NANO ANTIBODY AND USE THEREOF

Abstract

Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX.sub.1AMGWFRQAPGKEREX.sub.2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X.sub.1 is selected from Y or F, and X.sub.2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.

Claims

1. A nano antibody, wherein the nano antibody comprises CDR1, CDR2 and CDR3; the amino acid sequence of CDR1 is SEQ ID NO: 9 FTFSSX.sub.3A, where X.sub.3 is selected from any one of F and Y; the amino acid sequence of CDR2 is SEQ ID NO: 10 SGGGNT; and the amino acid sequence of CDR3 is SEQ ID NO: 11 TPGGRLWYYRYD.

2. The nano antibody according to claim 1, wherein the amino acid sequence of the nano antibody is SEQ ID NO: 1, EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX.sub.1AMGWFRQAPGKEREX.sub.2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS, where X.sub.1 is selected from Y or F, and X.sub.2 is selected from F or L.

3. The nano antibody according to claim 2, wherein the amino acid sequence of the nano antibody is SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4.

4. The nano antibody according to claim 3, wherein the coding gene of the nano antibody is SEQ ID NO: 6, SEQ ID NO: 7 or SEQ ID NO: 8.

5. The use of the nano antibody according to claim 1 in the preparation of a drug for treating a disease induced by Charcot-Leyden crystals (CLCs).

6. The use of the nano antibody according to claim 5, wherein the disease induced by CLCs is selected from one or more of allergic disease, hyperimmune disease due to bacterial, fungal or viral infection, leukemia, tumor, and enteritis.

7. The use of the nano antibody according to claim 6, wherein the allergic disease is selected from one or more of asthma, allergic rhinosinusitis, allergic dermatitis, and eosinophilia.

8. A drug for treating an disease induced by CLCs , wherein the drug contains the nano antibody according to claim 1 and pharmaceutically acceptable excipients.

9. The use of the nano antibody according to claim 1 in the preparation of a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.

10. The use of the nano antibody according to claim 9, wherein the use comprises the preparation of a diagnostic reagent for a disease with Charcot-Leyden crystals as test markers; and the disease with Charcot-Leyden crystals as test markers comprises one or more of paragonimiasis westermani, paragonimiasis, amebic dysentery, eosinophilic gastroenteritis, atopic dermatitis in children, or bronchial asthma.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0029] FIG. 1 is a plasmid profile of a Galectin-10 protein expression vector PK300.

[0030] FIG. 2 is a page gel diagram of Pk300 recombinant protein before and after EK digestion, where lane 1 is before EK digestion; lane 2 is after EK digestion; GST+Galectin-10 is 44.6 kDa, Galectin-10 is 16.8 kDa, and the loading volume is 5 .Math.L.

[0031] FIG. 3 is an affinity chromatogram of purified Galectin-10 protein.

[0032] FIG. 4 is a diagram of SDS-PAGE electrophoresis results of purified Galectin-10 protein, where, M: protein molecular weight standard; 1: whole bacteria; 2: precipitate; 3: loading sample (whole bacteria broken supernatant); 4: flow through; 5: wash impurities with eluent; 6: 50% buffer B peak; 7: 50% buffer B; 8: 50% buffer B peak; 9-12: 100% buffer B.

[0033] FIG. 5 is a diagram of SDS-PAGE electrophoresis results of 172# nano antibody (SEQ ID NO: 4), where, M: protein molecular weight standard; 1: whole bacteria; 2: precipitate; 3: loading sample (whole bacteria broken supernatant); 4: flow through; 5-8: 30% buffer B; 9-11: 100% buffer B.

[0034] FIG. 6 is a diagram of SDS-PAGE electrophoresis results of 254# nano antibody (SEQ ID NO: 2), where, M: protein molecular weight standard; 1: whole bacteria; 2: precipitate; 3: loading sample (whole bacteria broken supernatant); 4: flow through; 5: wash with eluent; 6: 5% buffer B peak; 7: 5% buffer B; 8: 5% buffer B peak; 9: 100% buffer B; 10: 100% buffer B; 11: 100% buffer B.

[0035] FIG. 7 is a diagram of SDS-PAGE electrophoresis results of recombinant protein of 225# nano antibody (SEQ ID NO: 2), where, M: protein molecular weight standard; 1: precipitate; 2: loading sample (whole bacteria broken supernatant); 3: flow through; 4-11: 30% buffer B;12-14:100% buffer B.

[0036] FIG. 8 is a diagram of SDS-PAGE electrophoresis results of 225# nano antibody (SEQ ID NO: 4), where, M: protein molecular weight standard; 1: whole bacteria; 2: precipitate; 3: loading sample (whole bacteria broken supernatant); 4: flow through; 5-8: 30% buffer B; 9-11: 100% buffer B.

[0037] FIG. 9 shows a microscope view of Galectin-10 crystals.

[0038] FIG. 10 is a diagram of the process of dissolving crystals by 172# nano antibody (SEQ ID NO: 2).

[0039] FIG. 11 is a diagram of the process of dissolving crystals by 254# nano antibody (SEQ ID NO: 3).

[0040] FIG. 12 is a diagram of the process of dissolving crystals by 225# nano antibody (SEQ ID NO: 4).

[0041] FIG. 13 is a diagram of the buffer control in the process of dissolving crystals.

[0042] FIG. 14 is a plasmid profile of a protein expression vector expressing 172# nano antibody.

[0043] FIG. 15 is a plasmid profile of a protein expression vector expressing 254# nano antibody.

[0044] FIG. 16 is a plasmid profile of a protein expression vector expressing 225# nano antibody.

[0045] FIG. 17 is a plasmid profile of Galectin-10 protein expression vector PK277.

[0046] FIG. 18 is a diagram of SDS-PAGE electrophoresis results of purified Galectin-10 protein with His tag, where, M: protein molecular weight standard; 1: whole bacteria; 2: precipitate; 3: loading sample (whole bacteria broken supernatant); 4: flow through; 5: wash with eluent; 6-9: elution peaks at different concentration gradients.

DETAILED DESCRIPTION

[0047] The following embodiments are used to illustrate the present application, but are not intended to limit the scope of the present application.

[0048] Specific embodiments of the present application will be described in more detail below. These embodiments are provided so that the present application can be understood more thoroughly, and can fully convey the scope of the present application to those skilled in the art.

[0049] As referred to throughout the specification and claims, the term “include” or “comprise” is an open-ended term and should be interpreted as “include but not limited to”. Subsequent descriptions in the specification are preferred embodiments for implementing the present application, however, the descriptions are for the purpose of general principles of the specification and are not intended to limit the scope of the present application. The protection scope of the present application should be determined by the appended claims.

Embodiment 1 Expression and Purification of Galectin-10 Protein

[0050] The amino acid sequence of Galectin-10 protein is shown as SEQ ID NO: 5. A PK300 plasmid profile of a Galectin-10 protein expression vector is shown in FIG. 1, and FIG. 2 shows an electrophoresis diagram of Pk300 recombinant protein before and after EK digestion, where GST+Galectin-10 is 44.6 kDa, Galectin-10 is 16.8 kDa, and the loading volume is 5 .Math.L. After an engineering strain LB liquid medium containing PK300 plasmids is cultured overnight at 37° C. while shaking, the engineering strain is inoculated with an inoculum of 1:100 into a shake flask containing 1 L of LB medium and cultured at 37° C. for 2 h, isopropyl-β-D-thiogalactoside (IPTG) with a final concentration of 1 mmol/ L is added for induction, and cooling to 30° C. is performed for overnight culture. Bacteria are collected by centrifugation at 8000 r/min for 10 min, resuspended with a bacteria breaking solution (20 mM PB, 0.3 M NaCl, pH 7.9) and then sonicated, the broken solution is centrifuged at 12000 r/min for 30 min, and the supernatant is taken for next purification.

[0051] Since the front-end sequence of the recombinant protein contains GST fusion protein, the recombinant protein can be purified by an affinity chromatography column. The buffer used for affinity chromatography is 20 mM PB, pH=7.4, and the buffer used for elution is 1×PBS (10 mM PB, 136 mM NaCl), 100 mM GSH, pH=7.4. The eluted fractions are collected, and the expression of the target protein is tested by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE).

[0052] The supernatant is purified by a GST affinity chromatography column. The chromatogram is shown in FIG. 3. The elution peak appears in 50% buffer B alone, indicating that the protein binds effectively to GST. The flow-through peaks and elution peaks are collected separately and subjected to SDS-PAGE electrophoresis. The results are shown in FIG. 4.

Embodiment 2 Expression of Recombinant Protein of Nano Antibody

[0053] The present invention is based on coding genes (SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8) of nano antibodies of which the amino acid sequences are respectively SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3 to construct expression vectors. Specifically, designing primers to amplify coding genes and then enzymatically digesting, a gene coding sequence is constructed on a protein expression vector by means of enzymatic digestion and T4 link. As shown in FIG. 14, FIG. 15 and FIG. 16, the gene sequence of the 172# nano antibody is linked to the expression vector pET28a, and the 225 and 254 sequences are respectively constructed on the protein expression vector Pet41b. Then the bacteria are shaken to induce protein expression, and the recombinant protein is cultured and expressed by engineering strains containing expression vectors respectively. Specifically, after engineering strains are cultured in an LB liquid medium overnight at 37° C. while shaking, the strains are inoculated with an inoculum of 1:100 into a shake flask containing 1 L of LB medium and cultured at 37° C. for 2 h, isopropyl-β-D-thiogalactoside (IPTG) with a final concentration of 1 mmol/ L is added for induction, and cooling to 16° C. is performed for overnight culture. Bacteria are collected by centrifugation at 8000 r/min for 10 min, resuspended with a bacteria breaking solution (20 mM PB, 150 mM NaCl, pH 8.0) and then sonicated, the broken solution is centrifuged at 12000 r/min for 30 min, and the supernatant is taken for next purification.

[0054] Since the front-end sequence of the recombinant protein contains GST fusion protein, the recombinant protein can be purified by a GST affinity chromatography column. The buffer used for affinity chromatography is 20 mM PB, 150 mM NaCl, pH=7.5, and the buffer used for elution is 20 mM PB, 150 mM NaCl, 100 mM GSH, pH=7.5. The eluted fractions are collected, and the expression of the target protein is tested by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE).

[0055] The results are as follows:

[0056] The supernatant of the recombinant protein of the 172# nano antibody (SEQ ID NO: 2) is purified by a His affinity chromatography column, the size of the target protein eluted by 100% buffer B is consistent with that of the recombinant protein (14.495 kDa), the recombinant protein (lane 10) has a purity of 80% and a concentration of 0.5 mg/mL, and the results of SDS-PAGE electrophoresis are shown in FIG. 5.

[0057] The supernatant of the recombinant protein of the 254# nano antibody (SEQ ID NO: 3) is purified by a GST affinity chromatography column, the size of the target protein of 50% buffer B peak is consistent with that of the recombinant protein (42.54 kDa), and the recombinant protein (sample in lane 6) has a purity of 80% and a concentration of 3 mg/mL. The results of SDS-PAGE electrophoresis are shown in FIG. 6.

[0058] The recombinant protein of the 225# nano antibody (SEQ ID NO: 4) is purified by a His affinity chromatography column. The buffer used for affinity chromatography is 20 mM PB, 150 mM NaCl, pH=7.5, and the buffer used for elution is 20 mM PB, 150 mM NaCl, 500 mM imidazole, pH=7.5. The eluted fractions are collected, and the expression of the target protein is tested by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE). The results of SDS-PAGE electrophoresis are shown in FIG. 7.

[0059] The concentration of the recombinant protein is low after the elution of 100% buffer B by His affinity chromatography, and the front-end sequence of the recombinant protein contains GST fusion protein, so eluent 13 and eluent 14 can be purified again by GST affinity chromatography. The results of SDS-PAGE electrophoresis are shown in FIG. 8.

Embodiment 3 Test on Galectin-10 Protein Crystals

[0060] 1. The PK300 vector expressing the Galectin-10 recombinant protein (Galectin-10 protein with GST tag 5 mg/mL) (the pk300 vector profile is shown in FIG. 1) is digested with an EK enzyme (purchased from Sino Biological Inc., article number S019100750) at 20° C. for 16 hours according to the following proportions. The electrophoresis diagram before and after digestion is shown in FIG. 2. The size of the GST tag + Gal protein before digestion is 44.6 kDa, but the protein is partially degraded. After digestion, the size of the Galectin-10 protein is 16.8 kDa. The band below indicated by the red arrow is Galectin-10 protein.

TABLE-US-00001 Buffer 60 .Math.L PK300 recombinant protein 516 .Math.L EK enzyme 24 .Math.L Total volume 600 .Math.L

[0061] 2. Then 50% PEG3350 and 5 × PBS are added according to the following volumes. Precipitation is performed for 16 hours at 20° C.

TABLE-US-00002 Digestion product 560 .Math.L 5 × PBS 70 .Math.L 50% PEG3350 70 .Math.L Total volume 700 .Math.L

[0062] 3. Centrifugation is performed at 6000 rpm for 5 min, the supernatant is discarded, 500 .Math.L of 1 × PBS is added, followed by uniform mixing.

[0063] Step 3 is repeated twice, then 100 .Math.L of 1 × PBS is added, followed by uniform mixing to obtain Galectin-10 crystals for dissolution test. The obtained crystals are observed under a microscope as shown in FIG. 9, where there are a large number of typical CLCs.

Embodiment 4 Dissolution Scheme of Crystals

[0064] 3 .Math.L of Galectin-10 crystals are pipetted into a 1.5 mL centrifuge tube, then 30 .Math.L of Galectin-10 antibody to be tested is added, shaken for uniform mixing, and 10 .Math.L are immediately pipetted and placed under a microscope for microscopic examination, and pictures are taken at regular intervals until all the crystals in the field of view are completely dissolved, and the time required for dissolution is recorded. During this period, the microscope cannot be shaken and adjusted to prevent the field of view from changing.

[0065] The dissolution process is shown in FIGS. 10-13. Wherein FIG. 10 is a process diagram of dissolving crystals by 172# nano antibody (SEQ ID NO: 2); FIG. 11 is a process diagram of dissolving crystals by 254# nano antibody (SEQ ID NO: 3); FIG. 12 is a process diagram of dissolving crystals by 225# nano antibody (SEQ ID NO: 4); and FIG. 13 is a buffer control diagram in the process of dissolving crystals. It can be seen that the three nano antibodies provided by the present invention can dissolve Gal10 crystals quickly and effectively.

Embodiment 5 Test on Galectin-10 Protein Content

I. Extraction and Purification of Galectin-10 Protein.

[0066] The amino acid sequence of Galectin-10 protein is shown as SEQ ID NO: 5. The plasmid profile of Galectin-10 protein expression vector PK277 is shown in FIG. 17. After an engineering strain LB liquid medium containing PK277 plasmids is cultured overnight at 37° C. while shaking, the strain is inoculated with an inoculum of 1:100 into a shake flask containing 1 L of LB medium and cultured at 37° C. for 2 h, isopropyl-β-D-thiogalactoside (IPTG) with a final concentration of 1 mmol/ L is added for induction, and cooling to 30° C. is performed for overnight culture. Bacteria are collected by centrifugation at 8000 r/min for 10 min, resuspended with a bacteria breaking solution (20 mM PB, 0.3 M NaCl, pH 7.9) and then sonicated, the broken solution is centrifuged at 12000 r/min for 30 min, and the supernatant is taken for next purification.

[0067] The results are as follows:

[0068] The supernatant of the recombinant protein of the Galectin-10 with His tag (SEQ ID NO: 2) is purified by a His affinity chromatography column, the size of the target protein eluted is consistent with that of the recombinant protein (21.3 kDa), the recombinant protein (lane 10) has a purity of 80% and a concentration of 0.3 mg/mL, and the results of SDS-PAGE electrophoresis are shown in FIG. 18. FIG. 18 shows an electrophoresis diagram of Pk277 recombinant protein, where His tag+Galectin-10 is 21.3 kDa, and the loading volume is 5 .Math.L.

II. Test on Galectin-10 Protein Content Using 172# Nano Antibody

1. Test Equipment

[0069] Incubator, plate washer, microplate reader.

2. Test Reagents

[0070] Galectin-10 protein, Galectin-10 monoclonal antibody (including His tag antibody and GST tag antibody), HRP-tagged anti-His tag antibody, anti-GST tag mouse monoclonal antibody, HRP-tagged goat anti-mouse antibody, TMB single-component developing solution.

3. Scope of Application of the Test Scheme

[0071] All Galectin-10 ELISA assays.

4. Test Method

[0072] (1) Phosphate buffered saline (PBS): weigh 8.0 g of NaCl, 0.2 g of KH.sub.2PO.sub.4, and 2.96 g of Na.sub.2HPO.sub.4•12H.sub.2O, add 1000 ml of distilled water with a measuring cylinder, pH 7.5.

[0073] (2) Sample diluent (PBST): add 0.1 ml of Tween-20 to 100 ml of PBS.

[0074] (3) Washing solution (PBST): add 1 ml of Tween-20 to 1000 ml of PBS.

[0075] (4) Stop solution: 1 mol/L H.sub.2SO.sub.4. Note that sulfuric acid is added to water with constant stirring. This reaction releases a lot of heat.

[0076] (5) Coating buffer: weigh 1.5 g of Na.sub.2CO.sub.3, 2.93 g of NaHCO.sub.3, and 0.2 g of NaN.sub.3 (optional), add 1000 ml of distilled water with a measuring cylinder, pH 9.6.

[0077] (6) Blocking solution: dissolve 3 g of bovine serum albumin in 100 ml of coating buffer.

5. Sample Determination (His Tag Antibody)

[0078] 1) Coating: dilute 3 mg/mL Galectin-10 protein with the coating buffer to 1:500, 1:2000, and 1:10000, 100 ul per well, 3 replicate wells for each concentration, 4° C., coat in a wet box overnight. Details are shown in Table 1.

TABLE-US-00003 Galectin-10 protein coating concentration table 1 2 3 A Uncoated Uncoated Uncoated B 1: 500 1: 500 1: 500 C 1: 2000 1: 2000 1: 2000 D 1: 10000 1: 10000 1: 10000

[0079] 2) Wash the plate: shake off the sample, add 300 ul of washing solution with a multichannel pipette and then pour out, wash the plate 4 times, and drop the plate on newspaper twice.

[0080] 3) Block: add 120 ul of blocking solution to each well, place in a wet box at 37° C. for 2 h, and then shake off the blocking solution.

[0081] 4) Add His tag 172# antibody for 1:200 dilution, 100 ul per well, incubate at 37° C. for 1 h in a wet box.

[0082] 5) Wash the plate: same as 2).

[0083] 6) Add HRP-tagged anti-His tag antibody for 1:1000 dilution, 100 ul per well, incubate at 37° C. for 1 h in a wet box.

[0084] 7) Wash the plate: same as 2).

[0085] 8) Add the TMB single-component developing solution, 100 ul per well, dark for 5 min, and add an equal volume of stop solution.

[0086] 9) Perform colorimetric reading at 450 nm wavelength with the microplate reader.

TABLE-US-00004 172# nano antibody test results Concentration of coated Galectin-10 Repeat 1 Repeat 2 Repeat 3 Average 0 0.428 0.456 0.452 0.445±0.09 6000 ng 1.771 1.848 1.877 1.832±0.032 1500 ng 1.767 1.687 1.72 1.725±0.023 300 ng 1.126 1.196 1.496 1.273±0.113

[0087] From the ELISA test results, the measured OD values of the Galectin-10 protein at 6000 ng/mL, 1500 ng/mL and 300 ng/mL are significantly different from those of uncoated Galectin-10 protein test wells. It can be determined that the minimum test concentration of the Galectin-10 protein tested with the 172# nano antibody is 300 ng/mL. It is proved that the 172# nano antibody can be used for the test of Galectin-10 protein (for scientific research use and clinical test use, etc.).

III. Test on Galectin-10 Protein Content Using 254# and 225# Nano Antibodies.

1. Test Equipment

[0088] Incubator, plate washer, microplate reader.

2. Test Reagents

[0089] Galectin-10 protein with His tag (expressed and purified with pk277, see Annex 1 for expression and purification methods), Galectin-10 nano antibodies 254# and 225# (antibodies with GST tags), anti-GST tag mouse monoclonal antibody, HRP-tagged goat anti-mouse antibody, TMB single-component developing solution.

3. Scope of Application of the Test Scheme

[0090] All Galectin-10 ELISA assays.

Test Method

[0091] (1) Phosphate buffered saline (PBS): weigh 8.0 g of NaCl, 0.2 g of KH.sub.2PO.sub.4, and 2.96 g of Na.sub.2HPO.sub.4•12H.sub.2O, add 1000 ml of distilled water with a measuring cylinder, pH 7.5.

[0092] (2) Sample diluent (PBST): add 0.1 ml of Tween-20 to 100 ml of PBS.

[0093] (3) Washing solution (PBST): add 1 ml of Tween-20 to 1000 ml of PBS.

[0094] (4) Stop solution: 1 mol/L H.sub.2SO.sub.4. Note that sulfuric acid is added to water with constant stirring. This reaction releases a lot of heat.

[0095] (5) Coating buffer: weigh 1.5 g of Na.sub.2CO.sub.3, 2.93 g of NaHCO.sub.3, and 0.2 g of NaN.sub.3 (optional), add 1000 ml of distilled water with a measuring cylinder, pH 9.6.

[0096] (6) Blocking solution: dissolve 3 g of bovine serum albumin in 100 ml of coating buffer.

4. Sample Determination (GST Tag Antibody)

[0097] 1) Coating: dilute 0.25 mg/mL Galectin-10 protein with the coating buffer to 0 well, 1:100, 1:500, and 1:2000, 100 ul per well, 3 replicate wells for each concentration, 4° C., coat in a wet box overnight, as shown in Table 3.

TABLE-US-00005 Galectin-10 protein coating table 1 2 3 4 5 6 A Uncoated Uncoated Uncoated Uncoated Uncoated Uncoated B 1: 100 1: 100 1: 100 1: 100 1: 100 1: 100 C 1: 500 1: 500 1: 500 1: 500 1: 500 1: 500 D 1: 2000 1: 2000 1: 2000 1: 2000 1: 2000 1: 2000

[0098] 2) Wash the plate: shake off the sample, add 300 ul of washing solution with a multichannel pipette and then pour out, wash the plate 4 times, and drop the plate on newspaper twice.

[0099] 3) Block: add 120 ul of blocking solution to each well, place in a wet box at 37° C. for 2 h, and then shake off the blocking solution.

[0100] 4) Add GST tag antibodies 254# and 225#, dilute 1:200, 100 ul per well, add 254# to 1, 2, and 3 columns, and 225# to 4, 5, and 6 columns, and incubate at 37° C. for 1 h in a wet box.

[0101] 5) Wash the plate: same as 2).

[0102] 6) Add anti-GST tag mouse monoclonal antibody, dilute 1:500, 100 ul per well, and incubate at 37° C. for 1 h in a wet box.

[0103] 7) Wash the plate: same as 2).

[0104] 8) Add HRP-tagged goat anti-mouse antibody, dilute 1:500, 100 ul per well, and incubate at 37° C. for 1 h in a wet box.

[0105] 9) Wash the plate: same as 2).

[0106] 10) Add the TMB single-component developing solution, 100 ul per well, dark for 20 min, and add an equal volume of stop solution.

[0107] 11) Perform colorimetric reading at 450 nm wavelength with the microplate reader. The results are shown in Table 4 and Table 5.

TABLE-US-00006 254# antibody test results Concentration of Galectin-10 (ng/mL) Repeat 1 Repeat 2 Repeat 3 Average 0 0.328 0.308 0.312 0.316±0.006 2500 1.317 1.198 1.34 1.285±0.044 500 0.615 0.551 0.577 0.581±0.019 125 0.397 0.353 0.37 0.373±0.013

TABLE-US-00007 225# antibody test results Concentration of Galectin-10 (ng/mL) Repeat 1 Repeat 2 Repeat 3 Average 0 0.119 0.134 0.128 0.127±0.004 2500 0.74 0.7 0.681 0.707±0.017 500 0.257 0.26 0.279 0.265±0.007 125 0.155 0.153 0.173 0.160±0.006

[0108] From the ELISA test results shown in Table 4 and Table 5, when the Galectin-10 protein is at 2500 ng/mL, 500 ng/mL and 125 ng/mL, the measured OD values of the 254# and 225# nano antibodies are significantly different from those of uncoated Galectin-10 protein test wells. It can be determined that the minimum test concentration of the two antibodies is 125 ng/mL. It is proved that the 254# and 225# nano antibodies can be used for the test of Galectin-10 protein. This test method is only an example, but is not limited.

[0109] Although the present application is described in detail above with general descriptions and specific embodiments, some modifications or improvements can be made on the basis of the present application, which is obvious to those skilled in the art. Therefore, all these modifications or improvements made without departing from the spirit of the present application fall into the scope of the present application.

SEQUENCE TABLE

[0110] Seq Id No: 1

TABLE-US-00008 EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX.sub.1AMGWFRQAPGKEREX.sub.2V SAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVT PGGRLWYYRYDYRCQGTQVTVSS;

Herein, X.sub.1 is selected from Y or F, and X.sub.2 is selected from F or L

[0111] 172# Nano Antibody (SEQ ID NO: 2)

TABLE-US-00009 EVQLQASGGGFVQPGGSLRLSCAASGFTFSSYAMGWFRQAPGKEREFVSA ISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPG GRLWYYRYDYRCQGTQVTVSS

[0112] 254# Nano Antibody (SEQ ID NO: 3)

TABLE-US-00010 EVQLQASGGGFVQPGGSLRLSCAASGFTFSSFAMGWFRQAPGKEREFVSA ISSGGGNTYYADSVKGRFTISRDNSKNTVVLQMNSLRAEDTATYYCVTPG GRLWYYRYDYRCQGTQVTVSS

[0113] 225# Nano Antibody (SEQ ID NO: 4)

TABLE-US-00011 EVQLQASGGGFVQPGGSLRLSCAASGFTFSSYAMGWFRQAPGKERELVSA ISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPG GRLWYYRYDYRCQGTQVTVSS

[0114] Galectin-10 (SEQ ID NO: 5)

TABLE-US-00012 MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDI VFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKY QVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR

[0115] Coding Gene of 172# Nano Antibody SEQ ID NO: 6

TABLE-US-00013 GAGGTGCAGC TGCAAGCGAG CGGTGGCGGT TTCGTTCAAC CGGGCGGTAG CCTGCGTCTG AGCTGCGCGG CGAGCGGTTT CACCTTTAGC AGCTACGCGA TGGGTTGGTT CCGTCAAGCG CCGGGCAAGG AGCGTGAATT TGTTAGCGCG ATCAGCAGCG GCGGTGGCAA CACCTACTAT GCGGACAGCG TGAAGGGTCG TTTTACCATT AGCCGTGATA ACAGCAAAAA CACCGTTTAC CTGCAAATGA ACAGCCTGCG TGCGGAAGAC ACCGCGACCT ACTATTGCGT GACCCCGGGT GGCCGTCTGT GGTACTATCG TTACGATTAT CGGTGTCAGG GCACCCAAGT GACCGTTAGC AGC

[0116] Coding Gene of 254# Nano Antibody SEQ ID NO: 7

TABLE-US-00014 GAGGTGCAGC TGCAAGCGAG CGGTGGCGGT TTCGTTCAAC CGGGCGGTAG CCTGCGTCTG AGCTGCGCGG CGAGCGGTTT CACCTTTAGC AGCTTCGCGA TGGGTTGGTT CCGTCAAGCT CCGGGCAAGG AGCGTGAATT TGTTAGCGCG ATCAGCAGCG GCGGTGGCAA CACCTACTAT GCGGACAGCG TGAAGGGTCG TTTTACCATT AGCCGTGATA ACAGCAAAAA CACCGTTTAC CTGCAAATGA ACAGCCTGCG TGCGGAAGAC ACCGCGACCT ACTATTGCGT GACCCCGGGT GGCCGTCTGT GGTACTATCG TTACGATTAT CGGTGTCAGG GCACCCAAGT GACCGTTAGC AGC

[0117] Coding Gene of 225# Nano Antibody SEQ ID NO: 8

TABLE-US-00015 GAGGTGCAGC TGCAAGCGAG CGGTGGCGGT TTCGTTCAAC CGGGCGGTAG CCTGCGTCTG AGCTGCGCGG CGAGCGGTTT CACCTTTAGC AGCTACGCGA TGGGTTGGTT CCGTCAAGCG CCGGGCAAGG AGCGTGAACT TGTTAGCGCG ATCAGCAGCG GCGGTGGCAA CACCTACTAT GCGGACAGCG TGAAGGGTCG TTTTACCATT AGCCGTGATA ACAGCAAAAA CACCGTTTAC CTGCAAATGA ACAGCCTGCG TGCGGAAGAC ACCGCGACCT ACTATTGCGT GACCCCGGGT GGCCGTCTGT GGTACTATCG TTACGATTAT CGGTGTCAGG GCACCCAAGT GACCGTTAGC AGC

[0118] Amino Acid Sequence of CDR1 SEQ ID NO: 9

TABLE-US-00016 FTFSSX.sub.3A

Herein, X.sub.3 is F or Y

[0119] Amino Acid Sequence of CDR2 SEQ ID NO: 10

TABLE-US-00017 SGGGNT

[0120] Amino Acid Sequence of CDR3 SEQ ID NO: 11

TABLE-US-00018 TPGGRLWYYRYD