POLYPEPTIDES ENCODING ANTIBODIES BINDING TO SARS-COV-2 SPIKE PROTEIN

20230192821 · 2023-06-22

Assignee

Inventors

Cpc classification

International classification

Abstract

There is provided inter alia a polypeptide comprising a CDRH1 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a CDRH1 sequence as shown in Table 1 and/or a CDRH2 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a CDRH2 sequence as shown in Table 1 and/or a CDRH3 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a CDRH3 sequence as shown in Table 1.

Claims

1. A polypeptide comprising: a CDRH1 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a CDRH1 sequence as shown in Table 1 and/or a CDRH2 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a CDRH2 sequence as shown in Table 1 and/or a CDRH3 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a CDRH3 sequence as shown in Table 1.

2. The polypeptide according to claim 1 wherein the polypeptide comprises a CDRH1 sequence comprising or consisting of a sequence sharing 90% or greater sequence identity with a CDRH1 sequence as shown in Table 1 and/or a CDRH2 sequence comprising or consisting of a sequence sharing 90% or greater sequence identity with a CDRH2 sequence as shown in Table 1 and/or a CDRH3 sequence comprising or consisting of a sequence sharing 90% or greater sequence identity with a CDRH3 sequence as shown in Table 1.

3. The polypeptide according to claim 2 wherein the polypeptide comprises a CDRH1 sequence comprising or consisting of a CDRH1 sequence as shown in Table 1 and/or a CDRH2 sequence comprising or consisting of a CDRH2 sequence as shown in Table 1 and/or a CDRH3 sequence comprising or consisting of a CDRH3 sequence as shown in Table 1.

4. The polypeptide according to claim 3 wherein the polypeptide comprises a CDRH1 sequence comprising or consisting of a CDRH1 sequence as shown in Table 1 and a CDRH2 sequence comprising or consisting of a CDRH2 sequence as shown in Table 1 and a CDRH3 sequence comprising or consisting of a CDRH3 sequence as shown in Table 1.

5. The polypeptide according to any preceding claim, wherein the polypeptide comprises a FWRH1 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH1 sequence as shown in Table 1 and/or a FWRH2 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH2 sequence as shown in Table 1 and/or a FWRH3 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH3 sequence as shown in Table 1 and/or a FWRH4 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH4 sequence as shown in Table 1.

6. A polypeptide comprising: a FWRH1 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH1 sequence as shown in Table 1 and/or a FWRH2 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH2 sequence as shown in Table 1 and/or a FWRH3 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH3 sequence as shown in Table 1 and/or a FWRH4 sequence comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH4 sequence as shown in Table 1.

7. The polypeptide according to either claim 5 or 6, wherein the polypeptide comprises a FWRH1 sequence comprising or consisting of a sequence sharing 90% or greater sequence identity with a FWRH1 sequence as shown in Table 1 and/or a FWRH2 sequence comprising or consisting of a sequence sharing 90% or greater sequence identity with a FWRH2 sequence as shown in Table 1 and/or a FWRH3 sequence comprising or consisting of a sequence sharing 90% or greater sequence identity with a FWRH3 sequence as shown in Table 1 and/or a FWRH4 sequence comprising or consisting of a sequence sharing 90% or greater sequence identity with a FWRH4 sequence as shown in Table 1.

8. The polypeptide according to claim 7, wherein the polypeptide comprises a FWRH1 sequence comprising or consisting of a FWRH1 sequence as shown in Table 1 and/or a FWRH2 sequence comprising or consisting of a FWRH2 sequence as shown in Table 1 and/or a FWRH3 sequence comprising or consisting of a FWRH3 sequence as shown in Table 1 and/or a FWRH4 sequence comprising or consisting of a FWRH4 sequence as shown in Table 1.

9. The polypeptide according to claim 8, wherein the polypeptide comprises a FWRH1 sequence comprising or consisting of a FWRH1 sequence as shown in Table 1 and a FWRH2 sequence comprising or consisting of a FWRH2 sequence as shown in Table 1 and a FWRH3 sequence comprising or consisting of a FWRH3 sequence as shown in Table 1 and a FWRH4 sequence comprising or consisting of a FWRH4 sequence as shown in Table 1.

10. The polypeptide according to any preceding claim, wherein the polypeptide comprises three complementarity determining regions (CDRH1-CDRH3).

11. The polypeptide according to any preceding claim, wherein the polypeptide comprises four framework regions (FWRH1-FWRH4).

12. A polypeptide comprising or consisting of a sequence sharing 80% or greater sequence identity with any immunoglobulin heavy chain variable domain (VH) sequence as shown in Table 1 or Table 2.

13. The polypeptide according to claim 12, wherein the polypeptide comprises or consists of a sequence sharing 90% or greater sequence identity with any immunoglobulin heavy chain variable domain (VH) sequence as shown in Table 1 or Table 2.

14. The polypeptide according to either claim 12 or 13 wherein the polypeptide comprises or consists of an immunoglobulin heavy chain variable domain (VH) sequence as shown in Table 1 or Table 2.

15. The polypeptide according to any preceding claim which is paired with a cognate light chain polypeptide.

16. The polypeptide according to any preceding claim wherein the polypeptide is an antibody.

17. The polypeptide according to claim 15 wherein the antibody belongs to the isotype subclass IGHA1, IGHA2, IGHG1, IGHG2, IGHG3 or IGHG4.

18. The polypeptide according to any one of claims 1 to 14 wherein the polypeptide is an antibody fragment, such as a F(ab′).sub.2, an Fd, an Fv, an scFv, a VH, or a VHH.

19. The polypeptide according to any preceding claim, wherein the polypeptide binds to the spike protein (S protein) of SARS-CoV-2.

20. The polypeptide according to claim 19 wherein the polypeptide binds to the S1 or S2 domain of the spike protein (S protein), such as the S1 domain of the spike protein (S1 protein).

21. Polypeptide according to any preceding claims which binds to SARS-Cov2 viral proteins other than the spike protein.

22. Polypeptide according to any preceding claims which binds to SARS-CoV2 infected human cells.

23. Polypeptide according to any preceding claim which binds to a human protein to reduce viral load, increase viral neutralisation or beneficially modify immune responses occurring as a consequence of virus infection.

24. A pharmaceutical composition comprising the polypeptide according to any preceding claim and one or more pharmaceutically acceptable diluents or carriers.

25. The pharmaceutical composition according to claim 24 further comprising up to 3 polypeptides that may bind to different epitopes, in various combination ratios according to any preceding claim.

26. The pharmaceutical composition according to either claim 24 or 25 comprising at least one further active agent such as an anti-viral or anti-inflammatory agent.

27. The polypeptide or pharmaceutical composition according to any preceding claims, for use in suppressing or treating a disease or disorder mediated by infection of SARS-CoV-2, such as COVID-19, or for providing prophylaxis to a subject at risk of infection of SARS-CoV-2, such as COVID-19.

28. A method of suppressing or treating a disease or disorder mediated by infection of SARS-CoV-2, such as COVID-19 or for providing prophylaxis to a subject at risk of infection of SARS-CoV-2, such as COVID-19, comprising administering to a person in need thereof a therapeutically effective amount of the polypeptide or pharmaceutical composition according to any preceding claims.

29. A polypeptide or pharmaceutical composition according to any preceding claims, for providing treatment or prophylaxis of an infection mediated by other/new forms of coronavirus.

30. One or more polypeptides according to any preceding claims, for use in diagnosis and/or prediction of outcome of SARS-CoV-2 infection.

31. A polypeptide or pharmaceutical composition according to any preceding claims, for use in medical equipment in order to prevent or reduce the risk of infection (e.g., mask or air filter).

32. A polynucleotide encoding the polypeptide according to any one of claims 1 to 23.

33. A vector comprising the polynucleotide according to claim 32.

Description

DESCRIPTION OF THE FIGURES

[0033] FIG. 1A. B cell responses to SARS-COV-2 infection. IGHV gene segment usage distribution per isotype subclass. Bars show mean values+/− standard error of the mean. Comparisons performed using t-tests, with adjusted p values using Bonferroni correction for multiple comparisons; *p<0.05, **p<0.005, ***p<0.0005.

[0034] FIG. 1B. B cell responses to SARS-COV-2 infection. Isotype subclass distribution between IGHA and IGHG subclasses. Bars show mean values+/− standard error of the mean. Comparisons performed using t-tests, with adjusted p values using Bonferroni correction for multiple comparisons; *p<0.05, **p<0.005, ***p<0.0005.

[0035] FIG. 1C. B cell responses to SARS-COV-2 infection. Mean BCR CDRH3 lengths from COVID-19 patients compared to healthy controls. Bars show mean values+/− standard error of the mean. Comparisons performed using t-tests, with adjusted p values using Bonferroni correction for multiple comparisons; *p<0.05, **p<0.005, ***p<0.0005.

[0036] FIG. 2A. Response characteristics of SARS-CoV-2 infection. Distribution of sequences with different numbers of mutations from germline.

[0037] FIG. 2B. Response characteristics of SARS-CoV-2 infection. Relationship between the proportion of the repertoire comprised by unmutated sequences, and the disease state.

[0038] FIG. 2C. Response characteristics of SARS-CoV-2 infection. Individual sequences were clustered together into related groups to identify clonal expansions (clonotypes). Diversity of all clonotypes in the repertoire calculated using the Shannon diversity index. To normalise for different sequence numbers for each sample, a random subsample of 1,000 sequences was taken.

[0039] FIG. 2D. Response characteristics of SARS-CoV-2 infection. Correlation between the Shannon diversity index, and the proportion of unmutated sequences.

[0040] FIG. 2E. Response characteristics of SARS-CoV-2 infection. The percent of all sequences that fall into the largest 10 clonotypes.

[0041] FIG. 2F. Response characteristics of SARS-CoV-2 infection. Mean number of mutations of all sequences in the largest 10 clonotypes.

[0042] FIG. 3A. Convergent BCR sequence signature within individuals infected with SARS-CoV-2. Data from all patients and healthy controls were clustered together to identify convergent clonotypes. Shown is the number of clonotypes shared by different numbers of participants, grouped by whether the clonotypes are also present in the healthy control dataset.

[0043] FIG. 3B. Convergent BCR sequence signature within individuals infected with SARS-CoV-2. Data from all patients and healthy controls were clustered together to identify convergent clonotypes. Of the convergent clonotypes, the mean mutation count was compared between those that were convergent only within the SARS-CoV-2 patients, and those that were also convergent with the healthy control dataset.

[0044] FIG. 3C. Convergent BCR sequence signature within individuals infected with SARS-CoV-2. Data from all patients and healthy controls were clustered together to identify convergent clonotypes. Of the convergent clonotypes, the CDRH3 AA sequence length was compared between those that were convergent only within the SARS-CoV-2 patients, and those that were also convergent with the healthy control dataset.

[0045] FIG. 3D. Convergent BCR sequence signature within individuals infected with SARS-CoV-2. Data from all patients and healthy controls were clustered together to identify convergent clonotypes. Shown is a heatmap of the 777 convergent COVID-19-associated clonotypes (observed between 4 or more COVID-19 participants) with the 469 convergent clonotypes from seven metastatic breast cancer (BC) patient biopsy samples, demonstrating that the convergent signatures are unique to each disease cohort.

[0046] FIG. 3E. Convergent BCR sequence signature within individuals infected with SARS-CoV-2. Data from all patients and healthy controls were clustered together to identify convergent clonotypes. Shown is the percentage frequencies of four example convergent clonotypes grouped by clinical status. Disclosed are SEQ ID NOS 570, 468, 435, and 467, respectively, in order of appearance

[0047] FIG. 3F. Convergent BCR sequence signature within individuals infected with SARS-CoV-2. Data from all patients and healthy controls were clustered together to identify convergent clonotypes. Shown is a similarity tree of convergent clonotype cluster centers that are significantly associated with clinical status. Groups (i) and (ii) indicate groups of similar convergent clonotypes. An alignment of group (ii) provided adjacent. Disclosed are SEQ ID NOS 907, 943, 433, 570, 461, 435, 974, 655, 468, 481, 552, 480, 458, 467, 722, 742, 851, 558, 440, 540, 463, 487, 575, 559, 416, 467, 722, 742, 851, and 558, respectively, in order of columns.

[0048] FIG. 3G. Convergent BCR sequence signature within individuals infected with SARS-CoV-2. Data from all patients and healthy controls were clustered together to identify convergent clonotypes. Proportions of IGHA and IGHG of the convergent clonotypes that are associated with patients with improving symptoms are shown.

[0049] FIG. 4A. Matches of the 777 convergent clonotypes identified in the present study to other SARS-CoV-2 studies. CDRH3 sequence (shown across the top in black text, SEQ ID NO: 2002), and IGHV/IGHJ gene segments of a sequence identified in the bronchoalveolar lavage fluid of a SARS-CoV-2 patient from a Chinese cohort, and a CDRH3 AA sequence logo unpacking the sequence diversity present in the convergent clonotype found in the COVID-19 patients in this study that had an exact AA match.

[0050] FIG. 4B. Matches of the 777 convergent clonotypes identified in the present study to other SARS-CoV-2 studies. CDRH3 sequence (shown across the top in black text, SEQ ID NO: 2015), and IGHV/IGHJ gene segment of an antibody in the CoV-AbDab (S304) that has SARS-CoV-1 and SARS-CoV-2 neutralising activity, alongside a CDRH3 AA sequence logo unpacking the sequence diversity in the convergent clonotype found in the COVID-19 patients in this study that had an exact AA match.

[0051] FIG. 4C. Matches of the 777 convergent clonotypes identified in the present study to other SARS-CoV-2 studies. Shown is a comparison of convergent clonotypes to the BCR data from Nielsen et al.sup.14. Plotted along the x-axis are the 405 convergent clonotypes represented in at least one Nielsen et al. dataset. Each row represents a separate BCR repertoire from Nielsen et al.; Non-shaded area indicates that the convergent clonotype has a match in the Nielsen dataset.

[0052] FIG. 5A. Distribution of sequences with different numbers of mutations from germline. Each row is a different COVID-19 patient (right).

[0053] FIG. 5B. Distribution of sequences with different numbers of mutations from germline. Each row is a different COVID-19 patient (right).

[0054] FIG. 5C. Distribution of sequences with different numbers of mutations from germline. Each row is a different COVID-19 patient (right).

[0055] FIG. 5D. Distribution of sequences with different numbers of mutations from germline. Each row is a different COVID-19 patient (right).

[0056] FIG. 6. The proportion of IGHG1 sequences containing the autoreactive “NHS” and “AVY” motifs between COVID patients with improving, stable or worsening symptoms. IGHG1 (box) was the only significant correlation. P-values are determined by ANOVA.

[0057] FIG. 7A. Properties of the 777 convergent clonotypes. Pie chart shows isotype subclass usage of the sequences with the 777 convergent clonotypes.

[0058] FIG. 7B. Properties of the 777 convergent clonotypes. Graph shows IGHV gene segment usage of the 777 convergent clonotypes.

[0059] FIG. 8A. Percentage frequencies of the convergent clonotypes grouped by clinical status that significantly associated with clinical status. Disclosed are SEQ ID NOS 655, 943, 552, 559, 575, 463, 742, 570, 435, 416, 481, and 468, respectively, in order of appearance.

[0060] FIG. 8B. Percentage frequencies of the convergent clonotypes grouped by clinical status that significantly associated with clinical status. Disclosed are SEQ ID NOS 487, 722, 461, 467, 540, 558, 480, 458, 440, 974, 851, 433, and 907, respectively, in order of appearance.

[0061] FIG. 9A. Lineage tree of the convergent clonotype that matched to the bronchoalveolar lavage fluid data. Lineage tree represents the members of the clonotype from the patient it was present in. Each node represents a unique sequence within the clonotype lineage tree, with the size indicative of the number of duplicate sequences present. Numbers on the edges of adjoining nodes show the number of mutations between the sequences.

[0062] FIG. 9B. Lineage tree of the convergent clonotype that matched to the bronchoalveolar lavage fluid data. Lineage tree represents the members of the clonotype from the patient it was present in. Each node represents a unique sequence within the clonotype lineage tree, with the size indicative of the number of duplicate sequences present. Numbers on the edges of adjoining nodes show the number of mutations between the sequences.

[0063] FIG. 9C. Lineage tree of the convergent clonotype that matched to the bronchoalveolar lavage fluid data. Lineage tree represents the members of the clonotype from the patient it was present in. Each node represents a unique sequence within the clonotype lineage tree, with the size indicative of the number of duplicate sequences present. Numbers on the edges of adjoining nodes show the number of mutations between the sequences.

[0064] FIG. 9D. Lineage tree of the convergent clonotype that matched to the bronchoalveolar lavage fluid data. Lineage tree represents the members of the clonotype from the patient it was present in. Each node represents a unique sequence within the clonotype lineage tree, with the size indicative of the number of duplicate sequences present. Numbers on the edges of adjoining nodes show the number of mutations between the sequences.

[0065] FIG. 9E. Lineage tree of the convergent clonotype that matched to the bronchoalveolar lavage fluid data. Lineage tree represents the members of the clonotype from the patient it was present in. Each node represents a unique sequence within the clonotype lineage tree, with the size indicative of the number of duplicate sequences present. Numbers on the edges of adjoining nodes show the number of mutations between the sequences.

[0066] FIG. 9F. Lineage tree of the convergent clonotype that matched to the bronchoalveolar lavage fluid data. Lineage tree represents the members of the clonotype from the patient it was present in. Each node represents a unique sequence within the clonotype lineage tree, with the size indicative of the number of duplicate sequences present. Numbers on the edges of adjoining nodes show the number of mutations between the sequences.

[0067] FIG. 9G. Lineage tree of the convergent clonotype that matched to the bronchoalveolar lavage fluid data. Lineage tree represents the members of the clonotype from the patient it was present in. Each node represents a unique sequence within the clonotype lineage tree, with the size indicative of the number of duplicate sequences present. Numbers on the edges of adjoining nodes show the number of mutations between the sequences.

[0068] FIG. 9H. Lineage tree of the convergent clonotype that matched to the bronchoalveolar lavage fluid data. Lineage tree represents the members of the clonotype from the patient it was present in. Each node represents a unique sequence within the clonotype lineage tree, with the size indicative of the number of duplicate sequences present. Numbers on the edges of adjoining nodes show the number of mutations between the sequences.

[0069] FIG. 10. Logo plots unpacking the sequence diversity present for the convergent clonotypes that clustered with CoV-AbDab SARS-CoV-1 or SARS-CoV-2 binding antibodies. The CoV-AbDab reference CDRH3 (corresponding to SEQ ID NOS 2015-2020, respectively, in order of appearance) and IGHV/IGHJ gene segment is displayed above each Logo plot. Gene transcript matches are annotated with “*,” while mismatches are annotated with “**.” The full sequence for 31B9 is not yet publicly available, so its genetic origins are not determined (ND).

DETAILED DESCRIPTION

[0070] The complementarity determining regions (CDRs) and framework regions (FWRs) of an antibody or fragment thereof may be numbered from N- to C-terminus, i.e. FWR1, CDR1, FWR2, CDR2, FWR3, CDR3 and FWR4. In the context of a heavy chain variable domain, these regions may be denoted with an ‘H’, i.e. FWRH1, CDRH1, FWRH2, CDRH2, FWRH3, CDRH3 and FWRH4.

[0071] Table 1 below provides the polypeptide sequences of immunoglobulin heavy chain variable domains of the invention (VHs) with complementarity determining regions (CDRH1-3) and frameworks (FWRH1-4) of the invention annotated according to the IMGT system (Lefranc et al. “IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains” Dev. Comp. Immunol. 27(1):55-77 (2003)). The full length polypeptide sequence of any VH given in Table 1 is the combination of, from N- to C-terminus, FWRH1, CDRH1, FWRH2, CDRH2, FWRH3, CDRH3 and FWRH4 on a single row. For example, the polypeptide sequence of set1_1 is QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDG SNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDAVYYCARDGGGYMDVWGQG TTVTVSS (SEQ ID NO: 1). “v_call” and “j_call” refer to the germline V and J gene segments from which the sequence originated, according to the IMGT system.

[0072] Table 2 below also provides the polypeptide sequences of immunoglobulin heavy chain variable domains (VHs) of the invention.

[0073] Based on the experimental work provided herein, it is expected that components of these VHs, such as the complementarity determining regions, frameworks, or combinations of these (such as full length VH sequences) may be utilised in therapeutic or prophylactic agents for treating or preventing SARS-CoV-2 infection, or for performing diagnostic or prognostic analysis of subjects infected, or suspected of being infected, with SARS-CoV-2.

[0074] It is envisaged that the proposed heavy chains be paired with suitable light chains to enable production of monoclonal antibodies, for example in IgG1 format. Cognate light chains can be identified by various methods, including computational prediction (eg Mason et al bioRxiv 617860 (2019)), the use of promiscuous or ‘common light chains’ (eg Xue et al. Biochem Biophys Res Commun. 515(3):481-486, (2019)), high-throughput paired heavy and light chain sequencing to identify native pairings (eg Wang et al Nat Biotechnol. 36(2):152-155 (2018)) and antibody display-based methods to find and optimise heavy and light chain pairings (eg Guo-Qiang et al. Methods Mol Biol. 562:133-142 2009).

TABLE-US-00001 TABLE 1 Polypeptide sequences of immunoglobulin heavy chain variable domains (VHs), from N-to C-terminus, with frameworks and complementarity determining regions annotated according to the IMGT system FWRH1 CDRH1 FWRH2 CDRH2 FWRH3 CDRH3 FWRH4 VH (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID name v_call j_call NO) NO) NO) NO) NO) NO) NO) set1_1 IGHV3- IGHJ6 2 38 135 216 304 416 1196 30-3 set1_2 IGHV3- IGHJ4 2 39 135 216 304 417 1197 30 set1_3 IGHV4- IGHJ5 3 40 136 217 305 418 1197 59 set1_4 IGHV3- IGHJ4 2 39 135 218 304 419 1197 33 set1_5 IGHV1- IGHJ3 4 41 137 219 306 420 1197 69 set2_1 IGHV3- IGHJ6 5 42 138 220 307 421 1196 73 set2_2 IGHV3- IGHJ4 6 43 139 221 308 422 1197 74 set2_3 IGHV3- IGHJ4 5 42 138 220 307 423 1197 73 set2_4 IGHV3- IGHJ3 5 42 138 220 307 424 1198 73 set2_5 IGHV3- IGHJ4 7 44 140 222 309 425 1197 15 set2_6 IGHV3- IGHJ4 2 45 141 223 310 426 1197 30 set2_7 IGHV4- IGHJ4 8 46 142 224 311 427 1199 61 set2_8 IGHV4- IGHJ4 9 47 143 225 312 428 1197 59 set2_9 IGHV3- IGHJ4 7 48 140 226 313 429 1197 15 set2_10 IGHV4- IGHJ4 10 47 144 225 314 430 1197 59 set2_11 IGHV4- IGHJ4 11 49 145 227 315 431 1197 39 set2_12 IGHV3- IGHJ4 12 50 146 228 304 432 1197 23 set2_13 IGHV5- IGHJ4 13 51 147 229 316 433 1197 51 set2_14 IGHV3- IGHJ6 7 44 140 222 309 434 1200 15 set2_15 IGHV1- IGHJ4 14 52 148 230 317 435 1197 2 set2_16 IGHV4- IGHJ5 15 53 149 231 318 436 1197 34 set2_17 IGHV4- IGHJ4 15 54 150 231 319 437 1201 34 set2_18 IGHV4- IGHJ4 9 47 143 225 320 438 1197 59 set2_19 IGHV4- IGHJ4 9 47 143 225 312 439 1197 59 set2_20 IGHV4- IGHJ4 16 55 151 232 321 440 1197 4 set2_21 IGHV1- IGHJ4 14 56 152 233 322 441 1202 18 set2_22 IGHV1- IGHJ5 14 57 153 234 323 442 1197 8 set2_23 IGHV3- IGHJ4 5 42 138 220 307 443 1197 73 set2_24 IGHV4- IGHJ5 16 55 151 232 321 444 1197 4 set2_25 IGHV3- IGHJ4 2 39 135 218 304 445 1197 33 set2_26 IGHV3- IGHJ4 6 58 154 235 324 446 1197 48 set2_27 IGHV3- IGHJ4 6 59 155 236 304 447 1197 66 set2_28 IGHV3- IGHJ5 6 60 156 237 325 448 1197 74 set2_29 IGHV5- IGHJ4 17 61 157 229 326 449 1197 51 set2_30 IGHV3- IGHJ6 2 39 135 218 304 450 1196 33 set2_31 IGHV3- IGHJ4 18 62 158 238 327 451 1197 9 set2_32 IGHV5- IGHJ3 17 63 157 239 328 452 1198 51 set2_33 IGHV3- IGHJ4 2 38 135 216 304 453 1197 30 set2_34 IGHV3- IGHJ4 19 64 159 240 329 454 1197 74 set2_35 IGHV3- IGHJ4 20 65 160 241 330 455 1197 11 set2_36 IGHV3- IGHJ4 6 59 155 236 304 456 1197 66 set2_37 IGHV5- IGHJ3 17 61 157 229 326 457 1198 51 set2_38 IGHV3- IGHJ4 2 39 135 218 304 458 1197 33 set2_39 IGHV3- IGHJ4 2 38 135 216 304 459 1197 30 set2_40 IGHV3- IGHJ4 2 38 135 216 304 460 1197 30 set2_41 IGHV3- IGHJ4 2 38 135 216 304 461 1197 30 set2_42 IGHV3- IGHJ5 2 38 135 216 304 462 1197 30 set2_43 IGHV3- IGHJ2 2 39 135 218 304 463 1203 33 set2_44 IGHV3- IGHJ4 2 38 135 216 304 464 1197 30 set2_45 IGHV3- IGHJ4 2 39 135 218 304 465 1197 33 set2_46 IGHV3- IGHJ6 2 38 135 216 304 466 1196 30-3 set2_47 IGHV3- IGHJ3 2 38 135 216 304 467 1198 30-3 set2_48 IGHV3- IGHJ4 21 59 155 236 304 468 1197 66 set2_49 IGHV3- IGHJ4 2 39 135 218 304 469 1197 33 set2_50 IGHV3- IGHJ4 2 38 135 216 304 470 1197 30 set2_51 IGHV4- IGHJ4 15 66 161 242 312 471 1197 34 set2_52 IGHV3- IGHJ3 2 38 135 216 304 472 1198 30 set2_53 IGHV3- IGHJ5 2 38 135 216 304 473 1197 30 set2_54 IGHV4- IGHJ4 22 67 143 232 331 474 1197 30-2 set2_55 IGHV3- IGHJ4 2 38 135 216 304 475 1197 30 set2_56 IGHV3- IGHJ4 2 39 135 218 304 476 1197 33 set2_57 IGHV3- IGHJ4 2 39 135 218 304 477 1197 33 set2_58 IGHV3- IGHJ6 2 68 162 243 332 478 1204 30 set2_59 IGHV3- IGHJ6 2 39 135 216 304 479 1196 30 set2_60 IGHV3- IGHJ4 21 59 155 236 304 480 1197 53 set2_61 IGHV3- IGHJ2 2 38 135 216 304 481 1203 30 set2_62 IGHV3- IGHJ4 2 39 135 216 304 482 1197 30 set2_63 IGHV1- IGHJ3 23 69 163 244 333 483 1205 18 set2_64 IGHV3- IGHJ4 6 58 154 235 324 484 1197 48 set2_65 IGHV1- IGHJ4 14 70 164 245 334 485 1197 18 set2_66 IGHV3- IGHJ4 2 38 135 216 304 486 1197 30 set2_67 IGHV3- IGHJ5 2 38 135 216 304 487 1197 30 set2_68 IGHV3- IGHJ4 2 38 135 216 304 488 1197 30 set2_69 IGHV1- IGHJ4 4 71 165 246 335 489 1197 69 set2_70 IGHV3- IGHJ4 2 39 135 216 304 490 1197 30 set2_71 IGHV3- IGHJ4 2 38 135 216 304 491 1197 30 set2_72 IGHV3- IGHJ4 2 38 135 216 304 492 1197 30 set2_73 IGHV3- IGHJ3 2 38 135 216 304 493 1198 30-3 set2_74 IGHV3- IGHJ4 2 38 135 216 304 494 1197 30 set2_75 IGHV3- IGHJ4 6 58 154 235 324 495 1197 48 set2_76 IGHV3- IGHJ4 2 39 135 216 304 496 1197 30 set2_77 IGHV3- IGHJ4 2 39 135 216 304 497 1197 30 set2_78 IGHV3- IGHJ4 2 39 135 216 304 498 1197 30 set2_79 IGHV3- IGHJ4 2 38 135 216 304 499 1197 30-3 set2_80 IGHV3- IGHJ6 2 38 135 216 304 500 1196 30 set2_81 IGHV3- IGHJ6 2 39 135 218 304 501 1206 33 set2_82 IGHV3- IGHJ4 2 38 135 216 304 502 1197 30-3 set2_83 IGHV3- IGHJ3 2 38 135 216 304 503 1198 30 set2_84 IGHV2- IGHJ4 24 72 166 247 336 504 1197 5 set2_85 IGHV3- IGHJ4 2 73 135 248 337 505 1207 30 set2_86 IGHV3- IGHJ5 6 59 155 236 338 506 1197 53 set2_87 IGHV3- IGHJ6 2 38 135 216 304 507 1196 30-3 set2_88 IGHV2- IGHJ4 25 74 167 249 339 508 1197 70 set2_89 IGHV2- IGHJ4 24 72 166 247 336 509 1197 5 set2_90 IGHV3- IGHJ6 2 39 135 218 304 510 1196 33 set2_91 IGHV3- IGHJ4 2 75 168 250 340 511 1197 33 set2_92 IGHV3- IGHJ4 7 58 169 251 341 512 1197 21 set2_93 IGHV3- IGHJ6 2 39 135 216 304 513 1196 30 set2_94 IGHV1- IGHJ4 14 76 170 252 342 514 1197 46 set2_95 IGHV4- IGHJ6 15 66 161 242 312 515 1196 34 set2_96 IGHV2- IGHJ4 25 74 167 249 339 516 1197 70 set2_97 IGHV3- IGHJ4 6 43 171 253 343 517 1197 7 set2_98 IGHV1- IGHJ5 14 70 164 245 334 518 1197 18 set2_99 IGHV3- IGHJ4 26 77 172 216 344 519 1197 30-3 set2_100 IGHV3- IGHJ6 21 59 173 236 304 520 1208 53 set2_101 IGHV4- IGHJ6 11 78 174 225 345 521 1196 39 set2_102 IGHV3- IGHJ3 21 59 155 236 304 522 1198 53 set2_103 IGHV4- IGHJ6 15 66 161 242 312 523 1196 34 set2_104 IGHV3- IGHJ4 12 38 146 254 304 524 1197 23 set2_105 IGHV3- IGHJ4 2 38 135 216 304 525 1197 30 set2_106 IGHV1- IGHJ3 14 70 164 245 334 526 1198 18 set2_107 IGHV4- IGHJ6 16 79 151 255 346 527 1209 4 set2_108 IGHV4- IGHJ4 15 66 161 242 312 528 1197 34 set2_109 IGHV4- IGHJ4 9 47 175 256 347 529 1197 4 set2_110 IGHV3- IGHJ5 6 80 171 253 348 530 1197 7 set2_111 IGHV2- IGHJ4 25 74 167 249 339 531 1197 70 set2_112 IGHV2- IGHJ5 24 72 166 247 336 532 1197 5 set2_113 IGHV2- IGHJ5 27 81 166 247 349 533 1197 5 set2_114 IGHV3- IGHJ6 2 39 135 218 304 534 1196 33 set2_115 IGHV5- IGHJ6 17 61 157 229 326 535 1196 51 set2_116 IGHV3- IGHJ4 2 38 135 216 304 536 1197 30-3 set2_117 IGHV3- IGHJ4 2 82 176 257 350 537 1202 30 set2_118 IGHV3- IGHJ4 2 38 135 216 304 538 1197 30 set2_119 IGHV3- IGHJ3 2 38 135 216 304 539 1198 30 set2_120 IGHV3- IGHJ4 2 83 135 216 304 540 1197 30 set2_121 IGHV3- IGHJ6 2 39 135 218 304 541 1196 33 set2_122 IGHV1- IGHJ4 14 84 148 230 351 542 1197 2 set2_123 IGHV5- IGHJ4 17 61 157 229 326 543 1197 51 set2_124 IGHV3- IGHJ4 7 85 169 251 341 544 1197 21 set2_125 IGHV3- IGHJ4 2 38 135 216 304 545 1197 30 set2_126 IGHV2- IGHJ4 24 72 166 247 336 546 1197 5 set2_127 IGHV4- IGHJ4 9 47 143 225 312 547 1197 59 set2_128 IGHV3- IGHJ4 2 86 177 216 352 548 1197 30-3 set2_129 IGHV3- IGHJ3 2 38 135 216 304 549 1198 30 set2_130 IGHV2- IGHJ3 24 72 166 247 336 550 1198 5 set2_131 IGHV3- IGHJ4 2 87 135 258 353 551 1197 33 set2_132 IGHV3- IGHJ4 2 39 135 216 304 552 1197 30 set2_133 IGHV3- IGHJ4 2 39 135 216 304 553 1197 30 set2_134 IGHV3- IGHJ3 2 39 135 218 304 554 1198 33 set2_135 IGHV3- IGHJ4 2 39 135 218 304 555 1197 33 set2_136 IGHV3- IGHJ3 2 38 135 216 304 556 1198 30 set2_137 IGHV2- IGHJ4 25 74 167 249 339 557 1197 70 set2_138 IGHV3- IGHJ4 2 39 135 218 354 558 1197 33 set2_139 IGHV3- IGHJ6 2 39 135 259 304 559 1196 30 set2_140 IGHV4- IGHJ4 11 88 145 225 355 560 1197 39 set2_141 IGHV4- IGHJ4 15 66 161 242 312 561 1197 34 set2_142 IGHV3- IGHJ6 2 39 135 218 304 562 1196 33 set2_143 IGHV3- IGHJ4 2 38 135 216 304 563 1197 30 set2_144 IGHV3- IGHJ4 2 38 135 216 304 564 1197 30-3 set2_145 IGHV3- IGHJ4 2 39 135 218 304 565 1197 33 set2_146 IGHV3- IGHJ6 2 38 135 216 304 566 1196 30-3 set2_147 IGHV2- IGHJ4 24 72 166 247 336 567 1197 5 set2_148 IGHV3- IGHJ4 2 38 135 216 304 568 1197 30-3 set2_149 IGHV3- IGHJ6 2 39 135 218 304 569 1196 33 set2_150 IGHV4- IGHJ4 9 47 143 225 312 570 1197 59 set2_151 IGHV3- IGHJ6 2 38 135 216 304 571 1200 30 set2_152 IGHV3- IGHJ6 2 38 135 216 304 572 1196 30-3 set2_153 IGHV3- IGHJ4 2 39 135 216 304 573 1197 30 set2_154 IGHV3- IGHJ4 28 89 178 260 356 574 1197 49 set2_155 IGHV3- IGHJ6 2 39 135 218 304 575 1196 33 set2_156 IGHV3- IGHJ6 2 38 135 216 304 576 1196 30 set2_157 IGHV3- IGHJ4 2 39 135 218 304 577 1197 33 set2_158 IGHV3- IGHJ4 12 38 146 254 304 578 1197 23 set2_159 IGHV3- IGHJ4 6 43 171 253 343 579 1197 7 set2_160 IGHV1- IGHJ4 4 90 179 261 357 580 1197 69 set2_161 IGHV3- IGHJ3 2 91 135 216 304 581 1198 30 set2_162 IGHV4- IGHJ4 15 66 161 242 312 582 1197 34 set2_163 IGHV2- IGHJ4 25 74 167 249 339 583 1197 70 set2_164 IGHV3- IGHJ4 2 39 135 218 304 584 1197 33 set2_165 IGHV4- IGHJ6 15 66 161 242 312 585 1196 34 set2_166 IGHV3- IGHJ4 2 39 135 216 304 586 1197 30 set2_167 IGHV3- IGHJ3 2 39 135 218 304 587 1198 33 set2_168 IGHV3- IGHJ4 2 39 135 218 304 588 1197 33 set2_169 IGHV1- IGHJ4 14 84 148 230 351 589 1197 2 set2_170 IGHV3- IGHJ6 2 39 135 218 304 590 1196 33 set2_171 IGHV3- IGHJ4 2 39 135 216 304 591 1197 30 set2_172 IGHV3- IGHJ6 2 38 135 216 304 592 1196 30 set2_173 IGHV3- IGHJ3 2 39 135 218 304 593 1198 33 set2_174 IGHV3- IGHJ4 18 92 180 262 358 594 1210 9 set2_175 IGHV3- IGHJ4 2 39 135 218 304 595 1197 33 set2_176 IGHV3- IGHJ4 2 38 135 216 304 596 1197 30 set2_177 IGHV3- IGHJ6 2 39 135 218 304 597 1196 33 set2_178 IGHV3- IGHJ3 7 58 169 251 341 598 1198 21 set2_179 IGHV3- IGHJ3 2 93 181 263 359 599 1211 30-3 set2_180 IGHV2- IGHJ3 25 74 167 249 339 600 1198 70 set2_181 IGHV3- IGHJ4 2 39 135 216 304 601 1197 30 set2_182 IGHV3- IGHJ4 2 38 135 216 304 602 1197 30 set2_183 IGHV3- IGHJ4 2 38 135 216 304 603 1197 30-3 set2_184 IGHV3- IGHJ4 2 39 135 218 304 604 1197 33 set2_185 IGHV1- IGHJ4 14 70 164 245 334 605 1197 18 set2_186 IGHV3- IGHJ3 2 38 135 216 304 606 1198 30-3 set2_187 IGHV4- IGHJ4 9 47 143 225 312 607 1197 59 set2_188 IGHV2- IGHJ2 29 94 182 264 360 608 1203 26 set2_189 IGHV3- IGHJ4 18 92 158 238 361 609 1197 9 set2_190 IGHV3- IGHJ6 2 39 135 216 304 610 1196 30 set2_191 IGHV5- IGHJ6 17 61 157 229 326 611 1196 51 set2_192 IGHV3- IGHJ4 2 39 135 216 304 612 1197 30 set2_193 IGHV3- IGHJ4 12 38 146 254 304 613 1197 23 set2_194 IGHV1- IGHJ4 14 70 164 245 334 614 1197 18 set2_195 IGHV1- IGHJ6 14 70 164 245 334 615 1196 18 set2_196 IGHV3- IGHJ6 2 39 135 218 304 616 1196 33 set2_197 IGHV3- IGHJ4 2 95 135 265 304 617 1197 30-3 set2_198 IGHV3- IGHJ6 2 39 135 216 304 618 1196 30 set2_199 IGHV2- IGHJ4 25 74 167 249 339 619 1197 70 set2_200 IGHV3- IGHJ6 2 39 135 218 304 620 1196 33 set2_201 IGHV3- IGHJ4 2 38 135 216 304 621 1197 30 set2_202 IGHV3- IGHJ4 2 39 135 218 304 622 1197 33 set2_203 IGHV3- IGHJ6 2 39 135 216 304 623 1196 30 set2_204 IGHV3- IGHJ6 12 96 183 266 362 569 1196 23 set2_205 IGHV3- IGHJ6 2 39 135 218 304 624 1196 33 set2_206 IGHV3- IGHJ6 2 39 135 216 304 625 1196 30 set2_207 IGHV3- IGHJ3 2 39 135 218 304 626 1198 33 set2_208 IGHV3- IGHJ4 2 97 135 216 304 627 1197 30-3 set2_209 IGHV5- IGHJ4 17 61 157 229 326 628 1197 51 set2_210 IGHV2- IGHJ4 25 74 167 249 339 629 1197 70 set2_211 IGHV3- IGHJ4 2 38 135 216 304 630 1197 30 set2_212 IGHV3- IGHJ4 2 39 135 218 304 631 1197 33 set2_213 IGHV3- IGHJ4 2 39 135 218 304 632 1197 33 set2_214 IGHV3- IGHJ6 2 39 135 216 304 633 1196 30 set2_215 IGHV3- IGHJ4 2 39 135 218 304 634 1197 33 set2_216 IGHV3- IGHJ4 2 39 135 218 304 635 1197 33 set2_217 IGHV3- IGHJ4 2 39 135 218 304 636 1197 33 set2_218 IGHV5- IGHJ4 17 61 157 229 326 637 1197 51 set2_219 IGHV2- IGHJ6 24 72 166 247 363 638 1196 5 set2_220 IGHV1- IGHJ5 30 98 184 267 364 639 1197 24 set2_221 IGHV3- IGHJ6 2 39 135 218 304 640 1200 33 set2_222 IGHV4- IGHJ6 15 66 161 242 312 641 1200 34 set2_223 IGHV3- IGHJ4 2 38 135 216 304 642 1197 30 set2_224 IGHV3- IGHJ6 2 39 135 218 304 643 1196 33 set2_225 IGHV3- IGHJ6 2 99 135 268 365 644 1212 33 set2_226 IGHV3- IGHJ4 6 43 171 253 343 645 1197 7 set2_227 IGHV4- IGHJ4 9 47 143 269 366 646 1213 59 set2_228 IGHV3- IGHJ4 18 92 158 238 361 647 1197 9 set2_229 IGHV3- IGHJ4 2 38 135 216 304 648 1197 30 set2_230 IGHV2- IGHJ6 24 72 166 247 336 649 1196 5 set2_231 IGHV3- IGHJ4 2 39 135 218 304 650 1197 33 set2_232 IGHV3- IGHJ6 2 39 135 218 304 651 1200 33 set2_233 IGHV3- IGHJ4 2 38 135 216 304 652 1197 30 set2_234 IGHV3- IGHJ3 2 38 135 216 304 653 1198 30 set2_235 IGHV3- IGHJ6 2 38 135 216 304 654 1196 30 set2_236 IGHV1- IGHJ3 31 100 185 270 367 655 1198 58 set2_237 IGHV3- IGHJ4 2 38 135 216 304 656 1197 30 set2_238 IGHV3- IGHJ4 7 58 169 251 368 657 1197 21 set2_239 IGHV3- IGHJ4 6 43 171 253 343 658 1213 7 set2_240 IGHV3- IGHJ6 2 38 135 216 304 659 1196 30 set2_241 IGHV3- IGHJ4 2 38 135 216 304 660 1197 30 set2_242 IGHV3- IGHJ6 2 38 135 216 304 661 1196 30 set2_243 IGHV3- IGHJ4 2 39 135 218 304 662 1197 33 set2_244 IGHV3- IGHJ6 2 38 135 216 304 663 1200 30 set2_245 IGHV3- IGHJ6 2 38 135 216 304 664 1196 30 set2_246 IGHV3- IGHJ4 12 38 146 254 304 665 1197 23 set2_247 IGHV1- IGHJ4 14 70 164 245 334 666 1197 18 set2_248 IGHV3- IGHJ4 2 38 135 216 304 667 1197 30 set2_249 IGHV3- IGHJ3 2 101 135 216 369 668 1198 30 set2_250 IGHV3- IGHJ6 2 102 135 271 370 669 1196 33 set2_251 IGHV3- IGHJ4 6 43 171 253 343 670 1197 7 set2_252 IGHV3- IGHJ5 2 38 135 216 304 671 1197 30-3 set2_253 IGHV3- IGHJ4 2 39 135 216 304 672 1197 30 set2_254 IGHV3- IGHJ4 2 39 135 218 304 673 1197 33 set2_255 IGHV3- IGHJ4 6 43 139 221 308 674 1197 74 set2_256 IGHV3- IGHJ4 2 39 135 218 304 675 1197 33 set2_257 IGHV3- IGHJ4 2 39 135 218 304 676 1197 33 set2_258 IGHV3- IGHJ6 20 65 186 272 341 677 1200 11 set2_259 IGHV3- IGHJ4 2 39 135 218 304 678 1197 33 set2_260 IGHV3- IGHJ5 2 39 135 218 304 679 1197 33 set2_261 IGHV3- IGHJ4 2 39 135 218 304 680 1197 33 set2_262 IGHV3- IGHJ5 2 38 135 216 304 681 1197 30 set2_263 IGHV3- IGHJ6 2 38 135 216 304 682 1196 30-3 set2_264 IGHV2- IGHJ4 25 74 167 249 339 683 1197 70 set2_265 IGHV3- IGHJ4 6 43 139 221 308 684 1197 74 set2_266 IGHV2- IGHJ4 24 72 166 247 336 685 1197 5 set2_267 IGHV3- IGHJ4 2 38 135 216 304 686 1197 30 set2_268 IGHV3- IGHJ4 2 39 135 216 304 687 1197 30 set2_269 IGHV3- IGHJ4 2 39 135 216 304 688 1197 30 set2_270 IGHV3- IGHJ4 6 43 139 221 308 689 1197 74 set2_271 IGHV5- IGHJ4 17 61 157 229 326 690 1197 51 set2_272 IGHV3- IGHJ5 2 38 135 216 304 671 1197 30 set2_273 IGHV3- IGHJ4 2 39 135 218 304 691 1197 33 set2_274 IGHV3- IGHJ4 2 38 135 216 304 692 1197 30-3 set2_275 IGHV3- IGHJ4 2 39 135 216 304 693 1197 30 set2_276 IGHV4- IGHJ4 15 66 161 242 312 694 1197 34 set2_277 IGHV3- IGHJ4 2 38 135 216 304 695 1197 30 set2_278 IGHV3- IGHJ5 2 38 135 216 304 696 1214 30 set2_279 IGHV3- IGHJ3 2 38 135 216 304 697 1198 30 set2_280 IGHV3- IGHJ4 2 39 135 218 304 698 1197 33 set2_281 IGHV3- IGHJ4 2 39 135 218 304 699 1197 33 set2_282 IGHV3- IGHJ4 2 38 135 216 304 700 1197 30 set2_283 IGHV3- IGHJ4 12 38 146 254 304 701 1197 23 set2_284 IGHV3- IGHJ4 2 38 135 216 304 702 1197 30 set2_285 IGHV3- IGHJ4 2 39 135 218 304 703 1197 33 set2_286 IGHV3- IGHJ4 2 38 135 216 304 704 1197 30 set2_287 IGHV3- IGHJ6 2 39 135 218 304 705 1200 33 set2_288 IGHV3- IGHJ4 6 43 139 221 308 706 1197 74 set2_289 IGHV3- IGHJ6 2 39 135 218 304 707 1196 33 set2_290 IGHV3- IGHJ6 2 39 135 218 304 708 1196 33 set2_291 IGHV3- IGHJ4 2 38 187 216 304 709 1197 30-3 set2_292 IGHV2- IGHJ4 25 74 167 249 339 710 1197 70 set2_293 IGHV3- IGHJ6 7 58 169 251 341 711 1196 21 set2_294 IGHV3- IGHJ4 2 39 135 273 371 712 1197 33 set2_295 IGHV3- IGHJ4 28 103 178 260 356 713 1215 49 set2_296 IGHV3- IGHJ6 2 38 135 216 372 714 1196 30-3 set2_297 IGHV5- IGHJ4 17 61 157 229 326 715 1197 51 set2_298 IGHV3- IGHJ4 2 38 135 216 304 716 1197 30 set2_299 IGHV3- IGHJ5 2 101 135 274 373 717 1203 30 set2_300 IGHV3- IGHJ4 2 38 135 216 304 718 1197 30 set2_301 IGHV3- IGHJ4 2 38 135 216 304 719 1197 30 set2_302 IGHV3- IGHJ3 2 38 135 216 304 720 1198 30 set2_303 IGHV3- IGHJ4 2 38 135 216 304 721 1197 30 set2_304 IGHV3- IGHJ3 2 38 135 216 304 722 1198 30-3 set2_305 IGHV3- IGHJ6 2 38 135 216 304 723 1196 30 set2_306 IGHV3- IGHJ6 2 38 188 275 374 724 1196 30 set2_307 IGHV3- IGHJ3 2 38 135 216 304 725 1198 30 set2_308 IGHV3- IGHJ4 2 38 135 216 304 726 1197 30 set2_309 IGHV1- IGHJ5 30 98 184 267 364 727 1197 24 set2_310 IGHV3- IGHJ5 2 38 135 216 304 728 1197 30 set2_311 IGHV1- IGHJ5 30 98 184 267 364 729 1197 24 set2_312 IGHV3- IGHJ4 2 38 135 216 304 730 1197 30 set2_313 IGHV3- IGHJ6 2 104 141 276 375 731 1196 30-3 set2_314 IGHV2- IGHJ4 24 72 166 247 336 732 1197 5 set2_315 IGHV3- IGHJ3 2 38 135 216 304 733 1198 30-3 set2_316 IGHV3- IGHJ6 7 58 169 251 341 734 1196 21 set2_317 IGHV3- IGHJ3 2 38 135 216 304 735 1198 30-3 set2_318 IGHV3- IGHJ3 2 38 135 216 304 736 1198 30 set2_319 IGHV3- IGHJ4 2 38 135 216 304 737 1197 30 set2_320 IGHV1- IGHJ5 30 98 184 267 364 738 1197 24 set2_321 IGHV3- IGHJ5 2 38 135 216 304 739 1197 30 set2_322 IGHV3- IGHJ4 2 38 135 216 304 740 1197 30-3 set2_323 IGHV3- IGHJ3 2 38 135 216 304 741 1198 30 set2_324 IGHV3- IGHJ5 2 38 135 216 304 742 1197 30-3 set2_325 IGHV3- IGHJ6 2 38 135 216 304 743 1196 30-3 set2_326 IGHV3- IGHJ6 2 38 135 216 304 744 1196 30 set2_327 IGHV3- IGHJ4 2 38 135 216 304 745 1197 30 set2_328 IGHV1- IGHJ5 30 98 184 267 364 746 1197 24 set2_329 IGHV3- IGHJ4 2 39 135 216 304 747 1197 30 set2_330 IGHV3- IGHJ4 2 38 135 216 304 748 1197 30 set2_331 IGHV3- IGHJ4 6 43 171 253 343 749 1197 7 set2_332 IGHV3- IGHJ4 2 38 135 216 304 750 1197 30-3 set2_333 IGHV3- IGHJ4 2 38 135 216 304 751 1197 30 set2_334 IGHV3- IGHJ4 2 38 135 216 304 752 1197 30 set2_335 IGHV3- IGHJ6 2 38 135 216 304 753 1196 30-3 set2_336 IGHV1- IGHJ5 30 98 184 267 364 754 1197 24 set2_337 IGHV3- IGHJ5 2 38 135 216 304 755 1197 30 set2_338 IGHV3- IGHJ4 2 38 135 216 304 756 1197 30 set2_339 IGHV3- IGHJ4 6 43 171 253 343 757 1197 7 set2_340 IGHV3- IGHJ4 2 38 189 216 376 758 1197 30 set2_341 IGHV3- IGHJ4 2 38 135 216 304 759 1197 30 set2_342 IGHV3- IGHJ4 7 58 169 251 341 760 1197 21 set2_343 IGHV3- IGHJ6 2 39 135 218 304 761 1196 33 set2_344 IGHV3- IGHJ4 2 38 135 216 304 762 1197 30-3 set2_345 IGHV3- IGHJ5 2 38 135 216 304 763 1197 30-3 set2_346 IGHV4- IGHJ6 9 47 143 225 312 764 1200 59 set2_347 IGHV1- IGHJ5 30 98 184 267 364 765 1197 24 set2_348 IGHV3- IGHJ4 2 38 135 216 304 766 1197 30 set2_349 IGHV3- IGHJ6 2 101 135 216 304 767 1196 30-3 set2_350 IGHV1- IGHJ5 30 98 184 267 364 768 1197 24 set2_351 IGHV3- IGHJ3 2 38 135 216 304 769 1198 30 set2_352 IGHV3- IGHJ6 2 105 141 216 377 770 1196 30 set2_353 IGHV3- IGHJ4 2 39 135 218 304 771 1197 33 set2_354 IGHV1- IGHJ5 30 98 184 267 364 772 1197 24 set2_355 IGHV1- IGHJ5 30 98 184 267 364 773 1197 24 set2_356 IGHV3- IGHJ4 6 106 190 277 378 774 1197 13 set2_357 IGHV3- IGHJ4 2 38 135 278 379 775 1197 30 set2_358 IGHV3- IGHJ4 32 107 191 279 380 776 1197 30 set2_359 IGHV3- IGHJ3 2 38 135 216 304 777 1198 30-3 set2_360 IGHV3- IGHJ3 2 39 135 216 304 778 1198 30 set2_361 IGHV3- IGHJ4 2 38 135 216 304 779 1197 30 set2_362 IGHV1- IGHJ5 30 98 184 267 364 780 1197 24 set2_363 IGHV1- IGHJ5 30 98 184 267 364 781 1197 24 set2_364 IGHV1- IGHJ5 30 98 184 267 364 782 1197 24 set2_365 IGHV1- IGHJ5 30 98 184 267 364 783 1197 24 set2_366 IGHV3- IGHJ4 2 38 135 216 304 784 1197 30-3 set2_367 IGHV3- IGHJ4 2 38 135 216 304 785 1197 30-3 set2_368 IGHV3- IGHJ4 2 39 135 216 304 786 1197 30 set2_369 IGHV2- IGHJ4 25 74 167 249 339 787 1197 70 set2_370 IGHV3- IGHJ3 2 39 135 216 304 788 1198 30 set2_371 IGHV3- IGHJ4 2 38 135 216 304 789 1197 30 set2_372 IGHV3- IGHJ5 2 38 135 216 304 790 1197 30-3 set2_373 IGHV3- IGHJ4 2 38 135 216 304 791 1197 30 set2_374 IGHV3- IGHJ3 2 101 135 216 381 792 1198 30 set2_375 IGHV3- IGHJ2 6 106 190 280 378 793 1203 13 set2_376 IGHV3- IGHJ6 2 39 135 218 304 794 1196 33 set2_377 IGHV3- IGHJ4 2 39 135 216 304 795 1197 30 set2_378 IGHV3- IGHJ4 2 38 135 216 304 796 1197 30 set2_379 IGHV3- IGHJ6 6 43 171 253 343 797 1196 7 set2_380 IGHV3- IGHJ3 2 38 135 216 304 798 1198 30 set2_381 IGHV3- IGHJ4 2 38 135 216 304 799 1197 30 set2_382 IGHV3- IGHJ4 2 38 135 216 304 800 1197 30 set2_383 IGHV3- IGHJ4 2 38 135 216 304 801 1197 30-3 set2_384 IGHV3- IGHJ4 2 38 135 216 304 802 1197 30 set2_385 IGHV3- IGHJ4 2 38 135 216 304 803 1197 30 set2_386 IGHV1- IGHJ4 30 98 184 267 364 804 1197 24 set2_387 IGHV3- IGHJ6 2 38 135 216 304 805 1196 30 set2_388 IGHV1- IGHJ4 30 98 184 267 364 806 1197 24 set2_389 IGHV3- IGHJ4 2 38 135 216 304 807 1197 30 set2_390 IGHV3- IGHJ5 2 38 135 216 304 808 1197 30-3 set2_391 IGHV3- IGHJ4 2 38 135 216 304 809 1197 30 set2_392 IGHV3- IGHJ3 2 38 135 216 304 810 1198 30 set2_393 IGHV2- IGHJ4 33 74 192 249 339 811 1197 70 set2_394 IGHV3- IGHJ4 2 38 135 216 304 812 1197 30 set2_395 IGHV3- IGHJ6 2 39 135 218 304 813 1196 33 set2_396 IGHV3- IGHJ3 2 38 135 216 304 814 1198 30-3 set2_397 IGHV3- IGHJ3 2 38 135 216 304 815 1198 30 set2_398 IGHV3- IGHJ3 2 38 135 216 304 816 1198 30 set2_399 IGHV3- IGHJ4 2 38 135 216 304 817 1197 30 set2_400 IGHV3- IGHJ4 2 38 135 216 304 818 1197 30 set2_401 IGHV1- IGHJ5 30 98 184 267 364 819 1197 24 set2_402 IGHV3- IGHJ6 2 39 135 216 304 820 1196 30 set2_403 IGHV3- IGHJ4 7 58 169 251 341 821 1197 21 set2_404 IGHV3- IGHJ4 6 106 190 277 378 822 1197 13 set2_405 IGHV3- IGHJ5 2 38 135 216 304 823 1197 30 set2_406 IGHV3- IGHJ4 6 43 171 253 343 824 1197 7 set2_407 IGHV3- IGHJ4 2 38 135 216 304 825 1197 30-3 set2_408 IGHV2- IGHJ4 25 74 167 249 339 826 1197 70 set2_409 IGHV3- IGHJ4 2 38 135 216 304 827 1197 30 set2_410 IGHV3- IGHJ4 6 108 154 272 341 828 1197 48 set2_411 IGHV3- IGHJ5 2 38 135 216 304 829 1197 30 set2_412 IGHV3- IGHJ4 2 91 135 281 304 830 1197 30 set2_413 IGHV1- IGHJ5 30 98 184 267 364 831 1197 24 set2_414 IGHV3- IGHJ6 2 39 135 218 304 832 1196 33 set2_415 IGHV3- IGHJ4 2 38 135 216 382 833 1197 30 set2_416 IGHV3- IGHJ3 2 38 193 216 383 834 1198 30-3 set2_417 IGHV3- IGHJ5 2 38 135 216 304 835 1197 30 set2_418 IGHV3- IGHJ3 2 39 135 216 304 836 1198 30 set2_419 IGHV3- IGHJ4 12 38 146 254 304 837 1197 23 set2_420 IGHV3- IGHJ4 2 39 135 216 304 838 1197 30 set2_421 IGHV3- IGHJ5 2 38 135 216 304 839 1197 30 set2_422 IGHV3- IGHJI 2 38 181 216 304 840 1197 30 set2_423 IGHV1- IGHJ4 14 70 164 245 334 841 1197 18 set2_424 IGHV3- IGHJ4 2 38 135 216 304 842 1197 30-3 set2_425 IGHV4- IGHJ3 8 109 194 225 355 843 1198 31 set2_426 IGHV3- IGHJ4 2 38 135 216 304 844 1197 30 set2_427 IGHV3- IGHJ4 7 110 169 251 341 845 1197 21 set2_428 IGHV3- IGHJ4 2 38 135 216 304 846 1197 30-3 set2_429 IGHV3- IGHJ6 2 39 135 216 304 847 1196 30 set2_430 IGHV3- IGHJ4 2 111 135 216 384 848 1197 30-3 set2_431 IGHV3- IGHJ4 2 38 135 216 304 849 1197 30 set2_432 IGHV3- IGHJ4 2 38 135 216 304 850 1197 30 set2_433 IGHV3- IGHJ4 12 38 146 254 304 851 1197 23 set2_434 IGHV1- IGHJ6 30 98 184 267 364 852 1200 24 set2_435 IGHV3- IGHJ5 2 38 135 216 304 853 1197 30 set2_436 IGHV3- IGHJ3 2 38 135 216 304 854 1198 30 set2_437 IGHV3- IGHJ6 2 38 135 216 385 855 1196 30-3 set2_438 IGHV3- IGHJ4 2 39 135 216 304 856 1197 30 set2_439 IGHV3- IGHJ5 2 38 135 216 304 857 1197 30-3 set2_440 IGHV1- IGHJ5 30 98 184 267 364 858 1197 24 set2_441 IGHV3- IGHJ4 2 38 135 216 304 859 1197 30 set2_442 IGHV3- IGHJ4 2 38 135 216 304 860 1197 30-3 set2_443 IGHV3- IGHJ6 2 38 135 216 304 861 1196 30 set2_444 IGHV3- IGHJ4 2 38 135 216 304 862 1197 30-3 set2_445 IGHV3- IGHJI 2 112 195 216 386 863 1197 30-3 set2_446 IGHV3- IGHJ6 6 58 154 235 341 864 1196 48 set2_447 IGHV3- IGHJ4 18 92 158 238 361 865 1197 9 set2_448 IGHV3- IGHJ4 2 39 135 218 304 866 1197 33 set2_449 IGHV3- IGHJ6 2 39 135 216 304 867 1196 30 set2_450 IGHV1- IGHJ5 30 98 184 267 387 868 1197 24 set2_451 IGHV1- IGHJ5 30 98 184 267 364 869 1197 24 set2_452 IGHV3- IGHJ5 21 59 155 236 304 870 1197 53 set2_453 IGHV3- IGHJ4 2 39 135 216 304 871 1197 30 set2_454 IGHV3- IGHJ3 2 39 196 282 388 872 1198 30 set2_455 IGHV3- IGHJ4 2 38 135 216 304 873 1197 30-3 set2_456 IGHV3- IGHJ4 2 39 135 283 304 874 1197 33 set2_457 IGHV3- IGHJ4 2 38 135 216 304 875 1197 30 set2_458 IGHV3- IGHJ6 2 39 135 218 304 876 1196 33 set2_459 IGHV3- IGHJ6 2 38 135 216 304 877 1196 30 set2_460 IGHV3- IGHJ3 2 38 135 216 389 878 1197 30 set2_461 IGHV3- IGHJ3 2 38 135 216 304 879 1198 30 set2_462 IGHV3- IGHJ4 2 38 135 216 304 880 1197 30 set2_463 IGHV3- IGHJ4 2 38 135 216 304 881 1197 30-3 set2_464 IGHV3- IGHJ4 2 113 181 284 390 882 1197 30-3 set2_465 IGHV3- IGHJ6 2 38 135 216 304 883 1196 30 set2_466 IGHV3- IGHJ4 2 38 135 216 304 884 1197 30 set2_467 IGHV3- IGHJ4 34 38 197 285 391 885 1197 30-3 set2_468 IGHV3- IGHJ6 7 58 169 251 341 886 1196 21 set2_469 IGHV3- IGHJ3 2 111 193 216 304 887 1198 30-3 set2_470 IGHV3- IGHJ4 2 38 135 216 392 888 1197 30 set2_471 IGHV3- IGHJ4 2 39 135 216 304 889 1197 30 set2_472 IGHV3- IGHJ3 2 38 135 216 304 890 1198 30 set2_473 IGHV1- IGHJ4 30 98 184 267 364 891 1197 24 set2_474 IGHV3- IGHJ3 2 39 135 218 304 892 1198 33 set2_475 IGHV3- IGHJ6 2 39 135 216 304 893 1196 30 set2_476 IGHV3- IGHJ4 7 58 169 251 341 894 1197 21 set2_477 IGHV3- IGHJ4 6 114 139 286 393 895 1197 74 set2_478 IGHV3- IGHJ4 2 38 135 216 304 896 1197 30 set2_479 IGHV3- IGHJ4 21 59 155 236 304 897 1210 53 set2_480 IGHV3- IGHJ3 2 39 135 216 304 898 1198 30 set2_481 IGHV3- IGHJ6 21 115 183 236 304 899 1196 66 set2_482 IGHV2- IGHJ4 25 74 167 249 339 900 1202 70 set2_483 IGHV3- IGHJ2 6 106 190 280 378 901 1203 13 set2_484 IGHV4- IGHJ4 15 66 161 242 394 902 1197 34 set2_485 IGHV3- IGHJ4 7 58 169 251 341 903 1197 21 set2_486 IGHV1- IGHJ5 30 98 184 267 364 904 1197 24 set2_487 IGHV3- IGHJ4 7 58 169 251 341 905 1197 21 set2_488 IGHV5- IGHJ4 17 116 198 287 395 906 1197 51 set2_489 IGHV1- IGHJ5 30 98 184 267 364 907 1197 24 set2_490 IGHV1- IGHJ4 4 90 199 288 396 908 1197 69 set2_491 IGHV3- IGHJ4 2 39 135 216 304 909 1197 30 set2_492 IGHV3- IGHJ4 12 38 146 254 304 910 1197 23 set2_493 IGHV3- IGHJ4 7 58 169 251 341 911 1197 21 set2_494 IGHV3- IGHJ4 2 39 135 216 304 912 1197 30 set2_495 IGHV3- IGHJ6 2 39 135 218 304 913 1196 33 set2_496 IGHV1- IGHJ4 4 90 199 288 396 914 1197 69 set2_497 IGHV3- IGHJ4 7 58 169 251 341 915 1197 21 set2_498 IGHV4- IGHJ4 9 47 143 225 312 916 1197 59 set2_499 IGHV3- IGHJ5 2 39 135 218 304 917 1197 33 set2_500 IGHV3- IGHJ6 35 117 200 289 397 918 1196 43 set2_501 IGHV3- IGHJ5 7 58 169 251 341 919 1197 21 set2_502 IGHV3- IGHJ4 12 38 146 254 304 920 1197 23 set2_503 IGHV3- IGHJ4 12 38 146 254 304 921 1197 23 set2_504 IGHV3- IGHJ4 7 58 169 251 341 922 1197 21 set2_505 IGHV3- IGHJ4 2 39 135 216 304 923 1197 30 set2_506 IGHV3- IGHJ4 7 58 169 251 341 924 1197 21 set2_507 IGHV1- IGHJ4 14 84 148 230 351 925 1197 2 set2_508 IGHV4- IGHJ3 9 47 143 225 312 926 1198 59 set2_509 IGHV3- IGHJ3 2 39 135 218 304 927 1198 33 set2_510 IGHV3- IGHJ6 2 39 135 216 304 928 1196 30 set2_511 IGHV1- IGHJ6 14 76 170 252 342 929 1196 46 set2_512 IGHV4- IGHJ5 9 47 143 225 312 930 1197 59 set2_513 IGHV4- IGHJ6 15 66 161 242 312 931 1196 34 set2_514 IGHV1- IGHJ4 14 76 170 252 342 932 1197 46 set2_515 IGHV2- IGHJ4 24 72 166 290 336 933 1197 5 set2_516 IGHV4- IGHJ6 9 118 143 225 312 934 1200 59 set2_517 IGHV3- IGHJ6 18 92 158 238 361 935 1196 9 set2_518 IGHV3- IGHJ4 2 39 201 216 304 936 1197 30 set2_519 IGHV3- IGHJ4 2 39 135 218 304 937 1197 33 set2_520 IGHV3- IGHJ6 6 43 171 253 343 938 1196 7 set2_521 IGHV3- IGHJ5 20 65 186 272 341 939 1197 11 set2_522 IGHV1- IGHJ4 14 70 164 245 334 940 1197 18 set2_523 IGHV3- IGHJ5 12 38 146 254 304 941 1197 23 set2_524 IGHV3- IGHJ4 2 38 135 216 304 942 1197 30 set2_525 IGHV3- IGHJ5 2 39 135 216 304 943 1197 30 set2_526 IGHV3- IGHJ5 2 38 202 216 304 944 1197 30-3 set2_527 IGHV1- IGHJ6 4 119 179 261 357 945 1196 69 set2_528 IGHV3- IGHJ4 12 38 146 254 304 946 1197 23 set2_529 IGHV3- IGHJ4 7 58 169 251 341 947 1197 21 set2_530 IGHV1- IGHJ6 30 98 184 267 364 948 1196 24 set2_531 IGHV3- IGHJ5 18 92 158 238 361 949 1197 9 set2_532 IGHV4- IGHJ6 9 47 143 225 312 950 1196 59 set2_533 IGHV3- IGHJ4 2 39 135 218 304 951 1197 33 set2_534 IGHV3- IGHJ4 2 39 135 218 304 952 1197 33 set2_535 IGHV1- IGHJ5 30 98 184 267 364 953 1197 24 set2_536 IGHV3- IGHJ4 2 39 135 216 304 954 1197 30 set2_537 IGHV3- IGHJ6 7 58 169 251 341 955 1196 21 set2_538 IGHV3- IGHJ6 2 38 135 216 304 956 1196 30-3 set2_539 IGHV3- IGHJ4 2 39 135 218 304 957 1197 33 set2_540 IGHV3- IGHJ6 2 39 135 216 304 958 1200 30 set2_541 IGHV1- IGHJ6 14 84 148 230 351 959 1196 2 set2_542 IGHV3- IGHJ4 36 39 203 291 304 960 1197 30 set2_543 IGHV3- IGHJ4 2 39 135 216 304 961 1197 30 set2_544 IGHV3- IGHJ4 2 39 135 218 304 962 1197 33 set2_545 IGHV3- IGHJ5 2 39 135 218 304 963 1197 33 set2_546 IGHV1- IGHJ5 30 98 184 267 364 964 1197 24 set2_547 IGHV3- IGHJ4 2 38 135 216 304 965 1197 30 set2_548 IGHV1- IGHJ6 4 90 199 288 396 966 1196 69 set2_549 IGHV3- IGHJ3 21 59 155 236 304 967 1198 53 set2_550 IGHV1- IGHJ4 30 98 184 267 364 968 1197 24 set2_551 IGHV1- IGHJ4 4 90 179 261 357 969 1197 69 set2_552 IGHV3- IGHJ6 2 39 135 216 304 970 1196 30 set2_553 IGHV4- IGHJ4 9 47 143 225 312 971 1197 59 set2_554 IGHV3- IGHJ3 12 38 146 254 304 972 1198 23 set2_555 IGHV3- IGHJ4 2 39 135 218 304 973 1197 33 set2_556 IGHV4- IGHJ4 11 88 145 225 355 974 1197 39 set2_557 IGHV3- IGHJ4 6 106 190 277 378 975 1197 13 set2_558 IGHV3- IGHJ3 12 38 146 254 304 976 1198 23 set2_559 IGHV1- IGHJ4 14 76 170 252 342 977 1197 46 set2_560 IGHV3- IGHJ4 2 39 135 216 304 978 1197 30 set2_561 IGHV1- IGHJ3 31 100 185 270 367 979 1198 58 set2_562 IGHV3- IGHJ6 6 58 154 235 324 980 1196 48 set2_563 IGHV3- IGHJ6 2 39 135 218 304 981 1196 33 set2_564 IGHV4- IGHJ4 9 47 143 225 312 982 1197 59 set2_565 IGHV4- IGHJ4 8 109 194 225 355 983 1197 31 set2_566 IGHV3- IGHJ4 7 120 204 292 398 984 1216 21 set2_567 IGHV1- IGHJ5 30 98 184 267 364 985 1197 24 set2_568 IGHV4- IGHJ3 11 88 145 225 355 986 1198 39 set2_569 IGHV3- IGHJ6 6 106 190 277 378 987 1196 13 set2_570 IGHV2- IGHJ3 33 74 192 249 339 988 1198 70 set2_571 IGHV2- IGHJ3 24 72 166 247 336 989 1198 5 set2_572 IGHV3- IGHJ6 6 58 154 235 341 990 1196 48 set2_573 IGHV4- IGHJ3 8 109 194 225 355 991 1198 31 set2_574 IGHV4- IGHJ4 8 109 194 225 355 992 1197 31 set2_575 IGHV4- IGHJ6 11 88 145 225 355 993 1196 39 set2_576 IGHV1- IGHJ6 4 90 199 288 396 994 1196 69 set2_577 IGHV1- IGHJ6 4 90 199 288 396 995 1196 69 set2_578 IGHV3- IGHJ4 2 39 135 218 304 996 1197 33 set2_579 IGHV1- IGHJ4 30 98 184 267 364 997 1197 24 set2_580 IGHV1- IGHJ6 4 90 199 288 396 998 1200 69 set2_581 IGHV2- IGHJ5 24 72 166 247 336 999 1197 5 set2_582 IGHV1- IGHJ5 14 84 148 230 351 1000 1197 2 set2_583 IGHV3- IGHJ6 6 43 171 253 343 1001 1196 7 set2_584 IGHV3- IGHJ3 6 59 155 236 338 1002 1198 53 set2_585 IGHV2- IGHJ3 25 74 167 249 339 1003 1198 70 set2_586 IGHV1- IGHJ4 30 98 184 267 364 1004 1197 24 set2_587 IGHV1- IGHJ4 30 98 184 267 364 1005 1197 24 set2_588 IGHV4- IGHJ4 9 47 143 225 312 1006 1197 59 set2_589 IGHV4- IGHJ3 11 88 145 225 355 1007 1198 39 set2_590 IGHV1- IGHJ5 30 98 184 267 364 1008 1197 24 set2_591 IGHV3- IGHJ6 2 39 135 293 304 1009 1196 30 set2_592 IGHV1- IGHJ6 4 90 199 288 396 1010 1196 69 set2_593 IGHV3- IGHJ4 20 65 186 272 341 1011 1197 11 set2_594 IGHV2- IGHJ4 33 74 192 249 339 1012 1197 70 set2_595 IGHV2- IGHJ4 25 74 167 249 339 1013 1197 70 set2_596 IGHV3- IGHJ6 12 38 146 254 304 1014 1196 23 set2_597 IGHV1- IGHJ4 4 90 205 294 399 1015 1197 69 set2_598 IGHV3- IGHJ6 6 43 171 253 343 1016 1196 7 set2_599 IGHV1- IGHJ6 14 76 170 252 342 1017 1196 46 set2_600 IGHV3- IGHJ6 20 65 186 272 341 1018 1196 11 set2_601 IGHV4- IGHJI 15 66 161 242 312 1019 1197 34 set2_602 IGHV3- IGHJ6 7 58 169 251 341 1020 1196 21 set2_603 IGHV3- IGHJ6 6 43 171 253 343 1021 1196 7 set2_604 IGHV3- IGHJ6 6 43 171 253 343 1022 1196 7 set2_605 IGHV4- IGHJ5 15 66 161 242 312 1023 1197 34 set2_606 IGHV4- IGHJ6 15 66 161 242 312 1024 1196 34 set2_607 IGHV2- IGHJ4 29 94 182 264 360 1025 1197 26 set2_608 IGHV4- IGHJ5 9 121 143 225 312 1026 1197 59 set2_609 IGHV1- IGHJ6 4 71 199 288 357 1027 1196 69 set2_610 IGHV3- IGHJ6 12 38 146 254 304 1028 1196 23 set2_611 IGHV3- IGHJ6 6 43 171 253 343 1029 1196 7 set2_612 IGHV3- IGHJ4 2 38 135 216 304 1030 1197 30 set2_613 IGHV4- IGHJ5 15 122 161 242 400 1031 1197 34 set2_614 IGHV3- IGHJ6 20 65 186 272 341 1032 1196 11 set2_615 IGHV4- IGHJ3 15 66 161 242 312 1033 1198 34 set2_616 IGHV4- IGHJ5 15 66 161 242 312 1034 1197 34 set2_617 IGHV1- IGHJ5 30 98 184 267 364 1035 1197 24 set2_618 IGHV1- IGHJ6 14 76 170 252 342 1036 1196 46 set2_619 IGHV1- IGHJ6 14 76 170 252 342 1037 1196 46 set2_620 IGHV1- IGHJ3 14 84 148 230 351 1038 1198 2 set2_621 IGHV4- IGHJ5 15 66 161 242 312 1039 1197 34 set2_622 IGHV1- IGHJ6 4 123 206 295 357 1040 1196 69 set2_623 IGHV3- IGHJ6 6 43 171 253 343 1041 1196 7 set2_624 IGHV4- IGHJ6 15 66 161 242 312 1042 1196 34 set2_625 IGHV3- IGHJ6 12 38 146 254 304 1043 1196 23 set2_626 IGHV3- IGHJ6 6 43 171 253 343 1044 1196 7 set2_627 IGHV3- IGHJ6 2 39 135 218 304 1045 1196 33 set2_628 IGHV5- IGHJ4 37 61 207 296 401 1046 1197 10-1 set2_629 IGHV3- IGHJ6 20 65 186 272 341 1047 1196 11 set2_630 IGHV4- IGHJ5 11 124 208 297 402 1048 1197 39 set2_631 IGHV5- IGHJ4 37 61 207 296 401 1049 1197 10-1 set2_632 IGHV3- IGHJ6 6 43 171 253 343 1050 1196 7 set2_633 IGHV3- IGHJ4 7 44 140 222 309 1051 1197 15 set2_634 IGHV3- IGHJ4 6 106 190 277 378 1052 1197 13 set2_635 IGHV3- IGHJ6 6 125 171 253 403 1053 1217 7 set2_636 IGHV2- IGHJ4 29 94 182 264 360 1054 1197 26 set2_637 IGHV3- IGHJ6 12 38 146 254 304 1055 1196 23 set2_638 IGHV3- IGHJ6 20 65 186 272 341 1056 1196 11 set2_639 IGHV3- IGHJ6 20 65 186 272 341 1057 1196 11 set2_640 IGHV4- IGHJ5 15 66 161 242 312 1058 1197 34 set2_641 IGHV1- IGHJ4 14 70 164 245 334 1059 1197 18 set2_642 IGHV4- IGHJ4 11 88 145 225 355 1060 1197 39 set2_643 IGHV1- IGHJ6 14 84 148 230 351 1061 1196 2 set2_644 IGHV4- IGHJ5 15 66 161 242 312 1062 1197 34 set2_645 IGHV4- IGHJ4 15 66 161 242 312 1063 1197 34 set2_646 IGHV1- IGHJ6 4 90 199 288 404 1064 1200 69 set2_647 IGHV1- IGHJ6 4 90 199 288 396 1065 1196 69 set2_648 IGHV3- IGHJ6 7 58 169 251 341 1066 1196 21 set2_649 IGHV4- IGHJ6 15 66 161 242 405 1067 1196 34 set2_650 IGHV3- IGHJ6 2 39 135 218 304 1068 1196 33 set2_651 IGHV3- IGHJ4 7 58 169 251 341 1069 1197 21 set2_652 IGHV5- IGHJ5 37 61 207 296 401 1070 1197 10-1 set2_653 IGHV3- IGHJ6 6 43 171 253 343 1071 1196 7 set2_654 IGHV1- IGHJ6 4 90 199 261 357 1072 1196 69 set2_655 IGHV3- IGHJ4 2 39 135 216 304 1073 1197 30 set2_656 IGHV3- IGHJ4 7 58 169 251 341 1074 1197 21 set2_657 IGHV3- IGHJ6 6 43 171 253 343 1075 1196 7 set2_658 IGHV4- IGHJ6 15 66 209 298 406 1076 1196 34 set2_659 IGHV3- IGHJ4 2 39 135 216 304 1077 1197 30 set2_660 IGHV1- IGHJ6 4 90 199 288 396 1078 1200 69 set2_661 IGHV4- IGHJ3 15 66 161 242 312 1079 1198 34 set2_662 IGHV3- IGHJ6 12 38 146 254 304 1080 1196 23 set2_663 IGHV1- IGHJ6 4 90 199 288 396 1081 1196 69 set2_664 IGHV3- IGHJ4 2 39 135 216 304 1082 1197 30 set2_665 IGHV3- IGHJ6 12 38 146 254 304 1083 1196 23 set2_666 IGHV1- IGHJ5 30 98 184 267 364 1084 1197 24 set2_667 IGHV3- IGHJ3 7 44 140 222 309 1085 1198 15 set2_668 IGHV4- IGHJ5 11 88 145 225 355 1086 1197 39 set2_669 IGHV4- IGHJ3 9 126 210 225 407 1087 1198 59 set2_670 IGHV4- IGHJ6 15 66 161 242 312 1088 1196 34 set2_671 IGHV4- IGHJ5 9 47 143 225 312 1089 1197 59 set2_672 IGHV4- IGHJ5 15 66 161 242 312 1090 1197 34 set2_673 IGHV1- IGHJ5 30 98 184 267 364 1091 1197 24 set2_674 IGHV4- IGHJ4 11 88 145 225 355 1092 1197 39 set2_675 IGHV4- IGHJ3 9 47 143 299 312 1093 1198 59 set2_676 IGHV4- IGHJ6 9 47 211 225 408 1094 1218 59 set2_677 IGHV1- IGHJ6 14 70 164 245 334 1095 1196 18 set2_678 IGHV2- IGHJ4 29 94 182 264 360 1096 1197 26 set2_679 IGHV3- IGHJ6 12 38 146 254 304 1097 1196 23 set2_680 IGHV1- IGHJ6 4 90 199 288 396 1098 1200 69 set2_681 IGHV4- IGHJ3 9 47 175 256 347 1099 1198 4 set2_682 IGHV3- IGHJ3 7 44 140 222 309 1100 1198 15 set2_683 IGHV1- IGHJ6 14 84 148 230 351 1101 1196 2 set2_684 IGHV3- IGHJ4 2 39 135 216 304 1102 1197 30 set2_685 IGHV1- IGHJ6 4 90 199 288 396 1103 1200 69 set2_686 IGHV4- IGHJ5 8 109 194 225 355 1104 1197 31 set2_687 IGHV3- IGHJ5 6 127 139 300 308 1105 1197 74 set2_688 IGHV1- IGHJ5 30 98 184 267 364 1106 1197 24 set2_689 IGHV1- IGHJ5 4 128 199 288 396 1107 1197 69 set2_690 IGHV5- IGHJ4 17 61 157 229 326 1108 1197 51 set2_691 IGHV1- IGHJ6 14 70 164 245 334 1109 1196 18 set2_692 IGHV1- IGHJ5 14 70 164 245 334 1110 1197 18 set2_693 IGHV3- IGHJ6 20 65 186 272 341 1111 1196 11 set2_694 IGHV3- IGHJ6 12 38 146 254 304 1112 1196 23 set2_695 IGHV3- IGHJ6 6 43 171 253 343 1113 1196 7 set2_696 IGHV3- IGHJ6 12 38 146 254 304 1114 1196 23 set2_697 IGHV5- IGHJ5 17 61 157 229 326 1115 1197 51 set2_698 IGHV3- IGHJ6 2 39 141 301 409 1116 1196 30 set2_699 IGHV4- IGHJ3 11 88 145 225 410 1117 1198 39 set2_700 IGHV3- IGHJ6 6 43 171 253 343 1118 1196 7 set2_701 IGHV4- IGHJ4 15 66 161 242 312 1119 1197 34 set2_702 IGHV1- IGHJ6 4 90 199 288 396 1120 1196 69 set2_703 IGHV4- IGHJ5 11 88 145 225 355 1121 1197 39 set2_704 IGHV3- IGHJ6 6 43 171 253 343 1122 1196 7 set2_705 IGHV4- IGHJ6 9 47 143 225 312 1123 1196 59 set2_706 IGHV3- IGHJ6 20 65 186 272 341 1124 1196 11 set2_707 IGHV4- IGHJ4 15 66 161 242 312 1125 1197 34 set2_708 IGHV1- IGHJ6 4 90 199 288 396 1126 1200 69 set2_709 IGHV1- IGHJ6 4 90 199 288 396 1127 1196 69 set2_710 IGHV3- IGHJ3 6 129 212 302 411 1128 1198 7 set2_711 IGHV4- IGHJ6 11 88 145 225 355 1129 1196 39 set2_712 IGHV4- IGHJ6 15 66 161 242 312 1130 1196 34 set2_713 IGHV1- IGHJ3 14 84 148 230 351 1131 1198 2 set2_714 IGHV3- IGHJ4 2 39 135 216 304 1132 1197 30 set2_715 IGHV4- IGHJ6 8 109 194 225 355 1133 1196 31 set2_716 IGHV4- IGHJ6 11 88 145 225 355 1134 1196 39 set2_717 IGHV3- IGHJ6 7 58 169 251 341 1135 1200 21 set2_718 IGHV3- IGHJ3 12 130 213 303 412 1136 1196 23 set2_719 IGHV3- IGHJ6 6 106 190 280 378 1137 1200 13 set2_720 IGHV4- IGHJ3 9 131 143 225 312 1138 1198 61 set2_721 IGHV3- IGHJ4 7 44 140 222 309 1139 1197 15 set2_722 IGHV2- IGHJ6 33 74 192 249 339 1140 1196 70 set2_723 IGHV4- IGHJ6 15 66 161 242 312 1141 1196 34 set2_724 IGHV3- IGHJ6 20 65 186 272 341 1142 1196 11 set2_725 IGHV4- IGHJ6 9 47 143 225 312 1143 1196 59 set2_726 IGHV3- IGHJ4 2 39 135 218 304 1144 1197 33 set2_727 IGHV1- IGHJ6 30 98 184 267 364 1145 1196 24 set2_728 IGHV3- IGHJ5 20 65 186 272 341 1146 1197 11 set2_729 IGHV3- IGHJ2 6 106 190 277 378 1147 1203 13 set2_730 IGHV4- IGHJ6 15 66 161 242 312 1148 1196 34 set2_731 IGHV1- IGHJ6 14 70 164 245 334 1149 1196 18 set2_732 IGHV3- IGHJ6 2 39 181 216 304 1150 1196 30 set2_733 IGHV4- IGHJ6 15 66 161 242 312 1151 1196 34 set2_734 IGHV3- IGHJ6 6 43 171 253 343 1152 1196 7 set2_735 IGHV4- IGHJ5 11 88 145 225 355 1153 1197 39 set2_736 IGHV1- IGHJ4 14 70 164 245 334 1154 1197 18 set2_737 IGHV3- IGHJ3 6 132 214 221 413 1155 1198 74 set2_738 IGHV4- IGHJ5 9 47 143 225 312 1156 1197 59 set2_739 IGHV4- IGHJ6 11 88 145 225 355 1157 1196 39 set2_740 IGHV3- IGHJ4 2 39 135 216 304 1158 1197 30 set2_741 IGHV1- IGHJ6 14 70 164 245 334 1159 1196 18 set2_742 IGHV3- IGHJ6 20 65 186 272 341 1160 1196 11 set2_743 IGHV3- IGHJ6 6 43 171 253 343 1161 1196 7 set2_744 IGHV3- IGHJ6 6 43 171 253 343 1162 1196 7 set2_745 IGHV1- IGHJ6 14 70 164 245 334 1163 1196 18 set2_746 IGHV1- IGHJ6 14 70 164 245 334 1164 1196 18 set2_747 IGHV1- IGHJ6 30 98 184 267 364 1165 1196 24 set2_748 IGHV4- IGHJ6 15 66 161 242 312 1166 1196 34 set2_749 IGHV1- IGHJ6 14 70 164 245 334 1167 1196 18 set2_750 IGHV1- IGHJ6 4 90 199 288 396 1168 1196 69 set2_751 IGHV3- IGHJ6 6 43 171 253 343 1169 1196 7 set2_752 IGHV1- IGHJ6 4 90 199 288 396 1170 1196 69 set2_753 IGHV3- IGHJ4 2 133 135 216 414 1171 1197 30 set2_754 IGHV3- IGHJ3 7 58 169 251 341 1172 1198 21 set2_755 IGHV3- IGHJ6 2 39 135 218 304 1173 1196 33 set2_756 IGHV3- IGHJ6 6 43 171 253 343 1174 1196 7 set2_757 IGHV1- IGHJ6 14 70 164 245 334 1175 1196 18 set2_758 IGHV3- IGHJ4 6 43 171 253 343 1176 1197 7 set2_759 IGHV1- IGHJ6 14 84 148 230 351 1177 1196 2 set2_760 IGHV3- IGHJ6 7 58 169 251 341 1178 1196 21 set2_761 IGHV4- IGHJ6 15 66 161 242 312 1179 1196 34 set2_762 IGHV1- IGHJ6 14 70 164 245 334 1180 1196 18 set2_763 IGHV3- IGHJ6 20 65 186 272 341 1181 1196 11 set2_764 IGHV4- IGHJ6 9 47 175 256 347 1182 1196 4 set2_765 IGHV4- IGHJ6 15 66 161 242 312 1183 1196 34 set2_766 IGHV1- IGHJ6 14 70 164 245 334 1184 1196 18 set2_767 IGHV1- IGHJ6 14 70 164 245 334 1185 1196 18 set2_768 IGHV4- IGHJ6 15 134 161 242 312 1186 1196 34 set2_769 IGHV1- IGHJ6 14 70 164 245 334 1187 1196 18 set2_770 IGHV1- IGHJ6 14 70 215 245 415 1188 1196 18 set2_771 IGHV3- IGHJ6 2 39 135 218 304 1189 1196 33 set2_772 IGHV3- IGHJ6 2 38 135 216 304 1190 1200 30 set2_773 IGHV3- IGHJ6 2 39 135 218 304 1191 1196 33 set2_774 IGHV3- IGHJ6 2 38 135 216 304 1192 1196 30 set2_775 IGHV3- IGHJ6 2 39 135 218 304 1193 1196 33 set2_776 IGHV3- IGHJ6 2 39 135 218 304 1194 1196 33 set2_777 IGHV3- IGHJ6 2 39 135 218 304 1195 1196 33

TABLE-US-00002 TABLE 2 Polypeptide sequences of immunoglobulin heavy chain variable domains (VHs) Polypeptide sequence VH name (SEQ ID NO) set1_1 1 set1_2 1219 set1_3 1220 set1_4 1221 set1_5 1222 set2_1 1223 set2_2 1224 set2_3 1225 set2_4 1226 set2_5 1227 set2_6 1228 set2_7 1229 set2_8 1230 set2_9 1231 set2_10 1232 set2_11 1233 set2_12 1234 set2_13 1235 set2_14 1236 set2_15 1237 set2_16 1238 set2_17 1239 set2_18 1240 set2_19 1241 set2_20 1242 set2_21 1243 set2_22 1244 set2_23 1245 set2_24 1246 set2_25 1247 set2_26 1248 set2_27 1249 set2_28 1250 set2_29 1251 set2_30 1252 set2_31 1253 set2_32 1254 set2_33 1255 set2_34 1256 set2_35 1257 set2_36 1258 set2_37 1259 set2_38 1260 set2_39 1261 set2_40 1262 set2_41 1263 set2_42 1264 set2_43 1265 set2_44 1266 set2_45 1267 set2_46 1268 set2_47 1269 set2_48 1270 set2_49 1271 set2_50 1272 set2_51 1273 set2_52 1274 set2_53 1275 set2_54 1276 set2_55 1277 set2_56 1278 set2_57 1279 set2_58 1280 set2_59 1281 set2_60 1282 set2_61 1283 set2_62 1284 set2_63 1285 set2_64 1286 set2_65 1287 set2_66 1288 set2_67 1289 set2_68 1290 set2_69 1291 set2_70 1292 set2_71 1293 set2_72 1294 set2_73 1295 set2_74 1296 set2_75 1297 set2_76 1298 set2_77 1299 set2_78 1300 set2_79 1301 set2_80 1302 set2_81 1303 set2_82 1304 set2_83 1305 set2_84 1306 set2_85 1307 set2_86 1308 set2_87 1309 set2_88 1310 set2_89 1311 set2_90 1312 set2_91 1313 set2_92 1314 set2_93 1315 set2_94 1316 set2_95 1317 set2_96 1318 set2_97 1319 set2_98 1320 set2_99 1321 set2_100 1322 set2_101 1323 set2_102 1324 set2_103 1325 set2_104 1326 set2_105 1327 set2_106 1328 set2_107 1329 set2_108 1330 set2_109 1331 set2_110 1332 set2_111 1333 set2_112 1334 set2_113 1335 set2_114 1336 set2_115 1337 set2_116 1338 set2_117 1339 set2_118 1340 set2_119 1341 set2_120 1342 set2_121 1343 set2_122 1344 set2_123 1345 set2_124 1346 set2_125 1347 set2_126 1348 set2_127 1349 set2_128 1350 set2_129 1351 set2_130 1352 set2_131 1353 set2_132 1354 set2_133 1355 set2_134 1356 set2_135 1357 set2_136 1358 set2_137 1359 set2_138 1360 set2_139 1361 set2_140 1362 set2_141 1363 set2_142 1364 set2_143 1365 set2_144 1366 set2_145 1367 set2_146 1368 set2_147 1369 set2_148 1370 set2_149 1371 set2_150 1372 set2_151 1373 set2_152 1374 set2_153 1375 set2_154 1376 set2_155 1377 set2_156 1378 set2_157 1379 set2_158 1380 set2_159 1381 set2_160 1382 set2_161 1383 set2_162 1384 set2_163 1385 set2_164 1386 set2_165 1387 set2_166 1388 set2_167 1389 set2_168 1390 set2_169 1391 set2_170 1392 set2_171 1393 set2_172 1394 set2_173 1395 set2_174 1396 set2_175 1397 set2_176 1398 set2_177 1399 set2_178 1400 set2_179 1401 set2_180 1402 set2_181 1403 set2_182 1404 set2_183 1405 set2_184 1406 set2_185 1407 set2_186 1408 set2_187 1409 set2_188 1410 set2_189 1411 set2_190 1412 set2_191 1413 set2_192 1414 set2_193 1415 set2_194 1416 set2_195 1417 set2_196 1418 set2_197 1419 set2_198 1420 set2_199 1421 set2_200 1422 set2_201 1423 set2_202 1424 set2_203 1425 set2_204 1426 set2_205 1427 set2_206 1428 set2_207 1429 set2_208 1430 set2_209 1431 set2_210 1432 set2_211 1433 set2_212 1434 set2_213 1435 set2_214 1436 set2_215 1437 set2_216 1438 set2_217 1439 set2_218 1440 set2_219 1441 set2_220 1442 set2_221 1443 set2_222 1444 set2_223 1445 set2_224 1446 set2_225 1447 set2_226 1448 set2_227 1449 set2_228 1450 set2_229 1451 set2_230 1452 set2_231 1453 set2_232 1454 set2_233 1455 set2_234 1456 set2_235 1457 set2_236 1458 set2_237 1459 set2_238 1460 set2_239 1461 set2_240 1462 set2_241 1463 set2_242 1464 set2_243 1465 set2_244 1466 set2_245 1467 set2_246 1468 set2_247 1469 set2_248 1470 set2_249 1471 set2_250 1472 set2_251 1473 set2_252 1474 set2_253 1475 set2_254 1476 set2_255 1477 set2_256 1478 set2_257 1479 set2_258 1480 set2_259 1481 set2_260 1482 set2_261 1483 set2_262 1484 set2_263 1485 set2_264 1486 set2_265 1487 set2_266 1488 set2_267 1489 set2_268 1490 set2_269 1491 set2_270 1492 set2_271 1493 set2_272 1474 set2_273 1494 set2_274 1495 set2_275 1496 set2_276 1497 set2_277 1498 set2_278 1499 set2_279 1500 set2_280 1501 set2_281 1502 set2_282 1503 set2_283 1504 set2_284 1505 set2_285 1506 set2_286 1507 set2_287 1508 set2_288 1509 set2_289 1510 set2_290 1511 set2_291 1512 set2_292 1513 set2_293 1514 set2_294 1515 set2_295 1516 set2_296 1517 set2_297 1518 set2_298 1519 set2_299 1520 set2_300 1521 set2_301 1522 set2_302 1523 set2_303 1524 set2_304 1525 set2_305 1526 set2_306 1527 set2_307 1528 set2_308 1529 set2_309 1530 set2_310 1531 set2_311 1532 set2_312 1533 set2_313 1534 set2_314 1535 set2_315 1536 set2_316 1537 set2_317 1538 set2_318 1539 set2_319 1540 set2_320 1541 set2_321 1542 set2_322 1543 set2_323 1544 set2_324 1545 set2_325 1546 set2_326 1547 set2_327 1548 set2_328 1549 set2_329 1550 set2_330 1551 set2_331 1552 set2_332 1553 set2_333 1554 set2_334 1555 set2_335 1556 set2_336 1557 set2_337 1558 set2_338 1559 set2_339 1560 set2_340 1561 set2_341 1562 set2_342 1563 set2_343 1564 set2_344 1565 set2_345 1566 set2_346 1567 set2_347 1568 set2_348 1569 set2_349 1570 set2_350 1571 set2_351 1572 set2_352 1573 set2_353 1574 set2_354 1575 set2_355 1576 set2_356 1577 set2_357 1578 set2_358 1579 set2_359 1580 set2_360 1581 set2_361 1582 set2_362 1583 set2_363 1584 set2_364 1585 set2_365 1586 set2_366 1587 set2_367 1588 set2_368 1589 set2_369 1590 set2_370 1591 set2_371 1592 set2_372 1593 set2_373 1594 set2_374 1595 set2_375 1596 set2_376 1597 set2_377 1598 set2_378 1599 set2_379 1600 set2_380 1601 set2_381 1602 set2_382 1603 set2_383 1604 set2_384 1605 set2_385 1606 set2_386 1607 set2_387 1608 set2_388 1609 set2_389 1610 set2_390 1611 set2_391 1612 set2_392 1613 set2_393 1614 set2_394 1615 set2_395 1616 set2_396 1617 set2_397 1618 set2_398 1619 set2_399 1620 set2_400 1621 set2_401 1622 set2_402 1623 set2_403 1624 set2_404 1625 set2_405 1626 set2_406 1627 set2_407 1628 set2_408 1629 set2_409 1630 set2_410 1631 set2_411 1632 set2_412 1633 set2_413 1634 set2_414 1635 set2_415 1636 set2_416 1637 set2_417 1638 set2_418 1639 set2_419 1640 set2_420 1641 set2_421 1642 set2_422 1643 set2_423 1644 set2_424 1645 set2_425 1646 set2_426 1647 set2_427 1648 set2_428 1649 set2_429 1650 set2_430 1651 set2_431 1652 set2_432 1653 set2_433 1654 set2_434 1655 set2_435 1656 set2_436 1657 set2_437 1658 set2_438 1659 set2_439 1660 set2_440 1661 set2_441 1662 set2_442 1663 set2_443 1664 set2_444 1665 set2_445 1666 set2_446 1667 set2_447 1668 set2_448 1669 set2_449 1670 set2_450 1671 set2_451 1672 set2_452 1673 set2_453 1674 set2_454 1675 set2_455 1676 set2_456 1677 set2_457 1678 set2_458 1679 set2_459 1680 set2_460 1681 set2_461 1682 set2_462 1683 set2_463 1684 set2_464 1685 set2_465 1686 set2_466 1687 set2_467 1688 set2_468 1689 set2_469 1690 set2_470 1691 set2_471 1692 set2_472 1693 set2_473 1694 set2_474 1695 set2_475 1696 set2_476 1697 set2_477 1698 set2_478 1699 set2_479 1700 set2_480 1701 set2_481 1702 set2_482 1703 set2_483 1704 set2_484 1705 set2_485 1706 set2_486 1707 set2_487 1708 set2_488 1709 set2_489 1710 set2_490 1711 set2_491 1712 set2_492 1713 set2_493 1714 set2_494 1715 set2_495 1716 set2_496 1717 set2_497 1718 set2_498 1719 set2_499 1720 set2_500 1721 set2_501 1722 set2_502 1723 set2_503 1724 set2_504 1725 set2_505 1726 set2_506 1727 set2_507 1728 set2_508 1729 set2_509 1730 set2_510 1731 set2_511 1732 set2_512 1733 set2_513 1734 set2_514 1735 set2_515 1736 set2_516 1737 set2_517 1738 set2_518 1739 set2_519 1740 set2_520 1741 set2_521 1742 set2_522 1743 set2_523 1744 set2_524 1745 set2_525 1746 set2_526 1747 set2_527 1748 set2_528 1749 set2_529 1750 set2_530 1751 set2_531 1752 set2_532 1753 set2_533 1754 set2_534 1755 set2_535 1756 set2_536 1757 set2_537 1758 set2_538 1759 set2_539 1760 set2_540 1761 set2_541 1762 set2_542 1763 set2_543 1764 set2_544 1765 set2_545 1766 set2_546 1767 set2_547 1768 set2_548 1769 set2_549 1770 set2_550 1771 set2_551 1772 set2_552 1773 set2_553 1774 set2_554 1775 set2_555 1776 set2_556 1777 set2_557 1778 set2_558 1779 set2_559 1780 set2_560 1781 set2_561 1782 set2_562 1783 set2_563 1784 set2_564 1785 set2_565 1786 set2_566 1787 set2_567 1788 set2_568 1789 set2_569 1790 set2_570 1791 set2_571 1792 set2_572 1793 set2_573 1794 set2_574 1795 set2_575 1796 set2_576 1797 set2_577 1798 set2_578 1799 set2_579 1800 set2_580 1801 set2_581 1802 set2_582 1803 set2_583 1804 set2_584 1805 set2_585 1806 set2_586 1807 set2_587 1808 set2_588 1809 set2_589 1810 set2_590 1811 set2_591 1812 set2_592 1813 set2_593 1814 set2_594 1815 set2_595 1816 set2_596 1817 set2_597 1818 set2_598 1819 set2_599 1820 set2_600 1821 set2_601 1822 set2_602 1823 set2_603 1824 set2_604 1825 set2_605 1826 set2_606 1827 set2_607 1828 set2_608 1829 set2_609 1830 set2_610 1831 set2_611 1832 set2_612 1833 set2_613 1834 set2_614 1835 set2_615 1836 set2_616 1837 set2_617 1838 set2_618 1839 set2_619 1840 set2_620 1841 set2_621 1842 set2_622 1843 set2_623 1844 set2_624 1845 set2_625 1846 set2_626 1847 set2_627 1848 set2_628 1849 set2_629 1850 set2_630 1851 set2_631 1852 set2_632 1853 set2_633 1854 set2_634 1855 set2_635 1856 set2_636 1857 set2_637 1858 set2_638 1859 set2_639 1860 set2_640 1861 set2_641 1862 set2_642 1863 set2_643 1864 set2_644 1865 set2_645 1866 set2_646 1867 set2_647 1868 set2_648 1869 set2_649 1870 set2_650 1871 set2_651 1872 set2_652 1873 set2_653 1874 set2_654 1875 set2_655 1876 set2_656 1877 set2_657 1878 set2_658 1879 set2_659 1880 set2_660 1881 set2_661 1882 set2_662 1883 set2_663 1884 set2_664 1885 set2_665 1886 set2_666 1887 set2_667 1888 set2_668 1889 set2_669 1890 set2_670 1891 set2_671 1892 set2_672 1893 set2_673 1894 set2_674 1895 set2_675 1896 set2_676 1897 set2_677 1898 set2_678 1899 set2_679 1900 set2_680 1901 set2_681 1902 set2_682 1903 set2_683 1904 set2_684 1905 set2_685 1906 set2_686 1907 set2_687 1908 set2_688 1909 set2_689 1910 set2_690 1911 set2_691 1912 set2_692 1913 set2_693 1914 set2_694 1915 set2_695 1916 set2_696 1917 set2_697 1918 set2_698 1919 set2_699 1920 set2_700 1921 set2_701 1922 set2_702 1923 set2_703 1924 set2_704 1925 set2_705 1926 set2_706 1927 set2_707 1928 set2_708 1929 set2_709 1930 set2_710 1931 set2_711 1932 set2_712 1933 set2_713 1934 set2_714 1935 set2_715 1936 set2_716 1937 set2_717 1938 set2_718 1939 set2_719 1940 set2_720 1941 set2_721 1942 set2_722 1943 set2_723 1944 set2_724 1945 set2_725 1946 set2_726 1947 set2_727 1948 set2_728 1949 set2_729 1950 set2_730 1951 set2_731 1952 set2_732 1953 set2_733 1954 set2_734 1955 set2_735 1956 set2_736 1957 set2_737 1958 set2_738 1959 set2_739 1960 set2_740 1961 set2_741 1962 set2_742 1963 set2_743 1964 set2_744 1965 set2_745 1966 set2_746 1967 set2_747 1968 set2_748 1969 set2_749 1970 set2_750 1971 set2_751 1972 set2_752 1973 set2_753 1974 set2_754 1975 set2_755 1976 set2_756 1977 set2_757 1978 set2_758 1979 set2_759 1980 set2_760 1981 set2_761 1982 set2_762 1983 set2_763 1984 set2_764 1985 set2_765 1986 set2_766 1987 set2_767 1988 set2_768 1989 set2_769 1990 set2_770 1991 set2_771 1992 set2_772 1993 set2_773 1994 set2_774 1995 set2_775 1996 set2_776 1997 set2_777 1998

[0075] In one embodiment there is provided a polypeptide comprising:

[0076] a sequence (such as a CDRH1 sequence) comprising or consisting of a sequence sharing 80% or greater sequence identity with a CDRH1 sequence as shown in Table 1 and/or

[0077] a sequence (such as a CDRH2 sequence) comprising or consisting of a sequence sharing 80% or greater sequence identity with a CDRH2 sequence as shown in Table 1 and/or

[0078] a sequence (such as a CDRH3 sequence) comprising or consisting of a sequence sharing 80% or greater sequence identity with a CDRH3 sequence as shown in Table 1.

[0079] Suitably the polypeptide comprises

[0080] a sequence (such as a CDRH1 sequence) comprising or consisting of a sequence sharing 90% or greater sequence identity with a CDRH1 sequence as shown in Table 1 and/or

[0081] a sequence (such as a CDRH2 sequence) comprising or consisting of a sequence sharing 90% or greater sequence identity with a CDRH2 sequence as shown in Table 1 and/or

[0082] a sequence (such as a CDRH3 sequence) comprising or consisting of a sequence sharing 90% or greater sequence identity with a CDRH3 sequence as shown in Table 1.

[0083] More suitably the polypeptide comprises

[0084] a sequence (such as a CDRH1 sequence) comprising or consisting of a CDRH1 sequence as shown in Table 1 and/or

[0085] a sequence (such as a CDRH2 sequence) comprising or consisting of a CDRH2 sequence as shown in Table 1 and/or

[0086] a sequence (such as a CDRH3 sequence) comprising or consisting of a CDRH3 sequence as shown in Table 1.

[0087] More suitably the polypeptide comprises

[0088] a sequence (such as a CDRH1 sequence) comprising or consisting of a CDRH1 sequence as shown in Table 1 and

[0089] a sequence (such as a CDRH2 sequence) comprising or consisting of a CDRH2 sequence as shown in Table 1 and

[0090] a sequence (such as a CDRH3 sequence) comprising or consisting of a CDRH3 sequence as shown in Table 1.

[0091] Suitably the polypeptide comprises

[0092] a sequence (such as a FWRH1 sequence) comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH1 sequence as shown in Table 1 and/or

[0093] a sequence (such as a FWRH2 sequence) comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH2 sequence as shown in Table 1 and/or

[0094] a sequence (such as a FWRH3 sequence) comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH3 sequence as shown in Table 1 and/or

[0095] a sequence (such as a FWRH4 sequence) comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH4 sequence as shown in Table 1.

[0096] In one embodiment the polypeptide comprises:

[0097] a sequence (such as a FWRH1 sequence) comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH1 sequence as shown in Table 1 and/or

[0098] a sequence (such as a FWRH2 sequence) comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH2 sequence as shown in Table 1 and/or

[0099] a sequence (such as a FWRH3 sequence) comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH3 sequence as shown in Table 1 and/or

[0100] a sequence (such as a FWRH4 sequence) comprising or consisting of a sequence sharing 80% or greater sequence identity with a FWRH4 sequence as shown in Table 1.

[0101] More suitably the polypeptide comprises

[0102] a sequence (such as a FWRH1 sequence) comprising or consisting of a sequence sharing 90% or greater sequence identity with a FWRH1 sequence as shown in Table 1 and/or

[0103] a sequence (such as a FWRH2 sequence) comprising or consisting of a sequence sharing 90% or greater sequence identity with a FWRH2 sequence as shown in Table 1 and/or

[0104] a sequence (such as a FWRH3 sequence) comprising or consisting of a sequence sharing 90% or greater sequence identity with a FWRH3 sequence as shown in Table 1 and/or

[0105] a sequence (such as a FWRH4 sequence) comprising or consisting of a sequence sharing 90% or greater sequence identity with a FWRH4 sequence as shown in Table 1.

[0106] More suitably the polypeptide comprises

[0107] a sequence (such as a FWRH1 sequence) comprising or consisting of a FWRH1 sequence as shown in Table 1 and/or

[0108] a sequence (such as a FWRH2 sequence) comprising or consisting of a FWRH2 sequence as shown in Table 1 and/or

[0109] a sequence (such as a FWRH3 sequence) comprising or consisting of a FWRH3 sequence as shown in Table 1 and/or

[0110] a sequence (such as a FWRH4 sequence) comprising or consisting of a FWRH4 sequence as shown in Table 1.

[0111] More suitably the polypeptide comprises

[0112] a sequence (such as a FWRH1 sequence) comprising or consisting of a FWRH1 sequence as shown in Table 1 and

[0113] a sequence (such as a FWRH2 sequence) comprising or consisting of a FWRH2 sequence as shown in Table 1 and

[0114] a sequence (such as a FWRH3 sequence) comprising or consisting of a FWRH3 sequence as shown in Table 1 and

[0115] a sequence (such as a FWRH4 sequence) comprising or consisting of a FWRH4 sequence as shown in Table 1.

[0116] Suitably the polypeptide comprises three complementarity determining regions (CDRH1-CDRH3). Suitably, the polypeptide comprises four framework regions (FWRH1-FWRH4).

[0117] In one embodiment there is provided a polypeptide comprising or consisting of a sequence sharing 80% or greater, more suitably 90% or greater, sequence identity with any immunoglobulin heavy chain variable domain (VH) sequence as shown in Table 1 (i.e. from N- to C-terminus, the combined sequence of FWRH1, CDRH1, FWRH2, CDRH2, FWRH3, CDRH3, FWRH4, for a single row) or Table 2. More suitably the polypeptide comprises or consists of an immunoglobulin heavy chain variable domain (VH) sequence as shown in Table 1 (i.e. from N- to C-terminus, the combined sequence of FWRH1, CDRH1, FWRH2, CDRH2, FWRH3, CDRH3, FWRH4, for a single row) or Table 2.

[0118] Suitably the polypeptide is an antibody, such as an antibody which belongs to the isotype subclass IGHA1, IGHA2 or IGHG1. Alternatively, the polypeptide is an antibody fragment, such as a F(ab′).sub.2, an Fd, an Fv, an scFv, a VH, or a VHH.

[0119] Suitably the polypeptide binds to the spike protein (S protein) of SARS-CoV-2. More suitably the polypeptide binds to the S1 or S2 domain of the spike protein (S protein), such as the S1 domain of the spike protein (S1 protein).

[0120] An antibody fragment as used herein refers to a portion of an antibody that binds to a target. Examples of binding fragments encompassed within the term include a Fab, a F(ab′).sub.2, an Fd, an Fv, an scFv, a VH, or a VHH.

[0121] Suitably the polypeptide comprises light chain CDRs (i.e. CDRL1, CDRL2, CDRL3). More suitably the polypeptide comprises light chain CDRs and framework regions (i.e. FWRL1, CDRL1, FWRL2, CDRL2, FWRL3, CDRL3 and FWRL4). More suitably the polypeptide is an antibody comprising both heavy and light chains. Suitably the light chain CDRs and/or frameworks and/or light chains are any one or more of those disclosed in Xue et al. Biochem Biophys Res Commun. 515(3):481-486, (2019).

[0122] Suitably, the polypeptide of the invention is isolated. An “isolated” polypeptide is one that is removed from its original environment. For example, a naturally-occurring polypeptide of the invention is isolated if it is separated from some or all of the coexisting materials in the natural system.

[0123] In one embodiment there is provided a pharmaceutical composition comprising the polypeptide and one or more pharmaceutically acceptable diluents or carriers. Suitably the composition comprises at least one further, different polypeptide according to any preceding claim. Suitably the composition comprises at least one further active agent.

[0124] In one embodiment the polypeptide or pharmaceutical composition is for use in suppressing or treating a disease or disorder mediated by infection of SARS-CoV-2, such as COVID-19, or for providing prophylaxis to a subject at risk of infection of SARS-CoV-2, such as COVID-19. In one embodiment there is provided a method of suppressing or treating a disease or disorder mediated by infection of SARS-CoV-2, such as COVID-19 or for providing prophylaxis to a subject at risk of infection of SARS-CoV-2, such as COVID-19, comprising administering to a person in need thereof a therapeutically effective amount of the polypeptide or pharmaceutical composition.

[0125] In one embodiment there is provided a polynucleotide encoding a polypeptide sequence disclosed in Table 1 or Table 2. In one embodiment there is provided a polynucleotide encoding an immunoglobulin heavy chain variable domain recited in Table 1 or Table 2. In one embodiment there is provided a vector comprising the polynucleotide.

[0126] The present invention will now be further described by means of the following non-limiting example.

Equivalents and Scope

[0127] While various invention embodiments have been particularly shown and described in the present disclosure, it will be understood by those skilled in the art that various changes in form and details may be made without departing from the spirit and scope of the embodiments disclosed herein and set forth in the appended claims.

[0128] Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments described herein. The scope of the present disclosure is not intended to be limited to the above description, but rather is as set forth in the appended claims.

[0129] In the claims, articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The disclosure includes embodiments in which exactly one member of a group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all group members are present in, employed in, or otherwise relevant to a given product or process.

[0130] It is also noted that the term “comprising” is intended to be open and permits but does not require the inclusion of additional elements or steps. When the term “comprising” is used herein, the terms “consisting of” and “or including” are thus also encompassed and disclosed.

[0131] Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or subrange within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.

[0132] In addition, it is to be understood that any particular embodiment of the present disclosure that falls within the prior art may be explicitly excluded from any one or more of the claims. Since such embodiments are deemed to be known to those of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiments of compositions disclosed herein can be excluded from any one or more claims, for any reason, whether or not related to the existence of prior art.

[0133] All cited sources, for example, references, publications, databases, database entries, and art cited herein, are incorporated into this application by reference, even if not expressly stated in the citation. In case of conflicting statements of a cited source and the instant application, the statement in the instant application shall control.

[0134] Section and table headings are not intended to be limiting.

EXAMPLES

Example 1

COVID-19 Disease Samples

[0135] Blood samples were collected from n=19 patients admitted to hospital with acute COVID-19 pneumonia. The mean age of patients was 50.2 (SD 18.5) years and 13 (68%) were male. All patients had a clinical history consistent with COVID-19 and typical radiological changes. Seventeen patients had a confirmatory positive PCR test for SARS-CoV-2. The patients experienced an average of 11 days (range 4-20) of symptoms prior to the day on which the blood sample was collected. Nine of the patients were still requiring hospital care but not oxygen therapy on day of sample collection (WHO Ordinal Scale Score 3), while eight were hospitalised requiring oxygen by conventional mask or nasal prongs (WHO Ordinal Scale Score 4) and two were hospitalised with severe COVID-19 pneumonia requiring high-flow nasal oxygen (WHO Ordinal Scale Score 5). On the day of sample collection, the direct clinical care team considered two patients to be deteriorating, four improving and the remaining thirteen were clinically stable.

SARS-CoV-2 Infection Results in a Stereotypic B Cell Response

[0136] IGHA and IGHG BCR sequencing yielded on average 135,437 unique sequences, and 23,742 clonotypes per sample (Table 3). To characterise the B cell response in COVID-19, we compared this BCR repertoire data to BCR repertoire data from healthy controls obtained in a separate study.sup.15. Comparing IGHV gene segment usage revealed a significantly different IGHV gene usage in COVID-19 patients compared to the healthy controls, most notably with increases in the usage of IGHV2-5 (2.6×IGHA, 1.0×IGHG increase), IGHV2-70 (4.6×IGHA, 4.1×IGHG increase), IGHV3-30 (2.0×IGHA, 1.4×IGHG increase), IGHV5-51 (3.5×IGHA, 2.0×IGHG increase), and IGHV4-34 (1.4×IGHA, 2.4×IGHG increase) in the COVID-19 patients (FIG. 1A). All of these V gene segments have been previously observed in SARS-CoV-1 or SARS-CoV-2 specific antibodies.sup.16. IGHV4-34 has been shown to bind both autoantigens.sup.17 and commensal bacteria.sup.18 and has been associated with SLE.sup.19. Our data extends this, showing that the proportion of sequences containing the autoreactive AVY & NHS sequence motifs within the IGHV region is significantly more frequent in improving COVID-19 patients compared to stable or deteriorating COVID-19 patients, specifically in the IGHG1 isotype subclass (p-value=0.038; FIG. 6).

[0137] Comparing isotype subclasses showed a significant increase in the relative usage of IGHA1 and IGHG1 in COVID-19 patients (FIG. 1B)—these are the two first isotype subclasses that are switched to upon activation of IGHM.sup.20. There was also an increase in the mean CDRH3 length of the BCRs in the COVID-19 patients, that was most pronounced in the IGHA1, IGHA2 and IGHG1 isotype subclasses (FIG. 1C).

SARS-CoV-2 Infection Stimulates Both Naïve and Memory Responses

[0138] To further investigate the COVID-19-specific B cell response, we analysed the characteristics of the BCR sequences that are consistent with recent B cell activation—somatic hypermutation, and clonal expansion. In healthy controls, for class-switched sequences, there is a clear unimodal distribution of sequences with different numbers of mutations, and a mean mutation count across IGHA and IGHG isotypes of 17.6 (FIG. 2A). In the COVID-19 samples, the mean mutation count was 14.4, and there was a bimodal distribution with a separate peak of sequences with no mutations. This bimodal distribution was most pronounced in the IGHG1, IGHG3, and IGHA1 isotype subclasses, corresponding to the increased isotype usages. Such a distribution is consistent with an expansion of recently class-switched B cells that have yet to undergo somatic hypermutation. There was considerable variation between participants in the proportion of unmutated sequences (FIG. 5A, FIG. 5B, FIG. 5C, and FIG. 5D), which had no significant correlation with the number of days since symptom onset (R=0.09, p=0.72), but was lower in the deteriorating compared to improving patients (FIG. 2B)

[0139] To investigate differential clonal expansion between patients, the Shannon diversity index of each repertoire was calculated (while accounting for differences in read depth through subsampling). A more diverse repertoire is indicative of a greater abundance of different clonal expansions. The BCR repertoires of the COVID-19 patients were significantly more diverse than the BCR repertoires of the healthy controls (FIG. 2C); this increase in diversity was positively correlated with an increased proportion of unmutated sequences (R=0.44, p=0.061; FIG. 2D). Interestingly, when we investigated the largest clonal expansions, despite having a more diverse repertoire, the largest clonal expansions in the COVID-19 samples were larger than in the healthy controls (FIG. 2E). These large clonal expansions were also highly mutated and had similar levels of mutation between the COVID-19 samples and the healthy controls (FIG. 2F).

Sequence Convergence can be Used to Identify Putative SARS-CoV-2 Specific Antibodies

[0140] Given the skewing of the B cell response in the COVID-19 patients to specific IGHV genes, we next investigated whether the same similarity was also seen on the BCR sequence level between different participants. Such convergent BCR signatures have been observed in response to other infectious diseases.sup.21, and may be used to identify disease-specific antibody sequences.

[0141] Of the 435,420 total clonotypes across all the COVID-19 patients, 9,646 (2.2%) were shared between at least two of the participants (FIG. 3A). As convergence could occur by chance or be due to an unrelated memory response from commonly encountered pathogens, the healthy control dataset was used to subtract irrelevant BCR sequences. Of the 9,646 convergent clonotypes, 1,442 (14.9%) were also present in at least one of the 40 healthy control samples. As expected, of the convergent clonotypes that were also present in the healthy control samples, the mean mutation count was significantly greater (FIG. 3B), and the mean CDRH3 length significantly shorter (FIG. 3C) than the convergent clonotypes that were unique to the COVID-19 patients.

[0142] To identify a set of SARS-CoV-2-specific antibody sequences with high confidence, we identified 777 convergent clonotypes that were shared between at least four of the COVID-19 patients (see Tables 1 and 2, which also include further convergent clonotypes from another set of samples), but not seen in the healthy controls. In parallel, for a comparison of convergent signatures, we performed the same analysis on a cohort of seven metastatic breast cancer patient biopsy samples.sup.22, which identified 469 convergent clonotypes. These convergent clonotypes were highly specific to each disease cohort (FIG. 3D). The 777 COVID-19 convergent clonotypes had low mutation levels, with a mean mutation count of 2, and only 51 clonotypes with a mean mutation greater than 5. The sequences within the convergent clonotypes were primarily of the IGHG1 (70%) and IGHA1 (16%) subclasses (FIG. 7A). The convergent clonotypes used a diversity of IGHV gene segments, with IGHV3-30, IGHV3-30-3 and IGHV3-33 as the most highly represented (FIG. 7B). This IGHV gene usage distribution differs between that of the total repertoire, and IGHV3-30 is also the most highly used IGHV gene in the CoV-AbDab.sup.16.

[0143] We next tested whether these convergent clonotypes correlated with disease severity. Indeed, 25 of these convergent clonotypes were found to associate with clinical symptoms after correcting for multiple testing, of which 22 were observed at a significantly higher frequency in improving patients (FIG. 3E, FIG. 8A, and FIG. 8B). This is a significantly higher proportion associated with clinical symptoms compared to that expected by chance (p-value=0.018 by random permutations of labels). Interestingly, some of these clonotypes are common in patients comprising >0.1% of a patient's repertoire. Furthermore, the convergent clonotypes that are associated with clinical symptoms cluster together (FIG. 3F) and are found primarily in the IGHA1 and IGHG1 isotypes (FIG. 3G).

BCR Sequence Convergence Signatures are Shared Between Different COVID-19 Studies in Different Locations and from Different Anatomical Sites

[0144] To further explore whether the convergent clonotypes observed in our study were indeed disease specific, and to determine whether such convergence was common across studies and geographic regions, we compared these 777 convergent clonotypes to public B cell datasets.

[0145] First, we compared our data to RNAseq data of bronchoalveolar lavage fluid obtained from five of the first infected patients in Wuhan, China.sup.23. These samples were obtained for the purpose of metagenomic analyses to identify the aetiological agent of the novel coronavirus but were re-analysed to determine whether we could extract any transcripts from BCRs. From the 10,038,758 total reads, we were able to identify 16 unique CDR3 AA sequences (Table 4). Of these, one had an exact AA match to a clonotype in our data and shared the same V gene segment (IGHV3-15), and J gene segment (IGHJ4) usage (FIG. 4A). This clonotype had a CDRH3 AA length of 12, so such a match is unlikely to occur due to chance alone. The clonotype contained 699 total sequences and was convergent between 8 of our 19 COVID-19 patients, but not present in the healthy controls. The clonotype was highly diverse, and the sequences had evidence of low mutation from germline, with a mean mutation count over all sequences of 4.8 (FIG. 7B).

[0146] Next, we compared our 777 convergent clonotypes to CoV-AbDab—the Coronavirus Antibody Database [accessed 10 May 2020].sup.16. At the time of access, this database contained 80 non-redundant CDRH3 sequences from published and patented antibodies proven to bind SARS-CoV-1 and/or SARS-CoV-2. We found 6 of our clonotypes to have high CDRH3 homology to the antibodies in CoV-AbDab (FIG. 4B and FIG. 10). The most striking similarity was to S304, a previously described SARS-CoV-1 and SARS-CoV-2 receptor-binding domain antibody able to contribute to viral neutralisation.sup.24. One of the 777 convergent clonotypes contained sequences with an exact CDRH3 AA sequence match and utilised the same IGHV and IGHJ germline gene segments to S304. This clonotype was convergent across 6 patients and had a mean mutation count of 1.1.

[0147] Finally, we compared our data to a publicly available BCR deep sequencing dataset from six COVID-19 patients from Stanford, USA. 405 of our 777 convergent clonotypes matched to sequences in this dataset (FIG. 4C), showing the high level of convergence between studies. The average number of clonotype matches to the Stanford COVID-19 patient repertoires was 95, but this varied considerably between patients and timepoints. Two of the six patients were seronegative at the day of sampling (7451 and 7453), and these two patients had the fewest clonotype matches (16 and 14 respectively). Patient 7453 had an additional sample taken two days later (following seroconversion), and at this point had a large increase in the number of clonotype matches to 204.

Supplementary Information

[0148]

TABLE-US-00003 TABLE 3 Summary of number of unique sequences, and number of clonotypes obtained for each COVID-19 patient Participant ID Unique BCR Sequences Clonotypes 1 47878 15456 2 257570 53168 3 33099 9616 4 37138 10754 5 198732 20036 6 233283 26181 7 51305 22276 8 39303 9391 9 221870 18278 10 54645 9255 11 202896 41132 12 31035 6791 13 40995 14782 14 171231 21373 15 280310 36446 16 29620 8736 17 253037 34805 18 60316 15068 19 329055 77557

TABLE-US-00004 TABLE 4 CDRH3 AA sequences identified from bronchoalveolar RNAseq data bestVHit bestJHit aaSeqCDR3 SEQ ID NO IGHV2-26 IGHJ3 CARDSGRHLGPFDIW 1999 IGHV1-2 IGHJ3 CATPYYYDGGLDAFDIW 2000 IGHV3-74 IGHJ5 CARDLSRTNWFDPW 2001 IGHV3-15 IGHJ4 CTTDLHDYGDSDYW 2002 IGHV3-15 IGHJ4 CTTDFGGMITFGGVLRRI 2003 IGHV3-21 IGHJ4 CARAQSRGGYDSFFDFW 2004 IGHV3-21 IGHJ4 CGRGGPGTGIDYW 2005 IGHV4-59 IGHJ5 CARGGQYNNWFAPW 2006 IGHV3-74 IGHJ5 CVRDLSRTNWFDPW 2007 IGHV3-15 IGHJ4 YTRDLHDYGDSDYW 2008 IGHV3-23 IGHJ3 CAKIPSFLSDYDVHPNDAIDIW 2009 IGHV5-10-1 IGHJ4 CARHPQGAQFSNLGTYYFDYW 2010 IGHV4-59 IGHJ4 CARDGEYGGLAMW 2011 IGHV5-51 IGHJ6 CARPGTYYDILTGYSNHGMDVW 2012 IGHV4-39 IGHJ5 CARHASFRGTNYNWFDPW 2013 IGHV3-53 IGHJ5 CARDTSTEDVAWWFDPW 2014

[0149] The CDRH3 identified in our SARS-CoV-2 patient dataset is SEQ ID NO: 2002.

Discussion

[0150] We have used deep sequencing of the BCR heavy chain repertoire to evaluate the B cell responses of 19 individuals with COVID-19. In agreement with previous studies, there was a skewing of the repertoire in the response to SARS-CoV-2 infection, with an increased use of certain V genes, and an increase in the proportion of antibodies with longer CDRH3s, and an altered isotype subclass distribution.sup.14. The significantly increased usage of IGHA1 observed in the COVID-19 patients is in line with mucosal responses, where the longer hinge in IGHA1 compared to IGHA2 may offer advantages in antigen recognition by allowing higher avidity bivalent interactions with distantly spaced antigens.

[0151] As anticipated, given the novel nature of the virus, that SARS-CoV-2 infection largely stimulated a characteristically naïve response, rather than a reactivation of pre-existing memory B cells—(1) there was an increased prevalence of unmutated antigen-experienced class-switched BCR sequences, (2) an increase in the diversity of class-switched IGHA and IGHG BCRs, and (3) an increase in the usage of isotype subclasses that are associated with viral immunity. These observations are consistent with an increase in the frequency of recently activated B cells in response to SARS-CoV-2. In addition to the naïve response, there was also evidence of a proportion of the response arising from memory recall. In the COVID-19 patients, the largest clonal expansions were highly mutated, equivalent to the level observed in healthy control cohort. Such a secondary response to SARS-CoV-2 has been previously observed.sup.25, and may be due to recall of B cells activated in response to previously circulating human coronaviruses, as recently highlighted.sup.26,27.

[0152] We observed a potential relationship between repertoire characteristics and disease state, with improving patients showing a tendency towards a higher proportion of unmutated sequences. The increased prevalence of autoreactive IGHV4-34 sequences in improving COVID-19 patients compared to stable or deteriorating COVID-19 patients potentially suggests a role for natural or autoreactive antibodies in resolving infection and lower risk of pathology. However, this will need to be confirmed using larger sample cohorts. There is a clear need to expand on these findings by deepening the data pool and gathering more clinical data to aid understanding of the differences between individuals that respond with mild versus severe disease and have different recovery patterns. Building upon these observations could help to inform the future development of diagnostic assays to monitor and predict the progression of disease in infected patients.

[0153] A large number (777) of highly convergent clonotypes unique to COVID-19 were identified (see Table 1 and Table 2, which also include further convergent clonotypes from a separate set of samples). Our approach of subtracting the convergent clonotypes also observed in healthy controls.sup.15, allowed us to identify convergence specific to the disease cohort. The unbiased nature of the BCR repertoire analysis approach means that, whilst these convergent clonotypes are likely to include many antibodies to the spike protein and other parts of the virus they may also include other protective antibodies, including those to host proteins. It is expected that the heavy chains we have identified, and components of these heavy chains, will find utility in the treatment, prevention and diagnosis of COVID-19. Furthermore, characterisation of the heavy chains we have identified, coupled with matched light chains to generate functional antibodies will permit analysis of the binding sites and neutralising potential of these antibodies. The report that plasma derived from recently recovered donors with high neutralising antibody titres can improve the outcome of patients with severe disease.sup.28, supports the hypotheses that intervention with a therapeutic antibody has the potential to be an effective treatment. A manufactured monoclonal antibody or combination of antibodies would also provide a simpler, scalable and safer approach than plasma therapy.

[0154] Sequence convergence between our 777 convergent clonotypes with heavy chains from published and patented SARS-CoV-1 and SARS-CoV-2 antibodies.sup.16 supports several observations. Firstly, it demonstrates that our approach of finding a convergent sequence signature is a useful method for enriching disease-specific antibodies, as we find matches to known SARS-CoV spike-binding antibodies. Secondly, it shows that the clonotypes observed in response to SARS-CoV-2 overlap with those to SARS-CoV-1, presumably explained by the relatively high homology of the two related viruses 3. Indeed, here we show that there is an overrepresentation of clonotypes that correlate with patient clinical symptoms than is expected by chance, and these BCR sequences are associated with the dominant IgA1 and IgG1 responses. Finally, it shows that the convergence extends beyond our UK COVID-19 disease cohort.

[0155] Further evidence for convergence extending beyond our disease cohort came from the comparisons of our 777 convergent clonotypes to deep sequencing datasets from China.sup.23 and the USA.sup.14. The dataset from the USA is also from BCR sequencing of the peripheral blood of COVID-19 patients, and here we found matches to 405 of our 777 clonotypes. The dataset from China was from total RNA sequencing of the bronchoalveolar lavage fluid of SARS-CoV-2 infected patients. Only 16 unique CDRH3 sequences could be identified in this whole dataset, but one of them matched a convergent clonotype in the current study, showing that convergence can be seen both between different locations, and different sample types. We believe that the identification of such high BCR sequence convergence between geographically distinct and independent datasets could be highly significant and validates the disease association of the clonotypes, as well as the overall approach.

[0156] In summary, our BCR repertoire analysis provides information on the specific nature of the B cell response to SARS-CoV-2 infection. The information generated has the potential to facilitate the treatment of COVID-19 by supporting diagnostic approaches to predict the progression of disease, informing vaccine development and enabling the development of therapeutic antibody treatments and prophylactics.

Materials and Methods

Clinical Information Gathering

[0157] Peripheral blood was obtained from patients admitted with acute COVID-19 pneumonia to medical wards at Barts Health NHS Trust, London, UK, after informed consent by the direct care team (NHS HRA RES Ethics 19/SC/0361). Venous blood was collected in EDTA Vacutainers (BD). Patient demographics and clinical information relevant to their admission were collected by members of the direct care team, including duration of symptoms prior to blood sample collection. Current severity was mapped to the WHO Ordinal Scale of Severity. Whether patients at time of sample collection were clinically Improving, Stable or Deteriorating was subjectively determined by the direct clinical team prior to any sample analysis. This determination was primarily made on the basis of whether requirement for supplemental oxygen was increasing, stable, or decreasing comparing current day to previous three days.

Sample Collection and Initial Processing

[0158] Blood samples were centrifuged at 150×g for 15 minutes at room temperature to separate plasma. The cell pellet was resuspended with phosphate-buffered saline (PBS without calcium and magnesium, Sigma) to 20 ml, layered onto 15 ml Ficoll-Paque Plus (GE Healthcare) and then centrifuged at 400×g for 30 minutes at room temperature without brake. Mononuclear cells (PBMCs) were extracted from the buffy coat and washed twice with PBS at 300×g for 8 min. PBMCs were counted with Trypan blue (Sigma) and viability of >96% was observed. 5×10.sup.6 PBMCs were resuspended in RLT (Qiagen) and incubated at room temperature for 10 min prior to storage at −80° C. Consecutive donor samples with sufficient RLT samples progressed to RNA preparation and BCR preparation and are included in this manuscript.

[0159] Metastatic breast cancer biopsy samples were collected and RNA extracted as part of a previously reported cohort.sup.22.

RNA Prep & BCR Sequencing

[0160] Total RNA from 5×10.sup.6 PBMCs was isolated using RNeasy kits (Qiagen). First-strand cDNA was generated from total RNA using SuperScript RT IV (Invitrogen) and IgA and IgG isotype specific primers.sup.29 including UMIs at 50° C. for 45 min (inactivation at 80° C. for 10 min).

[0161] The resulting cDNA was used as template for High Fidelity PCR amplification (KAPA, Roche) using a set of 6 FR1-specific forward primers.sup.29 including sample-specific barcode sequences (6 bp) and a reverse primer specific to the RT primer (initial denaturation at 95° C. for 3 min, 25 cycles at 98° C. for 20 sec, 60° C. for 30 sec, 72° C. for 1 min and final extension at 72° C. for 7 min). The amount of Ig amplicons (˜450 bp) was quantified by TapeStation (Beckman Coulter) and gel-purified.

[0162] Dual-indexed sequencing adapters (KAPA) were ligated onto 500 ng amplicons per patient using the HyperPrep library construction kit (KAPA) and the adapter-ligated libraries were finally PCR-amplified for 3 cycles (98° C. for 15 sec, 60° C. for 30 sec, 72° C. for 30 sec, final extension at 72° C. for 1 min). Pools of 10 and 9 libraries were sequenced on an Illumina MiSeq using 2×300 bp chemistry.

Sequence Processing

[0163] The Immcantation framework was used for sequence processing.sup.30,31 Briefly, paired-end reads were joined based on a minimum overlap of 20 nt, and a max error of 0.2, and reads with a mean phred score below 20 were removed. Primer regions, including UMIs and sample barcodes, were then identified within each read, and trimmed. Together, the sample barcode, UMI, and constant region primer were used to assign molecular groupings for each read. Within each grouping, usearch.sup.32, was used to subdivide the grouping, with a cutoff of 80% nucleotide identity, to account for randomly overlapping UMIs. Each of the resulting groupings is assumed to represent reads arising from a single RNA. Reads within each grouping were then aligned, and a consensus sequence determined.

[0164] For each processed sequence, IgBlast.sup.33 was used to determine V, D and J gene segments, and locations of the CDRs and FWRs. Isotype was determined based on comparison to germline constant region sequences. Sequences annotated as unproductive by IgBlast were removed. The number of mutations within each sequence was determined using the shazam R package.sup.31.

[0165] Sequences were clustered to identify those arising from clonally related B cells; a process termed clonotyping. Sequences from all samples were clustered together to also identify convergent clusters between samples. Clustering was performed using a previously described algorithm.sup.34. Clustering required identical V and J gene segment usage, identical CDRH3 length, and allowed 1 AA mismatch for every 10 AAs within the CDRH3. Cluster centers were defined as the most common sequence within the cluster. Lineages were reconstructed from clusters using the alakazam R package.sup.35. The similarity tree of the convergent clonontype CDR3 sequences was generated through a kmer similarity matrix between sequences in R.

Public Healthy Control Data Processing

[0166] The healthy control BCR sequence dataset used here has been described previously.sup.15. Only samples from participants aged 10 years or older, and from peripheral blood were used, resulting in a mean age of 28 (range: 11-51). Furthermore, only class-switched sequences were considered.

Public SARS-CoV-2 Bronchoalveolar Lavage RNAseq Data Processing

[0167] The bronchoalveolar lavage data comes from a previously published study of SARS-CoV-2 infection.sup.23 with data available under the PRJNA605983 BioProject on NCBI. MIXCR v3.0.3 was used, with default settings, to extract reads mapping to antibody genes from the total RNASeq data.sup.36.

Public CoV-AbDab Data Processing

[0168] All public CDRH3 AA sequences associated with published or patented SARS-CoV-1 or SARS-CoV-2 binding antibodies were mined from CoV-AbDab.sup.16, downloaded on 10 May 2020. A total of 80 non-redundant CDRH3s were identified (100% identity threshold). These sequences were then clustered alongside the representative CDRH3 sequence from each of our 777 convergent clones using CD-HIT.sup.37, at an 80% sequence identity threshold (allowing at most a CDRH3 length mismatch of 1 AA). Cluster centres containing at least one CoV-AbDab CDRH3 and one convergent clone CDRH3 were further investigated.

Public COVID-19 BCR Sequence Data Processing

[0169] The fourteen MiSeq “read 1” FASTQ datasets from the six SARS-CoV-2 patients analysed in Nielsen et al..sup.14 were downloaded from the Sequence Read Archive.sup.38. IgBlast.sup.33 was used to identify heavy chain V, D, and J gene rearrangements and antibody regions. Unproductive sequences, sequences with out-of-frame V and J genes, and sequences missing the CDRH3 region were removed from the downstream analysis. Sequences with 100% amino acid and isotype matches were collapsed. To circumvent the disparity in collapsed dataset sizes between pairs of replicates, we selected the replicate with the highest number of sequences for downstream analysis.

Convergent Clonotyping Matching to Public Repertoires

[0170] The public SARS-CoV-2-positive.sup.14 and healthy control BCR repertoires.sup.39 were scanned for clonotype matches to our 777 convergent clonotype cluster centres. A BCR repertoire sequence was determined as a match if it had identical V and J genes, the same length CDRH3, and was within 1 AA mismatch per 10 CDRH3 AAs to a convergent clonotype representative sequence.

Statistical Analysis and Graphing

[0171] Statistical analysis and plotting were performed using R.sup.40. Plotting was performed using ggplot2.sup.41. Sequence logos were created using ggseqlogo.sup.42. Specific statistical tests used are detailed in the figure descriptions. Correlations of IGHV4-34 autoreactive motifs and convergent clonotypes was performed by manova in R.

REFERENCES

[0172] 1. Lu, H., Stratton, C. W. & Tang, Y. W. Outbreak of pneumonia of unknown etiology in Wuhan, China: The mystery and the miracle. Journal of Medical Virology vol. 92 401-402 (2020). [0173] 2. Huang, C. et al. Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China. Lancet 395, 497-506 (2020). [0174] 3. Wan, Y., Shang, J., Graham, R., Baric, R. S. & Li, F. Receptor Recognition by the Novel Coronavirus from Wuhan: an Analysis Based on Decade-Long Structural Studies of SARS Coronavirus. J. Virol. 94, (2020). [0175] 4. Chen, N. et al. Epidemiological and clinical characteristics of 99 cases of 2019 novel coronavirus pneumonia in Wuhan, China: a descriptive study. Lancet 395, 507-513 (2020). [0176] 5. Mulangu, S. et al. A randomized, controlled trial of Ebola virus disease therapeutics. N. Engl. J. Med. 381, 2293-2303 (2019). [0177] 6. Gogtay, N. J. et al. Comparison of a Novel Human Rabies Monoclonal Antibody to Human Rabies Immunoglobulin for Postexposure Prophylaxis: A Phase 2/3, Randomized, Single-Blind, Noninferiority, Controlled Study. Clin. Infect. Dis. 66, 387-395 (2018). [0178] 7. Johnson, S. et al. Development of a Humanized Monoclonal Antibody (MEDI-493) with Potent In Vitro and In Vivo Activity against Respiratory Syncytial Virus. J. Infect. Dis. 176, 1215-1224 (1997). [0179] 8. Wang, S. F. et al. Antibody-dependent SARS coronavirus infection is mediated by antibodies against spike proteins. Biochem. Biophys. Res. Commun. 451, 208-214 (2014). [0180] 9. Tetro, J. A. Is COVID-19 receiving ADE from other coronaviruses? Microbes Infect. 22, 72-73 (2020). [0181] 10. Sharma, A. It is too soon to attribute ADE to COVID-19. Microbes and Infection (2020) doi:10.1016/j.micinf.2020.03.005. [0182] 11. Wang, Q. et al. Immunodominant SARS coronavirus epitopes in humans elicited both enhancing and neutralizing effects on infection in non-human primates. ACS Infect. Dis. 2, 361-376 (2016). [0183] 12. Brouwer, P. et al. Potent neutralizing antibodies from COVID-19 patients define multiple targets of vulnerability. bioRxiv (2020) doi:10.1101/2020.05.12.088716. [0184] 13. Andreano, E. et al. Identification of neutralizing human monoclonal antibodies from Italian Covid-19 convalescent patients. bioRxiv (2020) doi:10.1101/2020.05.05.078154. [0185] 14. Nielsen, S. et al. B cell clonal expansion and convergent antibody responses to SARS-CoV-2. Res. Sq. (2020) doi:10.21203/rs.3.rs-27220/v1. [0186] 15. Ghraichy, M. et al. Maturation of naïve and antigen-experienced B-cell receptor repertoires with age. bioRxiv (2019) doi:10.1101/609651. [0187] 16. Raybould, M. I. J., Kovaltsuk, A., Marks, C. & Deane, C. M. CoV-AbDab: the Coronavirus Antibody Database. bioRxiv (2020) doi:10.1101/2020.05.15.077313. [0188] 17. Pascual, V. et al. Nucleotide sequence analysis of the V regions of two IgM cold agglutinins: Evidence that the V(H)4-21 gene segment is responsible for the major cross-reactive idiotype. J. Immunol. 146, 4385-4391 (1991). [0189] 18. Schickel, J. N. et al. Self-reactive VH4-34-expressing IgG B cells recognizecommensal bacteria. J. Exp. Med. 214, 1991-2003 (2017). [0190] 19. Tipton, C. M. et al. Diversity, cellular origin and autoreactivity of antibody-secreting cell population expansions in acute systemic lupus erythematosus. Nat. Immunol. 16, 755-765 (2015). [0191] 20. Horns, F. et al. Lineage tracing of human B cells reveals the in vivo landscape of human antibody class switching. Elife 5, 1-20 (2016). [0192] 21. Parameswaran, P. et al. Convergent Antibody Signatures in Human Dengue. Cell Host Microbe 13, 691-700 (2013). [0193] 22. De Mattos-Arruda, L. et al. The Genomic and Immune Landscapes of Lethal Metastatic Breast Cancer. Cell Rep. 27, 2690-2708.e10 (2019). [0194] 23. Zhou, P. et al. A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature 579, 270-273 (2020). [0195] 24. Pinto, D. et al. Structural and functional analysis of a potent sarbecovirus neutralizing antibody. bioRxiv (2020) doi:10.1101/2020.04.07.023903. [0196] 25. Wec, A. Z. et al. Broad sarbecovirus neutralizing antibodies define a key site of vulnerability on the SARS-CoV-2 spike protein. bioRxiv (2020) doi:10.1101/2020.05.15.096511. [0197] 26. Grifoni, A. et al. Targets of T cell responses to SARS-CoV-2 coronavirus in humans with COVID-19 disease and unexposed individuals. Cell (2020) doi:10.1016/j.cell.2020.05.015. [0198] 27. Ng, K. et al. Pre-existing and de novo humoral immunity to SARS-CoV-2 in humans. BioRxiv (2020) doi:10.1101/2020.05.14.095414. [0199] 28. Duan, K. et al. Effectiveness of convalescent plasma therapy in severe COVID-19 patients. Proc. Natl. Acad. Sci. 117, 202004168 (2020). [0200] 29. van Dongen, J. J. M. et al. Design and standardization of PCR primers and protocols for detection of clonal immunoglobulin and T-cell receptor gene recombinations in suspect lymphoproliferations: report of the BIOMED-2 Concerted Action BMH4-CT98-3936. Leukemia 17, 2257-317 (2003). [0201] 30. Vander Heiden, J. A. et al. pRESTO: a toolkit for processing high-throughput sequencing raw reads of lymphocyte receptor repertoires. Bioinformatics 30, 1930-2 (2014). [0202] 31. Gupta, N. T. et al. Change-O: A toolkit for analyzing large-scale B cell immunoglobulin repertoire sequencing data. Bioinformatics 31, 3356-3358 (2015). [0203] 32. Edgar, R. C. Search and clustering orders of magnitude faster than BLAST. Bioinformatics 26, 2460-2461 (2010). [0204] 33. Ye, J., Ma, N., Madden, T. L. & Ostell, J. M. IgBLAST: an immunoglobulin variable domain sequence analysis tool. Nucleic Acids Res. 41, W34-40 (2013). [0205] 34. Galson, J. D. et al. BCR repertoire sequencing: different patterns of B cell activation after two Meningococcal vaccines. Immunol. Cell Biol. 93, 885-95 (2015). [0206] 35. Vander Heiden, J. A. & Gupta, N. alakazam: Immunoglobulin Clonal Lineage and Diversity Analysis. R Packag. version 0.2.0 (2015). [0207] 36. Bolotin, D. A. et al. MiXCR: software for comprehensive adaptive immunity profiling. Nat. Methods 12, 380-381 (2015). [0208] 37. Fu, L., Niu, B., Zhu, Z., Wu, S. & Li, W. CD-HIT: Accelerated for clustering the next-generation sequencing data. Bioinformatics 28, 3150-3152 (2012). [0209] 38. Leinonen, R., Sugawara, H. & Shumway, M. The sequence read archive. Nucleic Acids Res. 39, (2011). [0210] 39. Briney, B., Inderbitzin, A., Joyce, C. & Burton, D. R. Commonality despite exceptional diversity in the baseline human antibody repertoire. Nature 566, 393-397 (2019). [0211] 40. Team, R. D. C. R: A language and environment for statistical computing. R Found. Stat. Comput. Vienna, Austria (2008). [0212] 41. Wickham, H. ggplot2: Elegant Graphics for Data Analysis. (Springer; 1st ed. 2009. Corr. 3rd printing 2010 edition, 2009). [0213] 42. Wagih, O. Ggseqlogo: A versatile R package for drawing sequence logos. Bioinformatics 33, 3645-3647 (2017). [0214] Throughout the specification and the claims which follow, unless the context requires otherwise, the word ‘comprise’, and variations such as ‘comprises’ and ‘comprising’, will be understood to imply the inclusion of a stated integer, step, group of integers or group of steps but not to the exclusion of any other integer, step, group of integers or group of steps. All patents and patent applications mentioned throughout the specification of the present invention are herein incorporated in their entirety by reference. The invention embraces all combinations of preferred and more preferred groups and suitable and more suitable groups and embodiments of groups recited above.