5,969,108. When the antigen-binding portions comprised in the antibody are functionally active fragments or derivatives of a whole immunoglobulin such as single chain antibodies, they may be made such as those described in U.S. Pat. No. 4,946,778 which can also be adapted to produce single chain antibodies binding to HVEM and CD9. Transgenic mice, or other organisms, including other mammals, may be used to express antibodies, including those within the scope of the invention.
[0079] The antibody of the present invention may be chimeric, human or humanised.
[0080] Chimeric antibodies are those antibodies encoded by immunoglobulin genes that have been genetically engineered so that the light and heavy chain genes are composed of immunoglobulin gene segments belonging to different species.
[0081] Humanized, antibodies are antibody molecules from non-human species having one or more complementarity determining regions (CDRs) from the non-human species and a framework region from a human immunoglobulin molecule (see, e.g. U.S. Pat. No. 5,585,089; WO91/09967). Preferably the antibody of the present invention is humanised. In one embodiment of the present invention, there is provided an antibody, preferably a monoclonal antibody, comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9, wherein the antibody is humanised. More preferably this antibody is capable of activating T-cells and/or enhancing induction of T-cell proliferation in the presence of SEB stimulation wherein activating T-cell results in an upregulation of CD137, CD71 and CD25.
[0082] In humanised antibodies, the heavy and/or light chain contains one or more CDRs (including, if desired, one or more modified CDRs) from a donor antibody (e.g. a murine monoclonal antibody) grafted into a heavy and/or light chain variable region framework of an acceptor antibody (e.g. a human antibody). For a review, see Vaughan et al, Nature Biotechnology, 16, 535-539, 1998. In one embodiment, rather than the entire CDR being transferred, only one or more of the specificity determining residues from any one of the CDRs described herein above are transferred to the human antibody framework (see, for example, Kashmiri et al., 2005, Methods, 36, 25-34). When the CDRs or specificity determining residues are grafted, any appropriate acceptor variable region framework sequence may be used having regard to the class/type of the donor antibody from which the CDRs are derived, including mouse, primate and human framework regions. Preferably, the humanised antibody according to the invention comprises a variable domain comprising human acceptor framework regions as well as one or more of the CDRs or specificity determining residues described above. Thus, provided in one embodiment is a humanised monoclonal antibody comprising an antigen-binding portion binding HVEM and an antigen-binding portion binding CD9, wherein each antigen-binding portion comprises a variable domain comprising human acceptor framework regions and non-human donor CDRs.
[0083] Examples of human frameworks which can be used in the invention are KOL, NEWM, REI, EU, TUR, TEI, LAY and POM (Kabat et al, supra). For example, KOL and NEWM can be used for the heavy chain, REI can be used for the light chain and EU, LAY and POM can be used for both the heavy chain and the light chain. Alternatively, human germline sequences may be used; these are available at, for example: http://vbase.mrc-cpe.cam.ac.uk/. In a CDR-grafted antibody of the invention, the acceptor heavy and light chains do not necessarily need to be derived from the same antibody and may, if desired, comprise composite chains having framework regions derived from different chains.
[0084] Fully human antibodies are those antibodies in which the variable regions and the constant regions (where present) of both the heavy and the light chains are all of human origin, or substantially identical to sequences of human origin, not necessarily from the same antibody. Examples of fully human antibodies may include antibodies produced for example by the phage display methods described above and antibodies produced by mice in which the murine immunoglobulin variable and constant region genes have been replaced by their human counterparts, e.g., as described in general terms in EP0546073, U.S. Pat. Nos. 5,545,806, 5,569,825, 5,625,126, 5,633,425, 5,661,016, 5,770,429, EP 0438474 and EP0463151.
[0085] Furthermore, the antibody of the invention may comprise a heavy chain constant region selected from an IgG1, an IgG2, an IgG3 or an IgG4 isotype, or a variant thereof. The constant region domains of the antibody of the invention, if present, may be selected having regard to the proposed function of the antibody, and in particular the effector functions which may be required. For example, the human IgG constant region domains of the IgG1 and IgG3 isotypes may be used when the antibody effector functions are required. Alternatively, IgG2 and IgG4 isotypes may be used when the antibody effector functions are not required. For example, IgG4 molecules in which the serine at position 241 has been changed to proline as described in Angal et al., Molecular Immunology, 1993, 30 (1), 105-108, may be used. Particularly preferred is the IgG4 constant domain that comprises this change.
[0086] It should also be appreciated that antigen-binding portions comprised in the antibody of the invention such as the functionally-active fragments or derivatives of whole immunoglobulin fragments described above, may be incorporated into other antibody formats than being the antigen-binding portions of the classic IgG format. Alternative format to the classic IgG may include those known in the art and those described herein, such as DVD-Igs, FabFvs for example as disclosed in WO2009/040562 and WO2010/035012, diabodies, triabodies, tetrabodies etc. Other examples include a diabody, triabody, tetrabody, bibodies and tribodies (see for example Holliger and Hudson, 2005, Nature Biotech 23(9): 1 126-1136; Schoonjans et al. 2001 , Biomolecular Engineering, 17 (6), 193-202); tandem scFv, tandem scFv-Fc, FabFv, Fab′Fv, FabdsFv, Fab-scFv, Fab′-scFv, diFab, diFab′, scdiabody, scdiabody-Fc, ScFv-Fc-scFv, scdiabody-CH3, IgG-scFv, scFv-IgG, V-IgG, IgG-V, DVD-Ig, DuoBody, Fab-Fv-Fv, Fab-Fv-Fc and Fab-dsFv-PEG fragments described in WO2009040562, WO2010035012, WO2011/08609, WO2011/030107 and WO201 1/061492, respectively.
[0087] Furthermore, the antibody of the invention may comprise along with the antigen-binding portions binding HVEM and CD9, also at least an additional antigen-binding portion. Therefore, in one embodiment, there is provided an antibody, preferably a monoclonal antibody, comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9, wherein the antibody is humanised and wherein the antibody further comprises an additional antigen-binding portion. More preferably this antibody is capable of activating T-cells and/or enhancing induction of T-cell proliferation. The stimulation may be SEB stimulation wherein activating T-cells may result in an upregulation of CD137, CD71 and CD25.
[0088] In one embodiment, the additional antigen-binding portion is capable of increasing, i.e. extending, the half-life of the antibody. Preferably, the additional antigen-binding portion binds albumin, more preferably human serum albumin.
[0089] In one preferred embodiment, the antibody comprises a first antigen-binding portion binding the HVEM and a second antigen-binding portion binding an extracellular domain region of human CD9, wherein the extracellular domain region of CD9 is preferably loop 2 of CD9, and wherein more preferably the second antigen-binding portion binds within amino acids 112 to 195 of SEQ ID NO: 2, wherein the first and the second antigen-binding portions are located on the same antibody, i.e. they are part of the same polypeptide chain, associate via one or more non-covalent and/or covalent associations or linked so as to form one single molecule.
[0090] In another embodiment, the first antigen-binding portion binding HVEM of the antibody of the present invention comprises a first heavy chain variable region and a first light chain variable region and the second antigen-binding portion binding CD9 comprises a second heavy chain variable region and a second light chain variable region and wherein: [0091] a. The first heavy chain variable region comprises a CDR-H1 comprising SEQ ID NO: 3, a CDR-H2 comprising SEQ ID NO: 4 and a CDR-H3 comprising SEQ ID NO: 5; and [0092] b. The first light chain variable region comprises a CDR-L1 comprising SEQ ID NO: 6, a CDR-L2 comprising SEQ ID NO: 7 and a CDR-L3 comprising SEQ ID NO: 8; and [0093] c. The second heavy chain variable region comprises a CDR-H1 comprising SEQ ID NO: 9, a CDR-H2 comprising SEQ ID NO: 10 and a CDR-H3 comprising SEQ ID NO: 11; and [0094] d. The second light chain variable region comprises a CDR-L1 comprising SEQ ID NO: 12, a CDR-L2 comprising SEQ ID NO: 13 and a CDR-L3 comprising SEQ ID NO: 14; [0095] or [0096] e. The first heavy chain variable region comprises SEQ ID NO: 15 and the first light chain variable region comprises SEQ ID NO: 17; and the second heavy chain variable region comprises SEQ ID NO: 19 and second light chain variable region comprises SEQ ID NO: 21; [0097] or [0098] f. The first heavy chain variable region is encoded by a nucleotide sequence comprising SEQ ID NO: 16 and the first light chain variable region is encoded by a nucleotide sequence comprising SEQ ID NO: 18; and the second heavy chain variable region is encoded by a nucleotide sequence comprising SEQ ID NO: 20 and second light chain variable region is encoded by a nucleotide sequence comprising SEQ ID NO: 22.
[0099] In one embodiment, the antibody according to the present invention is prepared according to the disclosure of WO2015/181282, WO2016/009030, WO2016/009029, WO2017/093402, WO2017/093404 and WO2017/093406, which are all incorporated herein by reference.
[0100] More specifically, the antibody is made by the heterodimerization of a Fab-X and a Fab-Y.
[0101] Fab-X comprises a Fab fragment which comprises the first antigen-binding portion binding HVEM which comprises a first heavy chain variable region and a first light chain variable region wherein the first heavy chain variable region comprises a CDR-H1 comprising SEQ ID NO: 3, a CDR-H2 comprising SEQ ID NO: 4 and a CDR-H3 comprising SEQ ID NO: 5; and the first light chain variable region comprises a CDR-L1 comprising SEQ ID NO: 6, a CDR-L2 comprising SEQ ID NO: 7 and a CDR-L3 comprising SEQ ID NO: 8. The Fab comprising the first antigen-binding portion binding HVEM is linked to a scFv (clone 52SR4), preferably via a peptide linker to the C-terminal of the CH1 domain of the Fab fragment and the VL domain of the scFv. The scFv may itself also contains a peptide linker located in between its VL and VH domains.
[0102] Fab-Y also comprises a Fab fragment which comprises the second antigen-binding portion binding CD9 which comprises a second heavy chain variable region and a second light chain variable region and wherein the second heavy chain variable region comprises a CDR-H1 comprising SEQ ID NO: 9, a CDR-H2 comprising SEQ ID NO: 10 and a CDR-H3 comprising SEQ ID NO: 11; and the second light chain variable region comprises a CDR-L1 comprising SEQ ID NO: 12, a CDR-L2 comprising SEQ ID NO: 13 and a CDR-L3 comprising SEQ ID NO: 14. The Fab comprising the second antigen-binding portion binding CD9 is linked to a peptide GCN4 (clone 7P14P), preferably via a peptide linker to the CH1 domain of the Fab fragment.
[0103] The scFv of Fab-X is specific for and complementary to the peptide GCN4 of Fab-Y. As a result, when the Fab-X and the Fab-Y are brought into contact with each other, a non-covalent binding interaction between the scFv and GCN4 peptide occurs, thereby physically retaining the two antigen-binding portions in the form of a complex resulting in an antibody comprising two antigen-binding portions on the same molecule (
[0105] Binding specificities may be exchanged between Fab-X and Fab-Y, i.e. in one embodiment Fab-X may comprise the antigen-binding portion binding to HVEM and Fab-Y the antigen-binding portion binding to CD9; in another embodiment Fab-X may comprise the antigen-binding portion binding to CD9 and Fab-Y the antigen-binding portion binding to HVEM.
[0106] The antibody of the present invention may be comprised in a pharmaceutical composition along with one or more pharmaceutically acceptable excipients. By pharmaceutical composition is intended a composition for both therapeutic and diagnostic use. In another aspect, the present invention provides for a pharmaceutical composition comprising an antibody, preferably a monoclonal antibody, comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9, wherein the antibody is preferably humanised and wherein the composition comprises one or more pharmaceutically acceptable excipients.
[0107] Pharmaceutically acceptable excipients in therapeutic compositions may additionally contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents or pH buffering substances, may be present in such compositions. Such excipients enable the pharmaceutical compositions to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries and suspensions, for ingestion by the patient.
[0108] The antibody of the present invention and the pharmaceutical composition comprising such antibody may be used in therapy.
[0109] Therefore, in another aspect, the present invention provides for an antibody, preferably a monoclonal antibody, or a pharmaceutical composition comprising the antibody, and one or more pharmaceutically acceptable excipients, wherein the antibody comprises a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9, wherein the antibody is preferably humanised and is for use in therapy.
[0110] In one embodiment of this further aspect, the antibody or composition comprising such antibody for use in therapy is an antibody comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding an extracellular domain region of human CD9, wherein the extracellular domain region of CD9 is preferably loop 2 of CD9, and wherein more preferably the second antigen-binding portion binds within amino acids 112 to 195 of SEQ ID NO: 2, wherein the first and the second antigen-binding portions are located on the same antibody, i.e. they are part of the same polypeptide chain, associate via one or more non-covalent and/or covalent associations or linked so as to form one single molecule.
[0111] In another aspect, the present invention provides for an antibody, preferably a monoclonal antibody, or a pharmaceutical composition comprising the antibody, and one or more pharmaceutically acceptable excipients, wherein the antibody comprises a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9, wherein the antibody is preferably humanised and is for use in the treatment of cancer and/or an infectious disease.
[0112] In another embodiment, the antibody or composition comprising such antibody for use in the treatment of cancer and/or an infectious disease is an antibody comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding an extracellular domain region of human CD9, wherein the extracellular domain region of CD9 is preferably loop 2 of CD9, and wherein more preferably the second antigen-binding portion binds within amino acids 112 to 195 of SEQ ID NO: 2, wherein the first and the second antigen-binding portions are located on the same antibody, i.e. they are part of the same polypeptide chain, associate via one or more non-covalent and/or covalent associations or linked so as to form one single molecule.
[0113] In yet another aspect, the present invention provides for a method for treating a subject afflicted with cancer and/or an infectious disease, comprising administering to the subject a pharmaceutically effective amount of an antibody, preferably a monoclonal antibody, or a pharmaceutical composition comprising the antibody, and one or more pharmaceutically acceptable excipients, wherein the antibody comprises a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9, wherein the antibody is preferably humanised.
[0114] The subjects to be treated is preferably a human subject. In one embodiment, there is provided for a method for treating a human subject afflicted with cancer and/or an infectious disease, comprising administering to the subject a pharmaceutically effective amount of an antibody, preferably a monoclonal antibody, or a pharmaceutical composition comprising the antibody and one or more pharmaceutically acceptable excipients, wherein the antibody comprises a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9, wherein the antibody is preferably humanised.
[0115] In yet another embodiment, the method for treating a human subject afflicted with cancer and/or an infectious disease comprises administering an antibody or composition comprising such antibody comprising a first antigen-binding portion binding HVEM and a second antigen-binding portion binding an extracellular domain region of human CD9, wherein the extracellular domain region of CD9 is preferably loop 2 of CD9, and wherein more preferably the second antigen-binding portion binds within amino acids 112 to 195 of SEQ ID NO: 2, wherein the first and the second antigen-binding portions are located on the same antibody, i.e. they are part of the same polypeptide chain, associate via one or more non-covalent and/or covalent associations or linked so as to form one single molecule.
[0116] In another aspect of the present invention, there is provided the use of an antibody, preferably a monoclonal antibody, or a pharmaceutical composition comprising the antibody, and one or more pharmaceutically acceptable excipients, wherein the antibody comprises a first antigen-binding portion binding HVEM and a second antigen-binding portion binding CD9, wherein the antibody is preferably humanised, in the manufacture of a medicament for treating cancer and/or an infectious disease.
[0117] Example of cancers that may be treated using the antibody, or pharmaceutical composition comprising such antibody, include but are not limited to, Acute Lymphoblastic Leukaemia, Acute Myeloid Leukaemia, Adrenocortical Carcinoma, AIDS-Related Cancers Kaposi Sarcoma (Soft Tissue Sarcoma), AIDS-Related Lymphoma, Primary CNS Lymphoma, Anal Cancer, Appendix Cancer Astrocytomas, Atypical Teratoid/Rhabdoid Tumour, Brain Cancer, Basal Cell Carcinoma of the Skin, Bile Duct Cancer, Bladder Cancer, Bone Cancer (includes Ewing Sarcoma and Osteosarcoma and Malignant Fibrous Histiocytoma), Breast Cancer, Bronchial Tumours, Burkitt Lymphoma, Carcinoid Tumour, Cardiac (Heart) Tumours, Embryonal Tumours, Germ Cell Tumour, Primary CNS Lymphoma, Cervical Cancer, Cholangiocarcinoma, Chordoma, Chronic Lymphocytic Leukaemia, Chronic Myelogenous Leukaemia, Chronic Myeloproliferative Neoplasms, Colorectal Cancer, Craniopharyngioma, Cutaneous T-Cell Lymphoma, Ductal Carcinoma In Situ, Endometrial Cancer (Uterine Cancer), Ependymoma, Oesophageal Cancer, Esthesioneuroblastoma (Head and Neck Cancer), Ewing Sarcoma (Bone Cancer), Extracranial Germ Cell Tumour, Extragonadal Germ Cell Tumour, Eye Cancer, Intraocular Melanoma, Retinoblastoma, Fallopian Tube Cancer, Fibrous Histiocytoma of Bone, Malignant, and Osteosarcoma, Gallbladder Cancer, Gastric (Stomach) Cancer, Gastrointestinal Carcinoid Tumour, Gastrointestinal Stromal Tumours (Soft Tissue Sarcoma), Ovarian Germ Cell Tumours, Testicular Cancer, Gestational Trophoblastic Disease, Hairy Cell Leukaemia, Head and Neck Cancer, Hepatocellular (Liver) Cancer, Histiocytosis, Langerhans Cell Hodgkin Lymphoma, Hypopharyngeal Cancer, Intraocular Melanoma, Isle T-cell Tumours, Pancreatic Neuroendocrine Tumours, Kaposi Sarcoma (Soft Tissue Sarcoma), Kidney (Renal Cell) Cancer, Langerhans Cell Histiocytosis, Laryngeal Cancer, Leukaemia, Lip and Oral Cavity Cancer, Liver Cancer, Lung Cancer (Non-Small Cell and Small Cell), Male Breast Cancer, Malignant Fibrous Histiocytoma of Bone and Osteosarcoma, Melanoma, Intraocular (Eye) Childhood Intraocular, Merkel Cell Carcinoma, Mesothelioma, Metastatic Cancer, Metastatic Squamous Neck Cancer with Occult Primary, Midline Tract Carcinoma With NUT Gene Changes, Mouth Cancer, Multiple Endocrine Neoplasia Syndromes, Multiple Myeloma/Plasma Cell Neoplasms, Mycosis Fungoides (Lymphoma), Myelodysplastic Syndromes, Myelodysplastic/Myeloproliferative Neoplasms, Myelogenous Leukaemia, Chronic, Myeloid Leukaemia, Acute, Myeloproliferative Neoplasms, Nasal Cavity and Paranasal Sinus Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Hodgkin Lymphoma, Non-Small Cell Lung Cancer, Oral Cancer, Lip and Oral Cavity Cancer and Oropharyngeal Cancer, Osteosarcoma and Malignant Fibrous Histiocytoma of Bone, Ovarian Cancer, Pancreatic Cancer, Pancreatic Neuroendocrine Tumours (Isle T-cell Tumours), Papillomatosis, Paraganglioma, Paranasal Sinus and Nasal Cavity Cancer, Parathyroid Cancer, Penile Cancer, Pharyngeal Cancer, Pheochromocytoma, Pituitary Tumour, Plasma Cell Neoplasm/Multiple Myeloma, Pleuropulmonary Blastoma, Pregnancy and Breast Cancer, Primary Central Nervous System (CNS) Lymphoma, Primary Peritoneal Cancer, Prostate Cancer, Rectal Cancer, Recurrent Cancer, Renal Cell (Kidney) Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer, Sarcoma Childhood Rhabdomyosarcoma, Childhood Vascular Tumours, Ewing Sarcoma, Kaposi Sarcoma, Osteosarcoma, Soft Tissue Sarcoma, Uterine Sarcoma, Sezary Syndrome, Skin Cancer, Small Intestine Cancer, Squamous Cell Carcinoma of the Skin, Squamous Neck Cancer with Occult Primary, Stomach (Gastric) Cancer, Cutaneous T-Cell Lymphoma, Testicular Cancer, Throat Cancer, Nasopharyngeal Cancer, Oropharyngeal Cancer, Hypopharyngeal Cancer, Thymoma and Thymic Carcinoma, Thyroid Cancer, Transitional Cell Cancer of the Renal Pelvis and Ureter, Urethral Cancer, Uterine Cancer, Endometrial Uterine Sarcoma, Vaginal Cancer, Vascular Tumours, Vulvar Cancer and Wilms Tumour, and any combinations of said cancers. The present invention is also applicable to treatment of metastatic cancers.
[0118] The antibody according to the present invention, or the pharmaceutical composition comprising such antibody, may be administered concomitantly or sequentially to one or more additional cancer therapies. By cancer therapies is intended drug-based therapies as well as other type of cancer therapies such as radiotherapies.
[0119] The invention will now be further described by way of examples with references to embodiments illustrated in the accompanying drawings
EXAMPLES
Example 1: T-Cell Activation Primary Screen
[0120] The activation status of T-cells can be assessed through their expression of cell surface markers and secreted cytokines which play important roles in cellular function. Activated T-cells for example upregulate CD25, CD71 and CD137 on their surface. T-cells in the tumour microenvironment are often maintained in a suppressed state and express only low levels of these proteins. Agents that overcome this suppression and induce T-cell activation and proliferation have tremendous therapeutic potential as they may unleash effective anti-tumour T-cell responses and promote cancer elimination.
[0121] To identify novel modulators of T-cell activation, a large screen was undertaken whereby 49 antigen specificities were combined to generate a grid of bispecific antibodies with a theoretical size of 1,176 possible bispecific combinations. The specificities were selected from the literature as being expressed on T-cells or expressed on other cell types involved in interactions with T-cells. Of this potential grid, 969 novel antigen bispecific constructs were tested, covering 82.4% of the possible combinations. Between 1 and 4 different antibodies were tested for each specificity, and all were tested on peripheral blood mononuclear cells (PBMC) from donors in combination with a negative control arm to identify the effect of the monovalent forms of the construct.
[0122] PBMC represent the major leukocyte classes involved in both innate and adaptive immunity, apart from granulocytes. PBMC comprise a heterogenous population of cells which when manipulated in vitro provide a relatively more relevant physiological environment compared to isolated component cell types such as T-cell types such as T-cells and monocytes, that are no longer capable of responding to paracrine and autocrine signals provided by other cells. As such identification of molecules modulating specific subsets of cells within the wider PBMC population, have increased translational potential to more complex biological systems, ultimately increasing success rates for modulating immune cell interactions in disease.
[0123] Each bispecific combination was tested on two PBMC donors. The negative control arm is a Fab from an antibody raised to an antigen not expressed on PBMC.
[0124] Fusion proteins were prepared according to the disclosure of WO2015/181282, WO2016/009030, WO2016/009029, WO2017/093402, WO2017/093404 and WO2017/093406, which are all incorporated herein by reference. The first fusion protein (A-X) includes a Fab fragment (A of the A-X) with specificity to one antigen, which is linked to X, a scFv (clone 52SR4) via a peptide linker to the C-terminal of the CH1 domain of the Fab fragment and the VL domain of the scFv. The scFv itself also contains a peptide linker located in between its VL and VH domains.
[0125] The second fusion protein (B-Y) includes a Fab fragment (B of the B-Y) with specificity to another antigen. However, in comparison to the first protein, the Fab fragment B is attached to Y, a peptide GCN4 (clone 7P14P) via a peptide linker to the CH1 domain of the Fab fragment.
[0126] The scFv, X, is specific for and complementary to the peptide GCN4, Y. As a result, when the two fusion proteins are brought into contact with each other, a non-covalent binding interaction between the scFv and GCN4 peptide occurs, thereby physically retaining the two fusion proteins in the form of a complex mimicking an antibody comprising two different antigen-binding portions on the same molecule (
[0127] Purified Fab-X and Fab-Y with varying specificities were incubated together for 60 minutes (in a 37° C./5% CO.sub.2 environment) at an equimolar concentration. The final molarity of each tested complex was 100 nM. In 384-well tissue culture plates, 1.0E+05 PBMC were added to wells, to which were added pre-formed Fab-X/Fab-Y bispecific antibodies. Following addition of the bispecific antibodies, the cells were incubated for 48 hours at 37° C./5% CO.sub.2, with or without 1 μg/mL (final concentration) Staphylococcal Enterotoxin-B (SEB) superantigen. After 48 hours the plates were centrifuged at 500 ×g for 5 minutes at 4° C. Cell culture conditioned media was transferred from the cell pellets to fresh plates and frozen at −80° C. Cells were washed with 60 μL FACS buffer two times by centrifugation, followed by resuspension of the pellets by shaking the plates at 2200 rpm for 30 seconds. The cells were stained with a panel of fluorescently labelled antibodies as listed in the Table 2 and incubated at 4° C. in the dark for 1 hour.
TABLE-US-00002 TABLE 2 Epitope Fluorophore Clone Source Dilution CD56 APC HCD56 BioLegend ® 40 CD14 PE/Cy7 M5E2 BD Pharmagen ® 80 CD8 BV650 RPA-T8 BioLegend ® 80 CD4 BV605 RPA-T4 BD Horizon ® 40 CD19 PE-Cy5 HIB19 BD Pharmagen ® 20 CD45RO BV786 UCHL1 BD Horizon ® 40 CD71 FITC M-A712 BD Pharmagen ® 20 CD25 BV510 M-A251 BD Horizon ® 40 CD137 PE 4B4-1 BD Pharmagen ® 20 Live/Dead Near IR Thermo Scientific ® 1000
[0128] After this time, cells were washed twice with FACS buffer, before fixing with 2% paraformaldehyde (BD CellFix™, diluted in dH.sub.2O) and stored overnight at 4° C. The plates were centrifuged at 500 ×g for 5 minutes, the fixation buffer aspirated to waste and the cells resuspended in a residual volume of 10 μL for acquisition on the iQue® Screener Plus (IntelliCyt®). The data analysis software package ForeCyt™ (IntelliCyt®) was used to gate on CD14+ monocytes, CD56+ NK cells, CD19+ B-cells, CD4+ and CD8+ memory and naïve T-cells. For each cell population the cellular expression of CD25 and CD71 was measured as reported median fluorescent intensity values. The data were then used to calculate the log2 fold changes of expression relative to control well values.
[0129] The resulting flow cytometry data were analysed by identification of the CD4+ and CD8+ memory and naïve T-cells and well as the B cells, NK cells and monocytes. The MFI values of the 3 activation markers CD71, CD137 and CD25 were then determined and the log2 fold changes calculated relative to the control wells for each cell population. These results were deposited into the visualisation software Spotfire®, where it was possible to identify antigen pairs capable of inducing an increase in T-cell activation.
[0130] When considering antigen pairs capable of upregulating the activation markers CD25, CD137 and CD71 on T-cells in the presence of an SEB stimulation, but not in unstimulated conditions, the HVEM-CD9 bispecific pair was identified.
[0131] The HVEM-CD9 bispecific antibody was therefore taken into subsequent assays to show that its effect was reproducible across a larger number of donors.
Example 2: HVEM-CD9 Follow Up Assay
[0132] To confirm the effect of HVEM-CD9 on stimulation of T-cells, a further 4 PBMC donors were assayed in SEB-stimulated and unstimulated conditions.
[0133] A grid of fusion proteins Fab-X and Fab-Y were created by diluting equimolar (1 μM) quantities of Fab-X (Fab-scFv) and Fab-Y (Fab-peptide) with specificity for HVEM and CD9 in TexMACS™ media (Miltenyi Biotec®) containing 100 U/mL penicillin/100 μg/mL streptomycin. Mixtures of equimolar (1 μM) Fab-Y proteins were also generated in the same manner. The Fab-X and Fab-Y fusion proteins were incubated together for 1 hour (in a 37° C./5%CO.sub.2 environment), at a final concentration of 500 nM. Negative control wells containing TexMACS™ media only were also generated alongside the Fab-X and Fab-Y wells.
[0134] During this time, cryopreserved human PBMCs isolated from platelet leukapheresis cones were thawed and washed in TexMACS™ media and resuspended at 3.33×10.sup.6 cells/mL. The PBMCs were then seeded into 384 well flat bottom tissue culture plates (Greiner Bio-one®) at 30 μl/well (1×10.sup.5 PBMCs).
[0135] A total of 10 μl of Fab-X and Fab-Y complexes were transferred to the plates containing 30 μl PBMCs. The PBMCs were then either left unstimulated by the addition of 10 μl of TexMACS™ media, or stimulated with 10 μl of SEB (1 μg/mL final concentration). This resulted in a final assay concentration of Fab-X and Fab-Y complexes of 100 nM. The plates were then returned to a 37° C./5%CO.sub.2 environment for 48 hours.
[0136] After 48 hours the plates were centrifuged at 500 ×g for 5 minutes at 4° C. Conditioned medium was transferred from the cell pellets to fresh plates and frozen at −80° C. Cells were washed with 60 μL FACS buffer two times by centrifugation, followed by resuspension of the pellets by shaking the plates at 2200 rpm for 30 seconds. The cells were stained with a panel of fluorescently labelled antibodies as listed in Table 2 and incubated at 4° C. in the dark for 1 hour. After this time, cells were washed twice with FACS buffer, before fixing with 2% paraformaldehyde (BD CellFix™ diluted in dH.sub.2O) and stored overnight at 4° C. The plates were centrifuged at 500 ×g for 5 minutes, the fixation buffer aspirated to waste and the cells resuspended in a residual volume of 10 μL for acquisition on the iQue® Screener Plus (IntelliCyt®).
[0137] The data analysis software package ForeCyt™ (IntelliCyt®) was used to gate on CD14+ monocytes, CD56+ NK cells, CD19+ B-cells, CD4+ and CD8+ memory and naïve T-cells. For each cell population the cellular expression of CD25, CD71 and CD137 was measured as reported median fluorescent intensity values. The data were then used to calculate the log2 fold changes of expression relative to control well values.
[0138] Twenty-Four Fab-X/Fab-Y bispecific antibodies showed increased expression of the activation marker CD25 on CD4+ (
[0139] When studied in unstimulated conditions the HVEM/CD9 bispecific antibodies did not lead to any increases in activation marker fluorescence intensity in either CD4+ cells (
[0140] Furthermore, it was possible to measure the level of CD25 expression on naïve versus memory T-cell populations by the separation of the CD45RO-expressing memory cells from the CD45RO non-expressing naïve T-cell populations. Upon analysis of these sub populations a preference for upregulation of CD25 on the memory CD4+ and CD8+ T-cell populations compared to the naïve populations was identified (
[0141] The levels of expression on CD4+ and CD8+ memory T-cells of CD71 (
[0142] The bivalents (i.e. formed by a fusion where both Fab in the Fab-X and Fab-Y are specific for CD9 or HVEM as the case may be) and monovalent antibodies for CD9 or HVEM (i.e. formed by a fusion where the Fab is specific for CD9 or HVEM but the other component Fab is a negative control) did not lead to a similar increase in the activation marker fluorescence intensity on either cell populations, suggesting that a monospecific antibody binding CD9 alone or HVEM alone, whether in a monovalent or bivalent fashion, is unable to stimulate activation in the absence of the binding to the other antigen.
Example 3: Effect of a HVEM-CD9 Bispecific Antibody on T-Cell Proliferation
[0143] The effect of an anti-HVEM-CD9 bispecific antibody on proliferation of CD4+ and CD8+ T-cells was assessed in 5 PBMC donors. Mixtures of fusion proteins Fab-X and Fab-Y were created by diluting equimolar (1 μM) quantities of Fab-X and Fab-Y with specificity for HVEM and CD9 in DMEM (Thermo Fisher) containing 10% foetal bovine serum (FBS) and 100 U/mL penicillin/100 μg/mL streptomycin. Mixtures of equimolar (1 μM) Fab-Y proteins were also generated in the same manner. The Fab-X and Fab-Y fusion proteins were incubated together for 1 hour (in a 37° C./5%CO.sub.2 environment) to generate bispecific antibodies.
[0144] During this time, cryopreserved human PBMCs isolated from platelet leukapheresis cones were thawed, washed in DMEM media and resuspended at approximately 2 ×10.sup.6 cells/mL in PBS. CellTrace™ Violet (CTV; ThermoFisher) was then added to a final concentration of 1 μM (2 μl 5 mM CTV in DMSO added to 10mL cells), incubated in the dark at room temperature for 20 minutes, the cells washed twice with DMEM and resuspended in media to a final concentration of 1 ×10.sup.6 cells/mL.
[0145] Fab-X/Fab-Y bispecific antibodies were diluted to 400 nM concentration in DMEM and 50 μl transferred in triplicate to wells of a 96 well U bottom tissue culture plate. Anti-CD3 (clone UCHT-1), 50 μl of a 200ng/mL solution in DMEM, was then added. To 3 wells 100 μl DMEM media alone was added as a negative proliferation control. Finally, 100 μl of CTV labelled PBMC were added to each well. This resulted in a final assay concentration of Fab-X/Fab-Y bispecific antibodies of 100 nM, 50 ng/mL anti-CD3 and 1×10.sup.5 cells/well. The plates were then returned to a 37° C./5%CO.sub.2 environment for 96 hours.
[0146] After 96 hours the plates were centrifuged at 300 ×g for 5 minutes. Cell culture conditioned media was removed, the cells were washed twice with FACS buffer (2%FBS in PBS) and then resuspended in 50 μl FACS buffer containing fluorescently labelled antibodies, as listed in Table 3. The cells were incubated at room temperature in the dark for 20 minutes, washed twice with FACS buffer, resuspended in 100 μl/per well FACS buffer and analysed by flow cytometry (BD FACS Canto II™). Total events from 50 μl (50% volume) of each well were collected.
[0147] The data analysis software package FlowJo® was used to gate on CD8+ and CD4+ cells. Cell proliferation was assessed by enumerating cells with reduced CTV staining relative to unstimulated cells. The data are presented as the mean±SEM for triplicate wells.
TABLE-US-00003 TABLE 3 Epitope Fluorophore Clone Source Dilution CD8 PE RPA-T8 BD 100 CD4 APC RPA-T4 BioLegend ® 20
[0148] As shown in
Example 4: Analysis of Anti-CD9 Antibody Binding by Biolayer Interferometry
[0149] CD9 contains two extracellular loops: a short extracellular loop (loop 1: 34-55 in SEQ ID NO:2) and a long extracellular loop (loop 2: 112-195 in SEQ ID NO:2). We used biolayer interferometry to assess binding of our panel of CD9 Fab-Y antibodies (selected for their ability to bind full-length cell-expressed CD9) to the long extracellular loop 2 peptide, using the Octet® RED384 System (ForteBio) with Anti-hlgG Fc Capture (AHC) Biosensors (ForteBio) at room temperature. Firstly, an array of 8 sensors was dipped in kinetics buffer (PBS 0.1%, BSA 0.02%, Tween 20) for 120 seconds to provide a baseline signal. Sensors were then moved to wells containing 200 μl of recombinant human CD9 long extracellular loop 2-human Fc fusion protein (10015-CD, R&D Systems®) at 2 μg/mL in kinetics buffer to immobilize the protein to the biosensor (100 seconds), followed by a second baseline step (180 seconds) in kinetics buffer to equilibrate the biosensors now coated with the CD9 long extracellular loop 2-human Fc fusion protein. No detachment of the peptide was observed during this step. Sensors were then dipped in wells containing one of the anti-CD9 Fab (10 μg/mL) to evaluate association of each antibody to CD9-loop2 (120 seconds), followed by dissociation in kinetics buffer (600 seconds). Anti-CD137 Fab-Y (11175) was used as negative control during the antibody association step. A new set of 8 biosensors was used to repeat this process for each of the anti-CD9 antibodies (7270, 7271, 7272, 7485, 7486, 7489, 7491).
[0150] As shown in Table 4, all the anti-CD9 antibodies tested bind to the long extracellular loop 2 of CD9 and all are functional when combined with anti-HVEM antibodies 7660 and 7817. A positive functional response is considered to be the capacity to increase CD25 expression on T cells greater than 0.5 log2 fold change MFI in 2 donors when added as a Fab-K.sub.D-Fab with anti-HVEM antibodies as shown in generated as in example 2 and shown in
TABLE-US-00004 TABLE 4 CD9 long extracellular loop 2 Functional (Y/N) 7270 ✓ Y 7271 ✓ Y 7272 ✓ Y 7485 ✓ Y 7486 ✓ Y 7489 ✓ Y 7491 ✓ Y