Preparation and Purification of Hypersialylated IGG
20230193339 · 2023-06-22
Inventors
- John Schaeck (Titusville, NJ, US)
- Steffen Graham (Titusville, NJ, US)
- Radouane Zouaoui (Titusville, NJ, US)
Cpc classification
C07K1/34
CHEMISTRY; METALLURGY
C07K2317/41
CHEMISTRY; METALLURGY
C07K1/36
CHEMISTRY; METALLURGY
International classification
C07K1/34
CHEMISTRY; METALLURGY
Abstract
Methods for preparing and purifying hypersialylated IgG are described.
Claims
1. A method of producing a purified hypersialylated IgG (hsIgG) composition with greater than 75% of the branched Fc glycans on the hsIgG have a sialic acid on both the a1,3 branch and the a1,6 branch, the method comprising: (a) providing a hsIgG composition comprising hsIgG and ST6Gal or an enzymatically active portion thereof; (b) diluting the composition in a citrate buffer at about 50 mM, about pH 4.5, thereby producing a buffered antibody composition; (c) applying the buffered antibody composition to a chromatography column comprising a resin with a sulfonic acid functional group under conditions that bind the hsIgG as well as the ST6Gal or enzymatically active portion thereof; and (d) selectively eluting the IgG from the column, thereby producing a purified hsIgG composition with greater than 75% of the branched Fc glycans on the hsIgG have a sialic acid on both the a1,3 branch and the a1,6 branch.
2. (canceled)
3. The method of claim 1 or claim 2, wherein the CEX column comprises a resin having a SO.sub.3.sup.— functional group.
4. The method of claim 1 , wherein selectively eluting the hsIgG comprises eluting in a buffer comprising about 400 mM or more NaCl.
5-16. (canceled)
17. A method of producing a purified hypersialylated IgG (hsIgG) composition, the method comprising: (a) providing a hsIgG composition comprising hsIgG and ST6Gal or an enzymatically active portion thereof; (b) diluting the composition in a buffer suitable for use with the column, thereby producing a buffered antibody composition; (c) applying the buffered antibody composition to a blue dye column, e.g., a blue column described herein, under conditions that allow 80% or more of the hsIgG to flow through, but allows only 100 ppm or less of the ST6 or enzymatically active portion thereof to flow through, thereby producing purified hsIgG.
18. The method of claim 17, wherein the blue dye chromatography column is a Trisacryl Blue (TABS) column and the buffer suitable for use with the column is citrate buffer, about 100 mM, about pH 4.5, with about 800 mM NaCl.
19-20. (canceled)
21. The method of claim 17 , wherein the method does not contain any additional filtering, fractionation, or purification steps other than (a) and (b) before carrying out step (c).
22. The method of claim 17 , wherein the method comprises a single depth filtering step, in addition to steps (a) and (b) before step (c).
23-33. (canceled)
34. A method of preparing purified hypersialylated (hsIgG) composition, the method comprising (a) providing a mixture of IgG antibodies, (b) incubating the mixture of IgG antibodies in a reaction mixture comprising β1,4-Galactosyltransferase I (β4GalT) or enzymatically active portion thereof and UDP-Gal to produce galactosylated IgG antibodies; (c) incubating the galactosylated IgG antibodies in a second reaction mixture comprising ST6Gal or enzymatically active portion thereof and CMP-NANA to produce a hsIgG mixture; (d) applying the hsIgG mixture to a protein A column under conditions that bind IgG antibodies; and (e) eluting hsIgG from the protein A column.
35. The method of claim 34, further comprising (f) further purifying the hsIgG produced in step (e) using a trisacryl blue column.
36. The method of claim 34, wherein step (e) comprises eluting the hsIgG with a buffer comprising glycine.
37. The method of claim 34, wherein the protein A column is washed with an acetate buffer between step (d) and step (e).
38. The method of claim 34, wherein the pH and salt content of hsIgG produced in step (e) is altered before applying it to the trisacryl blue column.
39. The method of claim 34, wherein step (f) comprises eluting the hsIgG with a high salt buffer.
40. The method of claim 39, wherein the high salt buffer comprises 2 M NaCl.
41. The method of claim 39, wherein the high salt buffer comprises 2 M KCl.
42. The method of claim 38, wherein the hsIgG produced in step (e) is altered to 0.4 M NaCl and pH 4.5.
43. (canceled)
44. The method of claim 34, wherein the B4GalT or enzymatically active portion thereof is at least 90% identical SEQ ID NO: 12 or SEQ ID NO. 13Error! Reference source not found. and the ST6Gal or enzymatically active portion thereof comprises an amino acid sequence that is at least 90% identical SEQ ID NO: 19 or SEQ ID NO: 20.
45-68. (canceled)
69. The method of claim 1 , wherein at least 60%, 65%, 70% of the branched glycans on the Fab domain of the hsIgG have a sialic acid on both the α 1,3 arm and the α 1,6 arm that is connected through a NeuAc-α 2,6-Gal terminal linkage after purification.
70-74. (canceled)
75. The method of claim 4, wherein at least 60%, 65%, 70%, 75%, 80%, or 85% of the branched glycans on the Fab domain of the hsIgG have a sialic acid on both the α 1,3 arm and the α 1,6 arm that is connected through a NeuAc-α 2,6-Gal terminal linkage after purification.
76. The method of claim 34, wherein at least 60%, 65%, 70%, 75%, 80%, or 85% of the branched glycans on the Fab domain of the hsIgG have a sialic acid on both the α 1,3 arm and the α 1,6 arm that is connected through a NeuAc-α 2,6-Gal terminal linkage after purification.
Description
DESCRIPTION OF DRAWINGS
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
DETAILED DESCRIPTION
[0129] Antibodies are glycosylated at conserved positions in the constant regions of their heavy chain and on the Fab domain. For example, human IgG antibodies have a single N-linked glycosylation site at Asn297 (EU Numbering) of the CH2 domain. Each antibody isotype has a distinct variety of N-linked carbohydrate structures in the constant regions. For human IgG, the core oligosaccharide normally consists of G1cNAc.sub.2Man.sub.3G1cNAc, with differing numbers of outer residues. Variation among individual IgG’s can occur via attachment of galactose and/or galactose-sialic acid at one or both terminal GlcNAc or via attachment of a third GlcNAc arm (bisecting GlcNAc).
[0130] The present disclosure encompasses, in part, methods for preparing immunoglobulins (e.g., human IgG) having an Fc region having particular levels of branched glycans that are sialylated on both of the arms of the branched glycan (e.g., with a NeuAc-α 2,6-Gal terminal linkage). The levels can be measured on an individual Fc region (e.g., the number of branched glycans that are sialylated on an α1,3 arm, an α1,6 arm, or both, of the branched glycans in the Fc region), or on the overall composition of a preparation of polypeptides (e.g., the number or percentage of branched glycans that are sialylated on an α1,3 arm, an α1,6 arm, or both, of the branched glycans in the Fc region in a preparation of polypeptides).
[0131] Naturally derived polypeptides that can be used to prepare hypersialylated IgG include, for example, IgG in human serum (particular human serum pooled from more than 1,000 donors), intravenous immunoglobulin (IVIg) and polypeptides derived from IVIg (e.g., polypeptides purified from IVIg (e.g., enriched for sialylated IgGs) or modified IVIg (e.g., IVIg IgGs enzymatically sialylated).
[0132] N-linked oligosaccharide chains are added to a protein in the lumen of the endoplasmic reticulum. Specifically, an initial oligosaccharide (typically 14-sugar) is added to the amino group on the side chain of an asparagine residue contained within the target consensus sequence of Asn-X-Ser/Thr, where X may be any amino acid except proline. The structure of this initial oligosaccharide is common to most eukaryotes, and contains three glucose, nine mannose, and two N-acetylglucosamine residues. This initial oligosaccharide chain can be trimmed by specific glycosidase enzymes in the endoplasmic reticulum, resulting in a short, branched core oligosaccharide composed of two N-acetylglucosamine and three mannose residues. One of the branches is referred to in the art as the “α 1,3 arm,” and the second branch is referred to as the “α 1,6 arm,” as shown in
[0133] N-glycans can be subdivided into three distinct groups called “high mannose type,” “hybrid type,” and “complex type,” with a common pentasaccharide core (Man (α 1,6)-(Man(α 1,3))-Man((β 1,4)-GlcpNAc((β 1,4)-GlcpNAc(β 1,N)-Asn) occurring in all three groups.
[0134] The more common Fc glycans present in IVIg are shown in
[0135] Additionally or alternatively, one or more monosaccharides units of N-acetylglucosamine may be added to the core mannose subunits to form a “complex glycan.” Galactose may be added to the N-acetylglucosamine subunits, and sialic acid subunits may be added to the galactose subunits, resulting in chains that terminate with any of a sialic acid, a galactose or an N-acetylglucosamine residue. Additionally, a fucose residue may be added to an N-acetylglucosamine residue of the core oligosaccharide. Each of these additions is catalyzed by specific glycosyl transferases.
[0136] “Hybrid glycans” comprise characteristics of both high-mannose and complex glycans. For example, one branch of a hybrid glycan may comprise primarily or exclusively mannose residues, while another branch may comprise N-acetylglucosamine, sialic acid, galactose, and/or fucose sugars.
[0137] Sialic acids are a family of 9-carbon monosaccharides with heterocyclic ring structures. They bear a negative charge via a carboxylic acid group attached to the ring as well as other chemical decorations including N-acetyl and N-glycolyl groups. The two main types of sialic acid residues found in polypeptides produced in mammalian expression systems are N-acetyl-neuraminic acid (NeuAc) and N-glycolylneuraminic acid (NeuGc). These usually occur as terminal structures attached to galactose (Gal) residues at the non-reducing termini of both N-and O-linked glycans. The glycosidic linkage configurations for these sialic acid groups can be either α 2,3 or α 2,6.
[0138] Fc regions are glycosylated at conserved, N-linked glycosylation sites. For example, each heavy chain of an IgG antibody has a single N-linked glycosylation site at Asn297 of the CH2 domain. IgA antibodies have N-linked glycosylation sites within the CH2 and CH3 domains, IgE antibodies have N-linked glycosylation sites within the CH3 domain, and IgM antibodies have N-linked glycosylation sites within the CH1, CH2, CH3, and CH4 domains.
[0139] Each antibody isotype has a distinct variety of N-linked carbohydrate structures in the constant regions. For example, IgG has a single N-linked biantennary carbohydrate at Asn297 of the CH2 domain in each Fc polypeptide of the Fc region, which also contains the binding sites for C1q and FcγR. For human IgG, the core oligosaccharide normally consists of GlcNAc2Man3GlcNAc, with differing numbers of outer residues. Variation among individual IgG can occur via attachment of galactose and/or galactose-sialic acid at one or both terminal GlcNAc or via attachment of a third GlcNAc arm (bisecting GlcNAc).
[0140] Immunoglobulins, e.g., IgG antibodies, can be sialylated by carrying out a galactosylation step followed by a sialylation step. Beta-1,4-galactosyltransferase 1 (B4GalT) is a Type II Golgi membrane-bound glycoprotein that transfers galactose from uridine 5′-diphosphosegalactose ([[(2R,3S,4R,SR)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2R,3R,4S,5R,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] hydrogen phosphate; UDP-Gal) to GlcNAc as a β-1,4 linkage. Alpha-2,6-sialyltransferase 1 (ST6) is a Type II Golgi membrane-bound glycoprotein that transfers sialic acid from cytidine 5′-monophospho-N-acetylneuraminicacid ((2R,4S,5R,6R)-5-acetamido-2-[[(2R,3S,4R,5R)-5-(4-amino-2-oxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-4-hydroxy-6-(1,2,3-trihydroxypropyl)oxane-2-carboxylic acid; CMP-NANA or CMP-Sialic Acid) to Gal as an α-2,6 linkage. Schematically, the reactions proceed shown in
[0141] Glycans of polypeptides can be evaluated using any methods known in the art. For example, sialylation of glycan compositions (e.g., level of branched glycans that are sialylated on an α1,3 branch and/or an α1,6 branch) can be characterized using methods described in WO2014/179601.
[0142] In some embodiments of the hsIgG compositions prepared by the methods described herein, at least 60%, 65%, 70%, 75%, 80%, 85%, or 90% of the branched glycans on the Fc domain have a sialic acid on both the α 1,3 arm and the α 1,6 arm that is connected through a NeuAc-α 2,6-Gal terminal linkage. In addition, in some embodiments, at least 40%, 50%, 60%, 65%, 70%, 75%, 80%, or 85% of the branched glycans on the Fab domain have a sialic acid on both the α 1,3 arm and the α 1,6 arm that is connected through a NeuAc-α 2,6-Gal terminal linkage. Overall, in some embodiments, at least 60%, 65%, 70%, 75%, 80%, 85%, or 90% of the branched glycans have a sialic acid on both the α 1,3 arm and the α 1,6 arm that is connected through a NeuAc-α 2,6-Gal terminal linkage.
[0143] In some embodiments, the hsIgG compositions prepared by the methods described herein comprises at least 50%, 55%, 60%, 65%, 70% or 75% of the branched glycans on the Fc domain have a sialic acid on both the α 1,3 arm and the α 1,6 arm.
Enzymes
Galactosylating Enzymes
[0144] Beta-1,4-galactosyltransferase (B4GalT), e.g., human B4GalT, e.g., human (B4Galt1), as well as orthologs, mutants, and variants thereof, including enzymatically active portions of beta-1,4-galactosyltransferase (B4GalT), e.g., human B4GalT, e.g., human B4Galt1, as well as orthologs, mutants, and variants thereof, along with fusion proteins and polypeptides comprising the same are suitable for use in the methods described herein. B4Galt1 is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes that each encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta 1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. B4Galt1 adds galactose to N-acetylglucosamine residues that are either monosaccharides or the nonreducing ends of glycoprotein carbohydrate chains. B4GalT1 is also called GGTB2. Four alternative transcripts encoding four isoforms of B4GALT1 (NCBI Gene ID 2683) are described in Table 1.
TABLE-US-00001 Human B4GALT1 isoforms Transcript Length (nt) Protein SEQ ID NO: Length (aa) Isoform NM_001497.4 4176 NP_001488.2 SEQ ID NO: 5 398 1 NM_001378495.1 3999 NP_001365424.1 SEQ ID NO: 6 385 2 NM_001378496.1 4053 NP_001365425.1 SEQ ID NO: 7 357 3 NM_001378497.1 1520 NP_001365426.1 SEQ ID NO: 8 225 4
TABLE-US-00002 Topology of B4GALT1 isoform 1 (SEQ ID NO: 5) Feature AAs Description Length Sequence SEQ ID NO: Topological domain 1-24 Cytoplasmic 9 MRLREPLLSGSAAMPGASLQRACR SEQ ID NO: 9 Transmembr ane 25 – 44 Helical; Signal-anchor for type II membrane protein 17 LLVAVCALHLGVTLVYYLAG SEQ ID NO: 10 Topological domain 45 – 398 Lumenal 380 RDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPWDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS SEQ ID NO: 11
TABLE-US-00003 Binding sites of B4GALT1 isoform 1 (SEQ ID NO: 5) Position(s) Description Reference(s) 250 Metal binding; Manganese 310 Binding site; UDP-alpha-D-galactose “Structural snapshots of beta-1,4-galactosyltransferase-I along the kinetic pathway.” Ramakrishnan B., Ramasamy V., Qasba P.K. J. Mol. Biol. 357:1619-1633(2006) 343 Metal binding; Manganese; via tele nitrogen 355 Binding site; N-acetyl-D-glucosamine “Oligosaccharide preferences of beta1,4-galactosyltransferase-I: crystal structures of Met340His mutant of human beta1,4-galactosyltransferase-I with a pentasaccharide and trisaccharides of the N-glycan moiety.” Ramasamy V., Ramakrishnan B., Boeggeman E., Ratner D.M., Seeberger P.H., Qasba P.K. J. Mol. Biol. 353:53-67(2005) “Deoxygenated disaccharide analogs as specific inhibitors of beta1-4-galactosyltransferase 1 and selectin-mediated tumor metastasis.” Brown J.R., Yang F., Sinha A., Ramakrishnan B., Tor Y., Qasba P.K., Esko J.D. J. Biol. Chem. 284:4952-4959(2009)
TABLE-US-00004 Post Translational Amino Acid Modifications of B4GALT1 isoform 1 (SEQ ID NO: 5) Feature key Position(s) Description Reference(s) Glycosylation 113 N-linked (GlcNAc...) asparagine Disulfide bond 130 .Math. 172 “Oligosaccharide preferences of beta1,4-galactosyltransferase-I: crystal structures of Met340His mutant of human beta1,4-galactosyltransferase-I with a pentasaccharide and trisaccharides of the N-glycan moiety.” Ramasamy V., Ramakrishnan B., Boeggeman E., Ratner D.M., Seeberger P.H., Qasba P.K. J. Mol. Biol. 353:53-67(2005) “Structural snapshots of beta-1,4-galactosyltransferase-I along the kinetic pathway.” Ramakrishnan B., Ramasamy V., Qasba P.K. J. Mol. Biol. 357:1619-1633(2006) Disulfide bond 243 .Math. 262
[0145] The soluble form of B4GalT1 derives from the membrane form by proteolytic processing. The cleavage site is at positions 77-78 of B4GALT1 isoform 1 (SEQ ID NO: 5).
[0146] In some embodiments, one or more of the amino acids of the B4GalT1 corresponding to amino acids 113, 130, 172, 243, 250, 262, 310, 343, or 355 of B4GALT1 isoform 1 (SEQ ID NO: 5) is conserved as compared to (SEQ ID NO: 5).
[0147] In some embodiments, the enzyme is an enzymatically active portion of, e.g., B4GalT1. In some embodiments, the enzyme is an enzymatically active portion of B4GALT1 isoform 1 (SEQ ID NO: 5), or an ortholog, mutant, or variant of SEQ ID NO: 5. In some embodiments, the enzyme is an enzymatically active portion of B4GALT1 isoform 2 (SEQ ID NO: 6), or an ortholog, mutant, or variant of SEQ ID NO: 6. In some embodiments, the enzyme is an enzymatically active portion of B4GALT1 isoform 3 (SEQ ID NO: 7), or an ortholog, mutant, or variant of SEQ ID NO: 7. In some embodiments, the enzyme is an enzymatically active portion of B4GALT1 isoform 4 (SEQ ID NO: 8), or an ortholog, mutant, or variant of SEQ ID NO: 8.
[0148] In some embodiments, the enzymatically active portion of B4GalT1 does not comprise a cytoplasmic domain, e.g., SEQ ID NO: 9. In some embodiments, the enzymatically active portion of B4GalT1 does not comprise a transmembrane domain, e.g., SEQ ID NO: 10. In some embodiments, the enzymatically active portion of B4GalT1 does not comprise a cytoplasmic domain, e.g., SEQ ID NO: 9 or a transmembrane domain, e.g., SEQ ID NO: 10.
[0149] In some embodiments, the enzymatically active portion of B4GalT1 comprises all or a portion of a luminal domain, e.g., SEQ ID NO: 11, or an ortholog, mutants, or variants thereof.
[0150] In some embodiments, the enzymatically active portion of B4GalT1 comprises amino acids 109-398 of SEQ ID NO: 5, or an ortholog, mutants, or variants thereof. In some embodiments, the enzymatically active portion of B4GalT1 consists of SEQ ID NO: 5, or an ortholog, mutant, or variant of SEQ ID NO: 5.
[0151] A suitable functional portion of an B4GalT1 can comprise or consist of an amino acid sequence that is at least 80% (85%, 90%, 95%, 98% or 100%) identical to SEQ ID NO: 12.
[0152] Also suitable for use in the methods described herein is an amino acid sequence that comprises or consists of an amino acid sequence that is at least 80% (85%, 90%, 95%, 98% or 100%) identical to SEQ ID NO: 13.
Sialylating Enzymes
[0153] ST6, e.g., ST6Ga11, e.g., human ST6Ga11, as well as orthologs, mutants, and variants thereof, including enzymatically active portions of ST6Ga11, e.g., human ST6Ga11, as well as orthologs, mutants, and variants thereof, along with fusion proteins and polypeptides comprising the same, are suitable for use in the methods described herein. Alpha-2,6-sialyltransferase 1 (ST6) is a Type II Golgi membrane-bound glycoprotein that transfers sialic acid from cytidine 5′-monophospho-N-acetylneuraminic acid (CMP-NANA) to Gal as an α-2,6 linkage. ST6Gal1 is also called as ST6N or SIAT1. Four alternative transcripts encoding two isoforms of ST6GAL1 (NCBI Gene ID 6480) are described in Table 5.
TABLE-US-00005 Human ST6GAL1 isoforms Transcript Length (nt) Protein SEQ ID NO: Length (aa) Isoform NM_173216.2 4604 NP_775323.1 SEQ ID NO: 14 406 a NM_173217.2 3947 NP_775324.1 SEQ ID NO: 15 175 b NM_003032.3 4303 NP_003023.1 SEQ ID NO: 14 406 a NM_001353916.2 4177 NP_001340845.1 SEQ ID NO: 14 406 a
TABLE-US-00006 Topology of ST6Ga11 isoform a (SEQ ID NO: 14) Feature AAs Description Length Sequence SEQ ID NO: Topological domain 1-9 Cytoplasmic 9 MIHTNLKKK SEQ ID NO: 16 Transmembrane 10 – 26 Helical; Signal-anchor for type II membrane protein 17 FSCCVLVFLLFAVICVW SEQ ID NO: 17 Topological domain 27 – 406 Lumenal 380 KEKKKGSYYDSFKLQTKEFQVLKSLG KLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC SEQ ID NO: 18
TABLE-US-00007 Binding sites of ST6Gal1 isoform a (SEQ ID NO: 14) Position(s) Description Reference(s) 189 Substrate; via amide nitrogen “The structure of human alpha-2,6-sialyltransferase reveals the binding mode of complex glycans.” Kuhn B., Benz J., Greif M., Engel A.M., Sobek H., Rudolph M.G. Acta Crystallogr. D 69:1826-1838(2013) 212 Substrate 233 Substrate 353 Substrate; via carbonyl oxygen 354 Substrate 365 Substrate 369 Substrate 370 Substrate “The structure of human alpha-2,6-sialyltransferase reveals the binding mode of complex glycans.” Kuhn B., Benz J., Greif M., Engel A.M., Sobek H., Rudolph M.G. Acta Crystallogr. D 69:1826-1838(2013) 376 Substrate
TABLE-US-00008 Post Translational Amino Acid Modifications of ST6Gal1 isoform a (SEQ ID NO: 14) Feature key Position(s) Description Reference(s) Disulfide bond 142 .Math. 406 “The structure of human alpha-2,6-sialyltransferase reveals the binding mode of complex glycans.” Kuhn B., Benz J., GreifM., Engel A.M., Sobek H., Rudolph M.G. Acta Crystallogr. D 69:1826-1838(2013) Glycosylation 149 N-linked (GlcNAc...) asparagine “Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.” Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009); and “The structure of human alpha-2,6-sialyltransferase reveals the binding mode of complex glycans.” Kuhn B., Benz J., GreifM., Engel A.M., Sobek H., Rudolph M.G. Acta Crystallogr. D 69:1826-1838(2013) Glycosylation 161 N-linked (G1cNAc...) asparagine “Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.” Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) Disulfide bond 184 .Math. 335 “The structure of human alpha-2,6-sialyltransferase reveals the binding mode of complex glycans.” Kuhn B., Benz J., GreifM., Engel A.M., Sobek H., Rudolph M.G. Acta Crystallogr. D 69:1826-1838(2013) Disulfide bond 353 .Math. 364 “The structure of human alpha-2,6-sialyltransferase reveals the binding mode of complex glycans.” Kuhn B., Benz J., GreifM., Engel A.M., Sobek H., Rudolph M.G. Acta Crystallogr. D 69:1826-1838(2013) Modified residue 369 Phosphotyrosine “Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.” Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009)
[0154] The soluble form of ST6Ga11 derives from the membrane form by proteolytic processing.
[0155] In some embodiments, one or more of the amino acids of the ST6Ga11 corresponding to amino acids 142, 149, 161, 184, 189, 212, 233, 335, 353, 354, 364, 365, 369, 370, 376, or 406 of ST6Ga11 isoform a (SEQ ID NO: 14) is conserved as compared to SEQ ID NO: 14.
[0156] Also provided herein is an enzymatically active portion of, e.g., ST6Ga11. In some embodiments, the enzyme is an enzymatically active portion of STG6Ga11 isoform a (SEQ ID NO: 14), or an ortholog, mutant, or variant of SEQ ID NO: 14. In some embodiments, the enzyme is an enzymatically active portion of STG6Gal1 isoform b (SEQ ID NO: 15), or an ortholog, mutant, or variant of SEQ ID NO: 15.
[0157] In some embodiments, the enzymatically active portion of ST6Gal1 does not comprise a cytoplasmic domain, e.g., SEQ ID NO: 16. In some embodiments, the enzymatically active portion of ST6Ga11 does not comprise a transmembrane domain, e.g., SEQ ID NO: 17. In some embodiments, the enzymatically active portion of ST6Ga11 does not comprise a cytoplasmic domain, e.g., SEQ ID NO: 16 or a transmembrane domain, e.g., SEQ ID NO: 17.
[0158] In some embodiments, the enzymatically active portion of ST6Gal1 comprises all or a portion of a luminal domain, e.g., SEQ ID NO: 18, or an ortholog, mutants, or variants thereof.
[0159] In some embodiments, the enzymatically active portion of ST6Gal1 comprises amino acids 87-406 of SEQ ID NO: 14 (SEQ ID NO: 19), or an ortholog, mutants, or variants thereof. In some embodiments, the enzymatically active portion of ST6Ga11 consists of SEQ ID NO: 19, or an ortholog, mutant, or variant of SEQ ID NO: 19.
[0160] A suitable functional portion of an ST6Gal1 can comprise or consist of an amino acid sequence that is at least 80% (85%, 90%, 95%, 98% or 100%) identical to SEQ ID NO: 19.
[0161] In some embodiments, the ST6Ga11 comprises or consists of SEQ ID NO: 19, the portion of SEQ ID NO: 19 from amino acid 4 to 320, or the portion of SEQ ID NO: 19 from amino acid 5 to 320.
[0162] Also suitable for use in the methods described herein is an amino acid sequence that comprises or consists of an amino acid sequence that is at least 80% (85%, 90%, 95%, 98% or 100%) identical to SEQ ID NO: 20.
Antibodies
[0163] The methods described herein can include galactosylation and sialylation of antibodies. Suitable antibodies include, for example, IgG antibodies. The antibodies, e.g., IgG antibodies, can be pooled. For example, pooled IgG antibodies include IVIg.
[0164] In some embodiments, the IgG antibodies comprise IgG antibodies isolated from at least 1000 donors.
[0165] In some embodiments, at least 50%, 55%, 60%, 65% or 70% w/w of the IgG antibodies are IgG1 antibodies.
[0166] In some embodiments, at least 90% of the donor subject has been exposed to a virus.
[0167] In some embodiments, the methods described herein include providing a mixture of IgG antibodies. In some embodiments, providing a mixture of IgG antibodies includes (a) providing pooled plasma from at least 1000 human subjects; and (b) isolating a mixture of IgG antibodies from the pooled plasma. In some embodiments, the mixture of IgG antibodies are isolated from intravenous immunoglobulin. In some embodiments, the mixture of IgG antibodies are intravenous immunoglobulin. In some embodiments, the step of isolating a mixture of IgG antibodies from the pooled plasma comprises ethanol precipitation or caprylic acid (also called octanoic acid) precipitation. In some embodiments, the step of isolating a mixture of IgG antibodies from the pooled plasma comprises biding IgG antibodies to an ion exchange column and eluting the IgG antibodies from an ion exchange column.
Enzymatic Galactosylation and Sialylation
[0168] The methods described herein can comprise a galactosylation step. An exemplary galactosylation reaction is depicted in
[0169] The methods described herein can comprise a sialylation step. An exemplary sialylation reaction is depicted in
[0170] In some embodiments, the galactosylation step and the sialylation step are carried out sequentially in the same reaction mixture, that is, the galactosylation reaction mixture becomes the sialylation reaction mixture upon addition of the sialylating enzyme and CMP-NANA or salt thereof. In some embodiments, there galactosylation reaction mixture is not filtered, fractionated, or purified prior to the sialylation step. In some embodiments, the galactosylation step and the sialylation step are carried out separately, e.g, pre-galactosylated antibod(ies) are provided, though they may have been processed (e.g., filtered, fractionated, or purified) and/or stored prior to the sialylation step.
[0171] Thus, the methods described herein can also comprise a sequential galactosylation and sialylation step. An exemplary galactosylation and sialylation reaction is depicted in
[0172] Also provided herein is a method for galactosylating and sialylating, e.g., hyper-sialylating antibod(ies), e.g., antibod(ies) described herein, by providing a composition comprising: antibod(ies), e.g., as described herein; a galactosylating enzyme, e.g., a galactosylating enzyme described herein, e.g., B4GalT or enzymatically active portion or variant thereof; UDP-gal or a salt thereof; a sialylating enzyme, e.g., a sialylating enzyme described herein, e.g., ST6Gal1 or enzymatically active portion or variant thereof; CMP-NANA or salt thereof; and d) incubating the composition under conditions effective for galactosylating and sialylating the antibod(ies), e.g., as described herein.
[0173] In some embodiments, the galactosylation reaction mixture and/or the sialylation reaction mixture comprises Bis (2-hydroxyethyl) aminotris (hydroxymethyl)methane (BIS-TRIS) buffer.
[0174] In some embodiments, the galactosylation reaction mixture and/or the sialylation reaction mixture comprises MnCl.sub.2.
[0175] In some embodiments, one or more component(s) of one or more of the reaction mixture(s) are supplemented during the incubation. That is, the reaction mixture may comprise an amount of the component at the beginning of the reaction (which may change during the course of the reaction), but also be supplemented with additional amounts of the component(s) during the reaction.
[0176] In some embodiments, the B4GalT comprises or consists of an amino acid sequence is at least 90% identical SEQ ID NO: 12 or SEQ ID NO: 13.
[0177] In some embodiments, the ST6Ga11 comprises or consists of an amino acid sequence that is at least 90% identical SEQ ID NO: 19 or SEQ ID NO: 20.
[0178] In some embodiments, at least or about 60%, 65%, 70%, 75%, 80%, or 85% of the branched glycans on the sialylated antibod(ies), e.g., hsIgG, have a sialic acid on both the α1,3 branch and the α1,6 branch.
[0179] In some embodiments, about or at least 60%, 65%, 70%, 75%, 80%, or 85% of the branched Fc glycans on the sialylated antibod(ies), e.g., hsIgG, have a sialic acid on both the α1,3 branch and the α1,6 branch.
[0180] In some embodiments, about or at least 60%, 65%, 70%, 75%, 80%, or 85% of the branched glycans on the Fab domain of the sialylated antibod(ies), e.g., hsIgG, have a sialic acid on both the α 1,3 arm and the α 1,6 arm that is connected through a NeuAc-α 2,6-Gal terminal linkage.
[0181] In some embodiments, about or at least 80% of the branched Fc glycans on the sialylated antibod(ies), e.g., hsIgG, have a sialic acid on both the α1,3 branch and the α1,6 branch.
[0182] In some embodiments, about or at least 60%, 65%, 70% of the branched glycans on the Fab domain of the sialylated antibod(ies), e.g., hsIgG, have a sialic acid on both the α 1,3 arm and the α 1,6 arm that is connected through a NeuAc-α 2,6-Gal terminal linkage.
[0183] In some embodiments, about or at least 85% of the of the branched Fc glycans on the sialylated antibod(ies), e.g., hsIgG, have a sialic acid on both the α1,3 branch and the α1,6 branch.
[0184] In some embodiments, about or at least 60%, 65%, 70% of the branched glycans on the Fab domain of the sialylated antibod(ies), e.g., hsIgG, have a sialic acid on both the α 1,3 arm and the α 1,6 arm that is connected through a NeuAc-α 2,6-Gal terminal linkage.
[0185] In some embodiments, about or at least 90% of the of the branched Fc glycans on the sialylated antibod(ies), e.g., hsIgG, have a sialic acid on both the α1,3 branch and the α1,6 branch.
[0186] In some embodiments, about or at least 60%, 65%, 70% of the branched glycans on the Fab domain of the sialylated antibod(ies), e.g., hsIgG, have a sialic acid on both the α 1,3 arm and the α 1,6 arm that is connected through a NeuAc-α 2,6-Gal terminal linkage.
Isolation and Purification Methods
[0187] Provided herein are methods for purifying antibod(ies), e.g., IgG, e.g., pooled IgG, e.g., IVIg, e.g., sialylated IgG, e.g., sialylated pooled IgG, e.g., sialylated IVIg, e.g., hsIgG
[0188] Also provided herein are methods for producing purified sialylated antibod(ies), e.g., purified hsIgG, the method comprising: i) producing sialylated antibod(ies), e.g., hsIgG, e.g., as described herein; and ii) purifying sialylated antibod(ies), e.g., as described herein.
[0189] An exemplary manufacturing process for isolation and purification of hsIgG is shown in
[0190] In some embodiments, the methods for purifying antibod(ies) comprises analyzing the amount of one or more IgG subclasses after purification, e.g., after a chromatography step.
Quenching
[0191] The methods described herein can include quenching of an enzymatic reaction, e.g., an enzymatic sialylation reaction, e.g., as described herein.
[0192] In some embodiments, quenching comprises mixing the composition comprising sialylated antibod(ies), e.g., sialylation reaction mixture, e.g., as described herein, with a buffer, e.g., phosphate buffered saline (PBS), e.g., 5X PBS, thereby producing a quenched antibody composition. In some embodiments, quenching comprises mixing the composition and the buffer at or at about 1:1. In some embodiments, quenching comprises mixing the antibody composition and the buffer at 1 volume buffer or more to one volume antibody composition.
Depth Filtration
[0193] The methods described herein can include depth filtration. Depth filtration is well known in the art and described, e.g., in Sutherland, “Filtration Overview: A Closer Look at Depth Filtration,” Filtration & Separation 45(8):25-28 (2008); Nguyen et al., “Improved HCP Reduction Using a New, All-Synthetic Depth Filtration Media Within an Antibody Purification Process,” Biotechnology Journal 14(1):1700771 (2019).
[0194] In some embodiments, the methods described herein, e.g., methods for producing and/or purifying antibod(ies), e.g., IgG, e.g., pooled IgG, e.g., IVIg, e.g., e.g., sialylated IgG, e.g., sialylated pooled IgG, e.g., sialylated IVIg, e.g., hsIgG, include one or more depth filtration steps. In some embodiments, the method includes one or more depth filtration steps before a chromatography step. In some embodiments, the method includes one or more depth filtration steps after a chromatography step. In some embodiments, the method does not include a depth filtration step prior to chromatography. In some embodiments, the method does not include a depth filtration step after chromatography. In some embodiments, the method does not include a depth filtration step.
Buffer Exchange
[0195] The methods described herein can include buffer exchange. Methods for buffer exchange are well known in the art and described, e.g., in Kurnik, “Buffer Exchange Using Size Exclusion Chromatography, Countercurrent Dialysis, and Tangential Flow Filtration: Models, Development, and Industrial Application,” Biotechnology & Bioengineering 45(2): 149-58 (1995); Dizon-Maspat et al., “Single Pass Tangential Flow Filtration to Debottleneck Downstream Processing for Therapeutic Antibody Production,” Biotechnology & Bioengineering 109(4):962-970 (2012).
[0196] In some embodiments, the buffer exchange method is size exclusion chromatography (SEC). In some embodiments, the buffer exchange method is tangential flow filtration (TFF). In some embodiments, the buffer exchange method is countercurrent dialysis (CCD).
[0197] In some embodiments, the buffer exchange method is tangential flow filtration (TFF).
[0198] In some embodiments, the methods described herein, e.g., methods for producing and/or purifying antibod(ies), e.g., IgG, e.g., pooled IgG, e.g., IVIg, e.g., e.g., sialylated IgG, e.g., sialylated pooled IgG, e.g., sialylated IVIg, e.g., hsIgG, include one or more buffer exchange steps. In some embodiments, the method includes one or more buffer exchange steps before a chromatography step. In some embodiments, the method includes one or more buffer exchange steps after a chromatography step. In some embodiments, the method does not include a buffer exchange step prior to chromatography. In some embodiments, the method does not include a buffer exchange step after chromatography. In some embodiments, the method does not include a buffer exchange step.
Viral Inactivation/Removal
[0199] The methods described herein can include viral inactivation or viral removal. Methods for viral inactivation and removal are well known in the art and described, e.g., in Horowitz et al., “Strategies for Viral Inactivation,” Current Opinion in Hematology 2(6):484-92 (1995); Klutz et al., “Continuous Viral Inactivation at low pH Value in Antibody Manufacturing,” Chemical Engineering and Processing: Process Intensification 102:88-11 (2016).
[0200] In some embodiments, the viral inactivation method is selected from solvent/detergent inactivation, low pH inactivation, pasteurization, microwave heating, irradiation, high-energy light, and combinations thereof.
[0201] In some embodiments, the viral removal method is selected from affinity chromatography, nanofiltration, and combinations thereof.
[0202] In some embodiments, the methods described herein, e.g., methods for purification of antibod(ies), e.g., IgG, e.g., pooled IgG, e.g., IVIg, e.g., e.g., sialylated IgG, e.g., sialylated pooled IgG, e.g., sialylated IVIg, e.g., hsIgG, include one or more viral inactivation or viral removal steps. In some embodiments, the viral inactivation or viral removal step is carried out after galactosylation and sialylation. In some embodiments, the viral inactivation or viral removal step is carried out after galactosylation and sialylation but before chromatography. In some embodiments, the viral inactivation and removal includes viral inactivation followed by nanofiltration. In some embodiments, the method comprises viral removal (e.g., by nanofiltration), but does not include a separate viral inactivation step.
Nanofiltration
[0203] The methods described herein can include nanofiltration. Membranes and methods for nanofiltration are well known in the art and described, e.g., in Mohammad et al., “Nanofiltration Membranes Review: Recent Advances and Future Prospects,” Desalination 356:226-54 (2015).
[0204] In some embodiments, the methods described herein, e.g., methods for producing and/or purifying antibod(ies), e.g., IgG, e.g., pooled IgG, e.g., IVIg, e.g., e.g., sialylated IgG, e.g., sialylated pooled IgG, e.g., sialylated IVIg, e.g., hsIgG, include one or more nanofiltration steps. In some embodiments, the method includes one or more nanofiltration steps before a chromatography step. In some embodiments, the method includes one or more nanofiltration steps after a chromatography step. In some embodiments, the method does not include a nanofiltration step prior to chromatography. In some embodiments, the method does not include a nanofiltration step after chromatography. In some embodiments, the method does not include a nanofiltration step.
Chromatography
[0205] The methods described herein e.g., methods for producing and/or purifying antibod(ies), e.g., IgG, e.g., pooled IgG, e.g., IVIg, e.g., e.g., sialylated IgG, e.g., sialylated pooled IgG, e.g., sialylated IVIg, e.g., hsIgG, can include chromatography as part of the purification process.
[0206] In some embodiments, the antibod(ies) bind to the chromatography resin. In some embodiments, the antibod(ies) flow through the chromatography resin.
[0207] In some embodiments, the impurity(ies) (e.g., one or more of the other components of the enzymatic reaction mixture(s), e.g., galactosylation reaction mixture(s) and/or sialylation reaction mixture(s), including, but not limited to, enzymes, e.g., B4GalT and/or ST6, nucleotide sugars, and MnCl.sub.2) bind to the chromatography resin. In some embodiments, the impurities flow through the chromatography resin.
[0208] In some embodiments, both the antibod(ies) and the impurity(ies) bind to the chromatography resin. In such an embodiment, the antibod(ies) and impurity(ies) can be separately eluted.
Protein A Affinity Chromatography
[0209] The methods described herein e.g., methods for producing and/or purifying antibod(ies), e.g., IgG, e.g., pooled IgG, e.g., IVIg, e.g., e.g., sialylated IgG, e.g., sialylated pooled IgG, e.g., sialylated IVIg, e.g., hsIgG, can include an affinity chromatography step in which the antibod(ies) bind to the ligand of the chromatography resin, e.g., a Protein A affinity chromatography step.
[0210] Materials and methods for Protein A affinity chromatography are well known in the art and described, e.g., in Ramos-de-la-Peña et al., “Protein A chromatography: Challenges and Progress in the Purification of Monoclonal Antibodies,” Journal of Separation Science 2019:doi: 10.1002/jssc.201800963.
[0211] In some embodiments, the Protein A affinity chromatography resin is MabSelect™ PrismA (GE Healthcare).
[0212] In some embodiments, the Protein A affinity chromatography resin ligand is selected from the group consisting of Protein A, a Protein A derivative, a Protein A mimetic, or a combination thereof.
[0213] In some embodiments, the methods describe herein comprise Protein A Affinity Chromatography followed by Blue Dye Chromatography, e.g., as described herein.
Cation Exchange Chromatography
[0214] The methods described herein e.g., methods for producing and/or purifying antibod(ies), e.g., IgG, e.g., pooled IgG, e.g., IVIg, e.g., e.g., sialylated IgG, e.g., sialylated pooled IgG, e.g., sialylated IVIg, e.g., hsIgG, can include a cation exchange chromatography (CEX) step, e.g., a strong cation exchange chromatography step using a strong cation exchange chromatography resin.
[0215] In some embodiments, the strong cation exchange resin is selected from the group consisting of Poros™ XS (e.g., Cytiva 4404336), SP Sepharose High Performance (SP HP) (e.g., Cytiva 28950515), Capto™ SP Impres (e.g., Cytiva 17546815), Capto™ S (e.g., Cytiva 28926979), Capto™ S Impact (e.g., Cytiva 1737174), and combinations thereof.
[0216] The Poros™ strong cation exchange (CEX) resins are 50-.Math.m, rigid, polymeric, ionexchange chromatography resins. Thermoscientific Product Information Sheet Pub. No. 100031321 Rev. D. A polyhydroxyl surface coating provides low non-specific binding and surface functionalization with sulphopropyl yields a strong cation-exchanger ionizable with pH 1-14. Id. The support matrix is cross-linked polystyrene-divinylbenzene and the surface functionality is sulfopropyl (—CH.sub.2CH.sub.2CH.sub.2SO.sub.3.sup.—). Id. The dynamic binding capacity of Poros™ XS is ≥ 102 mg/mL (5% breakthrough of Polyclonal Human IgG in 20 mM MES< 40 mM NaCl, pH 5.0 at 300 cm/hour in 0.46 cmD × 20 cmL column). Id. The dynamic binding capacity of Poros™ 50 HS 57.0-75.3 mg/mL (5% breakthrough with Lysozyme in 20 mM MES, pH 6.2 at 100 cm/hour in 0.46 cmD × 20 cmL column). Id.
[0217] The SP Sepharose High Performance (SP HP) resin is based on a 6% cross-linked agarose matrix with a particle size of 24-44 .Math.m (d.sub.50v, ~34 .Math.m) that uses a sulphopropyl ligand (—CH.sub.2CH.sub.2CH.sub.2SO.sub.3.sup.—). See Product Bulleting “SP Sepharose High Performance”, cytiva.com. It has an operational pH stability of 4-13. Id. It has a dynamic binding capacity of ~ 55 ribonuclease A/mL resin. Id.
[0218] Capto™ SP ImpRes is based on a high-flow agarose base matrix with a bead size of about 40 .Math.m. Product Bulletin “Capto™ SP ImpRes, Capto™ Q ImpRes Ion Exchange Chromatography”, cytiva.com. The functional group of Capto™ SP Impres is —CH.sub.2CH.sub.2CH.sub.2SO.sub.3.sup.—. Id. The working operating pH stability is 4 to 12. The binding capacity (10% breakthrough measured at a residence time of 4 min (150 cm/h) in a TricornTM 5/100 column with 10 cm bed height; 20 mM sodium phosphate, pH 7.2 (lysozyme) and 50 mM Tris, pH 8.0 (BSA)) is > 70 mg lysozyme/mL medium and > 95 mg BSA/mL medium.
[0219] Capto™ S is a strong cation exchange resin based on a highly cross-linked agarose, spherical matrix with a median particle size of the cumulative volume distribution of about 90 .Math.m that uses the —SO3.sup.— charged group shown below
##STR00001##
[0220] See Cytiva, “Ion Exchange Resins”, 28407452 AG, cytiva.com. It has a dynamic binding capacity of > 120 mg lysozyme / mL resin (at 10% breakthrough by frontal analysis at a mobile phase velocity of 600 cm/h in a Tricorn™ 5/100 column at 10 cm bed height (1 min residence time) for lysozyme in 30 mM sodium phosphate, pH 6.8) and > 60 mg β-Lactoglobulin/mL resin (at 10% breakthrough by frontal analysis at a mobile phase velocity of 600 cm/h in a PEEK 7.5/100 column at 10 cm bed height (1 min residence time) for β-lactoglobulin in 100 mM citrate, pH 3) and can be operated at pH 4 to 12.
[0221] The Capto™ S Impact is based on a high-flow agarose base matrix with a median particle size of the cumulative volume distribution of about 50 .Math.m that uses a —SO3.sup.— ligand. See Capto™ S ImpAct product sheet, cytiva.com. It has a binding capacity of >85 mg BSA/mL resin, >90 mg lysozyme/mL resin, >100 mg IgG/ mL resin. Id.
[0222] In some embodiments, the strong cation exchange resin has a binding capacity of 50 mg/mL or more, e.g., 75 mg/mL or more, e.g., 100 mg/mL or more, measured as 5% breakthrough of Polyclonal Human IgG in 20 mM MES< 40 mM NaCl, pH 5.0 at 300 cm/hour in 0.46 cmD × 20 cmL column.
[0223] In some embodiments, the strong cation exchange resin maintains binding capacity of 50 mg/mL or more, e.g., 75 mg/mL or more, e.g., 100 mg/mL or more, measured as 5% breakthrough of Polyclonal Human IgG in 20 mM MES< 40 mM NaCl, pH 5.0 at 300 cm/hour in 0.46 cmD × 20 cmL column, at up to 150 mM NaCl (15 mS/cm).
[0224] In some embodiments, the functional group of the strong cation exchange resin comprises SO.sub.3—. In some embodiments, the functional group of the strong cation exchange resin is —CH.sub.2CH.sub.2CH.sub.2SO.sub.3.sup.—.
[0225] In some embodiments, the cation exchange chromatography is carried out in flow through mode. In some embodiments, the cation exchange chromatography is carried out in bind and elute mode. In some embodiments, the antibod(ies), e.g., sialylated antibod(ies), e.g., hsIgG, flow through the cation exchange chromatography resin. In some embodiments, the antibod(ies), e.g., sialylated antibod(ies), e.g., hsIgG, are bound and then eluted from the cation exchange chromatography resin.
[0226] In some embodiments, a composition comprising sialylated antibod(ies), e.g., hsIgG, and one or more impurities is loaded on to the CEX column. In some embodiments the composition is a sialylation reaction mixture, e.g., a sialylation mixture comprising sialylated antibod(ies), e.g., as described herein, is loaded on to the CEX column.
[0227] In some embodiments, from or from about 10 to or to about 110 mg antibod(ies), per mL resin are loaded on to the CEX column. In some embodiments, from or from about 10 to or to about 100, from or from about 10 to or to about 90, from or from about 10 to or to about 80, from or from about 10 to or to about 70, from or from about 10 to or to about 60, from or from about 10 to or to about 50, from or from about 10 to or to about 40, from or from about 10 to or to about 30, from or from about 10 to or to about 20, from or from about 20 to or to about 110, from or from about 20 to or to about 100, from or from about 20 to or to about 90, from or from about 20 to or to about 80, from or from about 20 to or to about 70, from or from about 20 to or to about 60, from or from about 20 to or to about 50, from or from about 20 to or to about 40, from or from about 20 to or to about 30, from or from about 30 to or to about 110, from or from about 30 to or to about 100, from or from about 30 to or to about 90, from or from about 30 to or to about 80, from or from about 30 to or to about 70, from or from about 30 to or to about 60, from or from about 30 to or to about 50, from or from about 30 to or to about 40, from or from about 40 to or to about 110, from or from about 40 to or to about 100, from or from about 40 to or to about 90, from or from about 40 to or to about 80, from or from about 40 to or to about 70, from or from about 40 to or to about 60, from or from about 40 to or to about 50, from or from about 50 to or to about 110, from or from about 50 to or to about 100, from or from about 50 to or to about 90, from or from about 50 to or to about 80, from or from about 50 to or to about 70, from or from about 50 to or to about 60, from or from about 60 to or to about 110, from or from about 60 to or to about 100, from or from about 60 to or to about 90, from or from about 60 to or to about 80, from or from about 60 to or to about 70, from or from about 70 to or to about 110, from or from about 70 to or to about 100, from or from about 70 to or to about 90, from or from about 70 to or to about 80, from or from about 80 to or to about 110, from or from about 80 to or to about 100, from or from about 80 to or to about 90, from or from about 90 to or to about 110, from or from about 90 to or to about 100, or from or from about 100 to or to about 110 mg antibod(ies), e.g., sialylated antibod(ies), e.g., hsIgG per mL resin are loaded on to the CEX column.
[0228] In some embodiments, the methods described herein include one or more of: (a) a quenching step, e.g., as described herein, (b) a depth filtration step, e.g., as described herein (c) a buffer exchange step, e.g., as described herein, (d) a virus inactivation or removal step, e.g., as described herein, and (e) a nanofiltration step, e.g., as described herein, before CEX chromatography.
[0229] In some embodiments, the methods described herein comprise one or more of: (a) blue dye chromatography, e.g., as described herein, (b) DE pad filtration, e.g., as described herein, (c) buffer exchange, e.g., as described herein, and (d) PS20 Spiking & Filtration, e.g., as described herein, after CEX chromatography.
[0230] Provided herein is a method for purifying sialylated antibod(ies), which includes, in order from (a) to (d): (a) providing a composition comprising sialylated antibod(ies), e.g., hsIgG and galactosylation and/or sialylation enzyme(s), e.g., B4GalT and/or ST6 or enzymatically active portion thereof, e.g., as described herein, and, for example, if it is a sialylation reaction mixture, e.g., as described herein, optionally quenching the reaction, e.g., as described herein, e.g., in PBS, e.g., in 5X PBS at a 1:1 dilution; (b) diluting the composition, e.g., with citrate buffer (e.g., 6.757 g/L sodium citrate dehydrate and 5.192 g/L citric acid buffer), e.g., citrate buffer at or at about 50 mM, at or at about pH 4.5, thereby producing a buffered antibody composition; (c) applying the buffered antibody composition to a CEX column, e.g., a CEX column described herein, under conditions that bind the sialylated antibod(ies), e.g., hsIgG, as well as the galactosylation and/or sialylation enzyme(s); and (d) selectively eluting the sialylated antibod(ies), e.g., hsIgG from the CEX column, thereby producing purified sialylated antibod(ies).
[0231] In some embodiments, the method does not contain any additional filtering, fractionation, or purification steps other than (a) and (b) before carrying out step (c). In some embodiments, the method comprises a single depth filtering step, in addition to steps (a) and (b) before step (c), e.g., between steps (a) and (b), but does not comprise any additional filtering, fractionation, or purification steps beyond the single depth filtration step before carrying out step (c). In some embodiments, the method comprises a viral inactivation step before step (c). In some embodiments, the applying in step (c) is spaced out in time, e.g., a portion of the buffered antibody composition is applied to the column over more than one application, e.g., over 1, 2, or 3 applications. In some embodiments, step (e) is repeated one or more times. In some embodiments, step (c) is carried out at resident time(s) of from or from about 1, 2, 3, 4, 5, or 6 minutes.
[0232] In some embodiments, selectively eluting the sialylated antibod(ies) comprises eluting in a buffer comprising 400 mM or more NaCl, e.g., a citrate buffer at or at about 50 mM, 400 mM or more NaCl, at or at about pH 4.5.
[0233] In some embodiments, the method further comprises, following step (e), one or more of: (f) a blue dye chromatography step, e.g., a Trisacyl Blue (TAB) chromatography, e.g., as described herein, (g) a DE Pad filtration step, e.g., as described herein, (h) a depth filtration step, e.g., as described herein; and (g) a PS20 spiking & filtration step, e.g., as described herein.
[0234] In some embodiments, this method produces yields (antibody recovery rate) of or of about 80%, 85%, 90%, or 95% or more with sialylating enzyme, e.g., ST6 or enzymatically active portion thereof, present at 100 ppm, 90 ppm, 80 ppm, 70 ppm, 60 ppm, 50 ppm, 40 ppm, or 30 ppm or less.
Blue Dye Affinity Chromatography
[0235] The methods described herein e.g., methods for producing and/or purifying antibod(ies), e.g., IgG, e.g., pooled IgG, e.g., IVIg, e.g., e.g., sialylated IgG, e.g., sialylated pooled IgG, e.g., sialylated IVIg, e.g., hsIgG, can include blue dye affinity chromatography as part of the purification process, e.g., an affinity chromatography step using a blue dye resin.
[0236] In some embodiments, the blue dye resin is selected from the group consisting of Blue Trisacryl™ (e.g., Sartorius 25896-010), Capto™ Blue (e.g., Cytiva 17544801), Capto™ Blue HS, (e.g., Cytiva 17545202), Blue Sepharose™ (e.g., Cytiva 17-0948-01), and combinations thereof.
[0237] The Blue Trisacryl™ resin is based on a synthetic polymer matrix with a bead size of 60 .Math.m that uses a blue dye ligand as the functional group. See Product Specifications, Sartorius 25896-010, Sartorius.com. It has an operational pH of 4-10. Id.
[0238] The Capto™ Blue resins are based on a highly cross-linked agarose matrix with an average particle size of 75 .Math.m. See Product Bulletin, “Capto Blue and Capto Blue (high sub) Affinity Chromatography,” cytiva.com. They use a Cibacron™ Blue (1-amino-4-[4-[[4-chloro-6-(2-sulfoanilino)-1,3,5-triazin-2-yl]amino]-3-sulfoanilino]-9,10-dioxoanthracene-2-sulfonic acid) ligand. Id; PubChem ID 172469. They have an operation pH of 3-13. Capto™ Blue has a dynamic binding capacity of HSA at 10% breakthrough of 24 mg/mL at 4 min residence time and Capto™ Blue HS has a dynamic binding capacity of HSA at 10% breakthrough of 30 mg/mL at 4 min residence time. Id.
[0239] Blue Sepharose™ is based on a highly cross-linked agarose base matrix (6% spherical) with a median particle size of the cumulative volume distribution of ~90 .Math.m. See Product Bulletin, “Blue Sepharose 6 Fast Flow Affinity Chromatography,” cytiva.com. It uses a Cibacron™ Blue 3G (1-amino-4-[4-[[4-chloro-6-(3-sulfoanilino)-1,3,5-triazin-2-yl]amino]-3-sulfoanilino]-9,10-dioxoanthracene-2-sulfonic acid). It has an operational pH stability from 4-12 and a total binding capacity of ≥ 18 mg human serum albumin/mL resin (Protein in excess is loaded in 0.050 M Potassium dihydrogen phosphate, pH 7.0 on a PEEK 7.5/50 column. The binding capacity is obtained by measuring the amount of bound and eluted protein in 0.050 M Potassium dihydrogen phosphate, 1.5 M Potassium chloride, pH 7.0.).
[0240] In some embodiments, the blue dye affinity chromatography is carried out in flow through mode. In some embodiments, the antibod(ies), e.g., sialylated antibod(ies), e.g., hsIgG, flow through the blue dye chromatography resin.
[0241] In some embodiments, a composition comprising sialylated antibod(ies), e.g., hsIgG, and one or more impurities is loaded on to the blue dye column. In some embodiments the composition is a sialylation reaction mixture, e.g., a sialylation mixture comprising sialylated antibod(ies), e.g., as described herein, is loaded on to the blue dye column.
[0242] In some embodiments, from or from about 10 to or to about 110 mg antibod(ies), per mL resin are loaded on to the blue dye column. In some embodiments, from or from about 10 to or to about 100, from or from about 10 to or to about 90, from or from about 10 to or to about 80, from or from about 10 to or to about 70, from or from about 10 to or to about 60, from or from about 10 to or to about 50, from or from about 10 to or to about 40, from or from about 10 to or to about 30, from or from about 10 to or to about 20, from or from about 20 to or to about 110, from or from about 20 to or to about 100, from or from about 20 to or to about 90, from or from about 20 to or to about 80, from or from about 20 to or to about 70, from or from about 20 to or to about 60, from or from about 20 to or to about 50, from or from about 20 to or to about 40, from or from about 20 to or to about 30, from or from about 30 to or to about 110, from or from about 30 to or to about 100, from or from about 30 to or to about 90, from or from about 30 to or to about 80, from or from about 30 to or to about 70, from or from about 30 to or to about 60, from or from about 30 to or to about 50, from or from about 30 to or to about 40, from or from about 40 to or to about 110, from or from about 40 to or to about 100, from or from about 40 to or to about 90, from or from about 40 to or to about 80, from or from about 40 to or to about 70, from or from about 40 to or to about 60, from or from about 40 to or to about 50, from or from about 50 to or to about 110, from or from about 50 to or to about 100, from or from about 50 to or to about 90, from or from about 50 to or to about 80, from or from about 50 to or to about 70, from or from about 50 to or to about 60, from or from about 60 to or to about 110, from or from about 60 to or to about 100, from or from about 60 to or to about 90, from or from about 60 to or to about 80, from or from about 60 to or to about 70, from or from about 70 to or to about 110, from or from about 70 to or to about 100, from or from about 70 to or to about 90, from or from about 70 to or to about 80, from or from about 80 to or to about 110, from or from about 80 to or to about 100, from or from about 80 to or to about 90, from or from about 90 to or to about 110, from or from about 90 to or to about 100, or from or from about 100 to or to about 110 mg antibod(ies), e.g., sialylated antibod(ies), e.g., hsIgG per mL resin are loaded on to the blue dye column.
[0243] In some embodiments, from or from about 10 to or to about 110 centigrams antibod(ies), per mL resin are loaded on to the blue dye column. In some embodiments, from or from about 10 to or to about 100, from or from about 10 to or to about 90, from or from about 10 to or to about 80, from or from about 10 to or to about 70, from or from about 10 to or to about 60, from or from about 10 to or to about 50, from or from about 10 to or to about 40, from or from about 10 to or to about 30, from or from about 10 to or to about 20, from or from about 20 to or to about 110, from or from about 20 to or to about 100, from or from about 20 to or to about 90, from or from about 20 to or to about 80, from or from about 20 to or to about 70, from or from about 20 to or to about 60, from or from about 20 to or to about 50, from or from about 20 to or to about 40, from or from about 20 to or to about 30, from or from about 30 to or to about 110, from or from about 30 to or to about 100, from or from about 30 to or to about 90, from or from about 30 to or to about 80, from or from about 30 to or to about 70, from or from about 30 to or to about 60, from or from about 30 to or to about 50, from or from about 30 to or to about 40, from or from about 40 to or to about 110, from or from about 40 to or to about 100, from or from about 40 to or to about 90, from or from about 40 to or to about 80, from or from about 40 to or to about 70, from or from about 40 to or to about 60, from or from about 40 to or to about 50, from or from about 50 to or to about 110, from or from about 50 to or to about 100, from or from about 50 to or to about 90, from or from about 50 to or to about 80, from or from about 50 to or to about 70, from or from about 50 to or to about 60, from or from about 60 to or to about 110, from or from about 60 to or to about 100, from or from about 60 to or to about 90, from or from about 60 to or to about 80, from or from about 60 to or to about 70, from or from about 70 to or to about 110, from or from about 70 to or to about 100, from or from about 70 to or to about 90, from or from about 70 to or to about 80, from or from about 80 to or to about 110, from or from about 80 to or to about 100, from or from about 80 to or to about 90, from or from about 90 to or to about 110, from or from about 90 to or to about 100, or from or from about 100 to or to about 110 centigrams antibod(ies), e.g., sialylated antibod(ies), e.g., hsIgG per mL resin are loaded on to the blue dye column.
[0244] In some embodiments, the methods described herein include one or more of: (a) a quenching step, e.g., as described herein, (b) a depth filtration step, e.g., as described herein (c) a buffer exchange step, e.g., as described herein, (d) a virus inactivation or removal step, e.g., as described herein, and (e) a nanofiltration step, e.g., as described herein, or (f) a CEX chromatography step, e.g., as described herein, before blue dye chromatography.
[0245] In some embodiments, the method does not comprise a CEX chromatography step.
[0246] In some embodiments, the methods described herein comprise one or more of: (a) DE pad filtration, e.g., as described herein, (b) buffer exchange, e.g., as described herein, and (c) PS20 spiking & filtration, e.g., as described herein, after blue dye chromatography.
[0247] Provided herein is a method for purifying sialylated antibod(ies), which includes, in order from (a) to (c): (a) providing a composition comprising sialylated antibod(ies), e.g., hsIgG and galactosylation and/or sialylation enzyme(s), e.g., B4GalT and/or ST6 or enzymatically active portion thereof, e.g., as described herein, and, for example, if it is a sialylation reaction mixture, e.g., as described herein, optionally quenching the reaction, e.g., as described herein, e.g., in PBS, e.g., in 5X PBS at a 1:1 dilution; (b) diluting the composition in a buffer suitable for use with the column, e.g., for a TAB column with citrate buffer, e.g., citrate buffer at or at about 100 mM, at or at about pH 4.5 with or with about 800 mM NaCl or for a CaptBlue column in or in about 250 mM glycine plus or plus about 100 mM sodium chloride at or at about pH 4.5, thereby producing a buffered antibody composition; and (c) applying the buffered antibody composition to a blue dye column, e.g., a blue column described herein, under conditions that allow 80% or more, e.g., 85% or more, 90% or more, or 95% or more of the sialylated antibod(ies), e.g., hsIgG to flow through, but allows only 30, 40, 50, 60, 70, 80, 90, or 100 ppm or less of the galactosylation and/or sialylation enzyme(s) to flow through, thereby producing purified sialylated antibod(ies).
[0248] In some embodiments, the method does not contain any additional filtering, fractionation, or purification steps other than (a) and (b) before carrying out step (c). In some embodiments, the method comprises a single depth filtering step, in addition to steps (a) and (b) before step (c), e.g., between steps (a) and (b), but does not comprise any additional filtering, fractionation, or purification steps beyond the single depth filtration step before carrying out step (c). In some embodiments, the method comprises a virus inactivation step before step (c). In some embodiments, the applying in step (c) is spaced out in time, e.g., a portion of the buffered antibody composition is applied to the column over more than one application, e.g., over 1, 2, or 3 applications. In some embodiments, step (c) is carried out at resident time(s) of from or from about 1, 2, 3, 4, 5, or 6 minutes.
[0249] In some embodiments, the method further comprises, following step (c), one or more of: (d) a CEX chromatography step, e.g., as described herein, (e) a DE pad filtration step, e.g., as described herein, (f) a depth filtration step, e.g., as described herein; and (g) a PS20 spiking & filtration step, e.g., as described herein.
[0250] In some embodiments, the method further comprises, following step (c), one or more of: (d) a DE pad filtration step, e.g., as described herein, (e) a depth filtration step, e.g., as described herein; and (f) a PS20 spiking & filtration step, e.g., as described herein, but does not comprise a CEX chromatography step, e.g., as described herein.
[0251] In some embodiments, this method produces yields (antibody recovery rate) of or of about 80%, 85%, 90%, or 95% or more with sialylating enzyme, e.g., ST6 or enzymatically active portion thereof, present at 100 ppm, 90 ppm, 80 ppm, 70 ppm, 60 ppm, 50 ppm, 40 ppm, or 30 ppm or less.
Polysorbate Spiking
[0252] Polysorbate, e.g., polysorbate 20, can be added to composition comprising the antibod(ies) described herein, e.g., hsIgG, e.g., purified hsIgG. In some embodiments, the polysorbate is polysorbate 20. In some embodiments, the polysorbate 20 is Super Refined™ polysorbate 20 (Croda Health Care).
Precipitation
[0253] The methods described herein can include precipitation. In some embodiments, the precipitation is ammonium sulfate precipitation.
[0254] In some embodiments, the methods described herein, e.g., methods for purification of antibod(ies), e.g., IgG, e.g., pooled IgG, e.g., IVIg, e.g., e.g., sialylated IgG, e.g., sialylated pooled IgG, e.g., sialylated IVIg, e.g., hsIgG, include ammonium sulfate precipitation.
Variants
[0255] In some embodiments, the enzyme(s) described herein are at least 80%, e.g., at least 85%, 90%, 95%, 98%, or 100% identical to the amino acid sequence of an exemplary sequence (e.g., as provided herein), e.g., have differences at up to 1%, 2%, 5%, 10%, 15%, or 20% of the residues of the exemplary sequence replaced, e.g., with conservative mutations, e.g., including or in addition to the mutations described herein. In preferred embodiments, the variant retains desired activity of the parent, e.g., β-galactoside α-2,6-sialyltransferase activity or β-1,4-galactosyltransferase activity.
[0256] To determine the percent identity of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). The length of a reference sequence aligned for comparison purposes is at least 80% of the length of the reference sequence, and in some embodiments is at least 90% or 100%. The nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein nucleic acid “identity” is equivalent to nucleic acid “homology”). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
[0257] Percent identity between a subject polypeptide or nucleic acid sequence (i.e. a query) and a second polypeptide or nucleic acid sequence (i.e. target) is determined in various ways that are within the skill in the art, for instance, using publicly available computer software such as Smith Waterman Alignment (Smith, T. F. and M. S. Waterman (1981) J Mol Biol 147:195-7); “BestFit” (Smith and Waterman, Advances in Applied Mathematics, 482-489 (1981)) as incorporated into GeneMatcher Plus™, Schwarz and Dayhof (1979) Atlas of Protein Sequence and Structure, Dayhof, M.O., Ed, pp 353-358; BLAST program (Basic Local Alignment Search Tool; (Altschul, S. F., W. Gish, et al. (1990) J Mol Biol 215: 403-10), BLAST-2, BLAST-P, BLAST-N, BLAST-X, WU-BLAST-2, ALIGN, ALIGN-2, CLUSTAL, or Megalign (DNASTAR) software. In addition, those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the length of the sequences being compared. In general, for target proteins or nucleic acids, the length of comparison can be any length, up to and including full length of the target (e.g., 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). For the purposes of the present disclosure, percent identity is relative to the full length of the query sequence.
[0258] For purposes of the present disclosure, the comparison of sequences and determination of percent identity between two sequences can be accomplished using a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
[0259] Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
EXAMPLES
[0260] The invention is further described in the following examples, which do not limit the scope of the invention described in the claims.
Example 1: Hypersialylated IgG Preparation
[0261] IgG in which more than 60% of the overall branched glycans are disialylated can be prepared as follows.
[0262] Briefly, a mixture of IgG antibodies is exposed to a sequential enzymatic reaction using β1,4 galactosyltransferase 1 (B4GalT) and α2,6-sialyltransferase (ST6Gal1) enzymes. The B4GalT does not need to be removed from the reaction before addition of ST6Ga11 and no partial or complete purification of the product is needed between the enzymatic reactions.
[0263] The galactosyltransferase enzyme selectively adds galactose residues to pre-existing asparagine-linked glycans. The resulting galactosylated glycans serve as substrates to the sialic acid transferase enzyme which selectively adds sialic acid residues to cap the asparagine-linked glycan structures attached to. Thus, the overall sialylation reaction employed two sugar nucleotides (uridine 5′-diphosphogalactose (UDP-Gal) and cytidine-5′-monophospho-N-acetylneuraminic acid (CMP-NANA)). The latter is replenished periodically to increase disialylated product relative to monosialylated product. The reaction includes the co-factor manganese chloride.
[0264] A representative example of the IgG-Fc glycan profile for such a reaction starting with IVIg and the reaction product is shown in the
[0265] The glycan data is shown per IgG subclass. Glycans from IgG3 and IgG4 subclasses cannot be quantified separately. As shown, for IVIg the sum of all the nonsialylated glycans is more than 80% and the sum of all sialylated glycans is < 20%. For the reaction product, the sum for all nonsialylated glycans is < 20% and the sum for all sialylated glycans is more than 80%. Nomenclature for different glycans listed in the glycoprofile use the Oxford notation for N linked glycans.
Example 2: Alternative Sialylation Condition
[0266] An alternative suitable reaction conditions for galactosylation and sialylation to create hsIgG in 50 mM BIS-TRIS pH 6.9 include: galactosylation of IgG antibodies (e.g., pooled IgG antibodies, pooled immunoglobulins or IVIg) are as follows: 7.4 mM MnCl.sub.2; 38 .Math.mol UDP-Gal/g IgG antibody; and 7.5 units B4GalT/g IgG antibody with 16-24 hours of incubation at 37° C. followed by sialylation in 7.4 mM MnC12; 220 .Math.mol CMP-NANA/g IgG antibody (added twice: half at the start of the reaction and half after 9-10 hrs); and 15 units ST6-Gal1/g IgG antibody with 30-33 hours of incubation at 37° C. The reaction can be carried out by adding the ST6-Gal1 and CMP-NANA to the galactosylation reaction. Alternatively, all of the reactants can be combined at the outset and the CMP-NANA supplemented.
Example 3: Purification of hsIgG
[0267] It is desirable to have an efficient, economical method for purifying hsIgG prepared, for example, by any of the methods described herein. In order to prepared hsIgG suitable for use in a drug product is desirable to efficiently remove the enzymes, sugar nucleotide and manganese in the reaction(s) used to prepare hsIgG. Moreover, it can be desirable to reduce or eliminate the need for buffer exchange. Finally, since hsIgG can include a variety of IgG subclasses (e.g., IgG1, IgG2, etc.) it can be desirable to employ methods that produce a purified produce that does not unduly alter the subclass distribution of the unpurified material.
[0268] Protein A column chromatography was examined. Wash conditions including simple (NaCl, Na.sub.2SO.sub.4) and chaotropic (arginine, MgCl.sub.2, KSCN) salts, buffer (phosphate, TRIS, BIS-TRIS, acetate, formate, glycolate, citrate, MOPS), organic modifier (ethylene glycol, propylene glycol), additives (imidazole, methyl galactopyranoside, lactose), and pH were examined.
[0269] Using A Mabselect PrismA column (GE Healthcare Life Sciences), loading of filtered reaction mixture (preferably in 50 mM MOPS at pH 7.4) followed by washing with 50 mM sodium acetate pH 4.99 and elution with glycine pH 3.0, produced hsIgG with a subclass profile similar to the initially loaded material (Loaded: IgG168%; IgG2 30%; IgG3 1.8% and IgG4 1.4%; Eluate: IgG170%; IgG2 29%; IgG3 0.9% and IgG4 1.1%). This column step substantially removed ST6-Gal. The Protein A column step was followed by a polishing step employing a Blue Trisacryl M (Pall Corp.) column in flow-thru mode. Here the loading buffer was 0.4 M NaCl, 50 mM Na citrate pH 4.5 and the wash buffer was 2 M NaCl, 50 mM sodium phosphate pH 7.0. This provided a very clean product. A different type of blue dye column with a sepharose base resin (HiTrap Blue HP; GE Healthcare Life Sciences) was used in a bind and elute mode. Here, loading in 50 mM sodium citrate pH 4.5 and elution in 1.5 M KCI, 32.5 mM sodium citrate, 35% ethylene glycol, pH 4.51 provided a very clean product.
Example 4: Purification Process and Improvements
[0270] Various improvements to the following hsIgG manufacturing process show in
[0271] After sialylation (step 4 in
[0272] In the glycine buffer, the pH of the process material is lowered to 3.5 for viral inactivation. It is held at the low pH for 90 minutes before being quenched and the pH raised to 4.5 (step 7 in
[0273] The first purification step (step 11 in
Example 5: Strong Cation Exchange Resin in Bind and Elute Mode
[0274] The process comprises two TFF steps (buffer exchanges/one concentration), three depth filtration steps, and two dilutions before chromatography. These steps are expensive (material / buffer / operating time / lost product). Reducing the number of steps before the chromatography purification reduces cost, operation time, and the amount of material lost while still removing reaction impurities (e.g., nucleotides, enzymes, manganese chloride).
[0275] As described herein, steps 5-10 in
Resin Screening
[0276] Five different strong cation exchange resins were evaluated for their ability to separate IVIg from ST6 spiked into solution: Poros™ XS, Capto™ S, Capto™ SP Impres, SP HP, and Capto™ S Impact. The load material was prepared by diluting 0.55 mL IVIg at 100 mg/mL 1:10 with 50 mM citrate pH 4.5 and then spiking in 3.3 mL of ST6 at 16 mg/mL. For each resin, 8 mL of the load material was applied to the column and then eluted by linear gradient into 50 mM citrate, 1 M NaCl pH 4.5. The ability of each resin to separate IVIg and ST6 was evaluated by observing the chromatograms and by using Unicorn to calculate the peak resolution shown in the equation below (t is mean retention time, W is peak width). The resolution calculations (Table 9) showed that Poros™ XS performed the best for separation of IVIg from ST6.
TABLE-US-00009 Resolution of resins Resin Resolution Capto™ S Impact 0.87 Capto™ S 0.37 Capto™ SP Impres 0.90 SP HP 1.01 Poros™ XS 1.17
Binding Capacity Determination
[0277] Operating the Poros™ resin in flow through mode is advantageous because it allows for only one cycle and a smaller resin requirement since the resin only needs to bind the impurities. When using the Poros™ XS resin in bind and elute mode the number of cycles required for complete processing depends on how much product it can bind at one time. A load solution was made by diluting IVIg 1:20 with 50 mM citrate pH 4.5. The load solution was applied to the column at 2-, 4- and 6-minute residence times and the binding capacity evaluated at a 5% breakthrough.
Yield & Residual ST6 Evaluation
[0278] The yield and residual ST6 for differing load capacity and elution buffer conductivity was evaluated over a number of runs to identify the best elution conditions and loading capacity (Table 10). The loading solution was prepared by diluting 2.8 g of IVIg, and 500 uL of ST6 at 15.6 mg/mL and diluting the solution 1:20 with 50 mM citrate pH 4.5. All steps were operated at a 5-minute residence time. Load material is 2,700 ppm in ST6.
TABLE-US-00010 Run Load Capacity (mg/mL-resin) Elution Conductivity (mS/cm) Load Mass (mg) Eluate Vol (mL) Eluate Cone (mg/mL) Yield (%) ST6 (ppm) 1 55 44 110 9 11.2 91.6 19.9 2 55 49 110 9 11.7 95.7 71.2 3 70 44 140 9 14.5 93.2 9.2 4 70 49 140 9 14.5 93.2 73.5 5 85 44 170 9 17.1 90.5 15.8 6 85 49 170 9 17.1 90.5 84.3 7 55 39.4 110 9 11.1 90.8 6.1 8 70 39.4 140 9 13.6 87.4 8.2 9 85 39.4 170 9 16.9 89.5 6.7
[0279] Statistical analysis showed that the elution conductivity was the only significant parameter in the regression models for both yield and residual ST6. The prediction profiler in
[0280]
Purification of hsIVIg Reaction Mixture
[0281] A number of runs were performed with a hsIVIg generated using the sialylation procedure developed in MOPS (Table 11). The hsIVIg reaction mixture was quenched with 5x PBS with a 1:1 dilution and then diluted more with 50 mM citrate pH 4.5. 50 mM citrate, 400 mM NaCl pH 4.5 was used as elution buffer for all the runs below. Concentrations of 7.15 mg/mL correspond to 1:20 dilution with 50 mM citrate pH 4.5. Five minute residence times were used for all steps.
TABLE-US-00011 Run Load Capacity (mg/mL-resin) Load Conc. (mg/mL) Yield % ST6 (ppm) 3 28.6 14.3 87.5 31.9 4 57.2 7.15 91.9 33.3 5 14.3 7.15 97.3 38.4 6 28.6 7.15 91.4 29.1 10 35.7 6.08 93.5 24.1
[0282] The flow through step contains no IgG only nucleotides and manganese chloride as seen by the SEC chromatogram of the flow through in
[0283] This can be compared to the SEC of the eluate in
Results Summary
[0284] These results show that by diluting the reaction mixture directly into 50 mM citrate pH 4.5 and loading onto the same Poros™ XS resin, the current hsIVIg process is improved significantly. Binding the hsIVIg to the resin allows for a much simpler path to removing nucleotides and manganese chloride (achieved by buffer exchange previously). Using 50 mM citrate, 400 mM NaCl pH 4.5, it is clear that significant ST6 enzyme clearance can be achieved. In addition, the Poros™ XS eluate pool is in the appropriate conditions for the subsequent TAB purification step.
[0285] In a manufacturing scale process, a single depth filtration step may still be used. The sialylation reaction mixture is often very turbid and not suitable for direct loading to a chromatography resin. So, after diluting the quenched reaction mixture with 50 mM citrate pH 4.5, the process material may be depth filtered before loading onto the Poros™ XS resin.
Example 6: Alternative Columns
[0286] The current manufacturing process of M254 uses a trisacryl blue (TAB) column in flow-through mode which does not withstand high concentration of sodium hydroxide wash. This results in a higher level of bioburden in some batches. Different blue resins have been evaluated and Capto™ Blue High Sub (Capto™ Blue HS) has been found to be a good alternative for the TAB column with similar recovery and better enzymes clearance. In addition, Capto™ Blue High Sub can withstand a high sodium hydroxide wash and has the potential to reduce the number of steps of the current purification process.
Evaluation of Capto™ Blue and Blue Sepharose™
[0287] Two chromatography resins have been evaluated against TAB to determine if the recovery is impacted. For that purpose, 250 mg of IVIg diluted 1: 1 in 800 mM NaCL +100 mM citrate pH 4.5 and loaded directly in triplicate. Overlay of the chromatograms of one of the runs is shown in
Comparison of Capto™ Blue and Capto™ Blue HS
[0288] Capto™ Blue and Capto™ Blue HS have been compared to evaluate the recovery and enzyme clearance. Multiple runs were executed where either hsIGIV (post strong cation exchange column flow-through material) was loaded directly or loaded after dilution. Table 12 summarizes different load conditions while Table 13 is showing the mass balance:
TABLE-US-00012 Loading conditions Run #1 Run # 2 Run #3 Run #4 Chromatography Resin 1 mL Capto™ Blue 1 mL Capto™ Blue 1 mL Capto™ Blue HS 1 mL Capto™ Blue HS Starting material hsIVIg SCX FT hsIVIg SCX Load hsIVIg SCX FT *hsIVIg SCX FT diluted (1:1) Protein Concentration (mg/mL) 25.2 25.9 25.2 12.7 Amount loaded (g) 2 2 1.1 1.1 IVIg g/mL of resins 2 2 1.1 1.1 Flow rate (mL/min) 0.17 0.17 0.17 0.17 Residence time (min) 6 6 6 6 Spiked enzymes /mg of IVIg N/A N/A 0.2 uL/mg N/A
[0289] As shown in
TABLE-US-00013 Recovery of Capto™ B and Capto™ Blue HS Capto™ Blue run Mass Balance (%) Strip (%) Run 1 (Capto™ B) 97.5 2.2 Run2 (Capto™ B) 96.7 2.2 Run 3 (Capto™ B HS) 99.6 4.9 Run 4 (Capto™ B HS) 96.2 6.7
[0290] Recovery of the Capto™ Blue HS is very similar to the Capto™ blue and 96% recovery is considered satisfactory to be implemented instead of TAB column.
[0291] Residual ST6 after Capto™ Blue and Capto™ Blue HS was also evaluated and found to be as low if not lower than TAB as shown in
Impact of Using Capto™ Blue HS on Product Attributes
[0292] IVIg from Capto™ Blue HS flow through and eluate were compared to the load to evaluate impact on the product quality. Analytical SEC of the load, flow-through and eluate were compared; no differences were found, as demonstrated in
TABLE-US-00014 Level of aggregate, dimer and monomer are very similar RT of the monomer (min) Agg.(%) Dimer (%) Monomer (%) LMW (%) Load 7.889 1.2 9.9 84.0 4.9 FT 7.905 1.5 10.0 83.7 4.8 Eluate 7.903 1.3 9.4 84.6 4.7
[0293] IgG subclass distribution was evaluated by mass spectrometry (
Example 7: Elimination of Cation Exchange Column
Capto™ Blue HS
[0294] In order to reduce the number of current manufacturing process steps, different conditions were evaluated and residual ST6 was evaluated: [0295] Run1: Capto™ Blue HS flow through of an experiment with residual ST6 of 651 ppm was used as loading test material to evaluate 5X PBS and MOPS at pH 4.5 buffer as loading buffer which will mimic loading material directly into the column after the reaction. [0296] Run 2: Post viral inactivation material with residual ST6 of 1400 ppm was loaded directly onto the Capto™ Blue HS resin using 250 mM Glycine pH 4.5. [0297] Run 3: Post viral inactivation material with residual ST6 of 1400 ppm was loaded directly onto the Capto™ Blue HS resin using 250 mM Glycine + 100 mM Sodium Chloride pH 4.5.
[0298] The residual ST6 of the three runs were evaluated, as shown in
Trisacryl Blue (TAB)
[0299] The current manufacturing process has two chromatography columns, CEX followed by TAB to reduce the level of added ST6 during enzymatic reaction. Residual level of ST6 was 2.5-7.2 ppm for the historical manufactured drug substance lots. Maximum loading for the historical manufacturing process using the TAB column was 1.1 g IVIg/ml resin (1X).
[0300] In the present study, TAB column runs were performed to understand the feasibility to increase the loading capacity and to eliminate CEX column from the current manufacturing process.
[0301] Pre-packed 1ml TAB columns were used for the loading study. TAB column loading study runs were performed with CEX load and CEX eluate obtained from 1.5 Kg GMP run lot # 20006. TAB column runs were performed by using AKTA Avant 150. Load flow rate was maintained at 0.17 ml/min to achieve residence time similarly to manufacturing column operation. Load flow-through fractions were collected, protein concentration measured by A280, and residual level of ST6 determined by ELISA.
[0302] As shown in
[0303] In the present study, TAB column run was performed with CEX load, in other words without CEX column purification. As shown in the
[0304] Results in the present study indicated 1.1 g/ml as maximum loading for the TAB column to decrease the level of ST6 ≤7.2 ppm for drug substance similarly to historical manufacturing runs (ST6 level 2.5-7.2 ppm). Additionally, results in the present study suggest without CEX column, TAB column efficiently decreases the level of ST6 to meet the current target (drug substance ≤7.2 ppm).
Example 8: Ammonium Sulfate Precipitation
[0305] IVIg is isolated and purified from human plasma in some methods by precipitation using either ethanol or polyethylene glycol at low temperature. Here, we evaluate precipitation of hsIVIg using ammonium sulfate to remove residual ST6.
[0306] For that purpose, IVIg and hsIVIg were precipitated as follows. A saturated solution of ammonium sulfate was prepared by adding the powder directly into a 100 mL of water while stirring. Once a significant amount of the powder was precipitated the solution was left stirring for 30 min then decanted from the precipitate and added as is to the IVIG solution. The saturated ammonium sulfate solution was added until the solution of the IVIG turned white and no change in the color was seen. The precipitate was collected by centrifugation or by sterile filtration.
[0307]
[0308] From a single experiment, we can see that it is possible to remove residual enzymes by precipitation. Aggregate seen when material was collected by filtration is not an issue knowing that filtration is not a way to collect IVIg.
TABLE-US-00015 Ammonium Sulfate Precipitation Results Mode Starting material Recovery (%) ST6 (ppm) Aggregates by SEC (%) Dimer by SEC (%) Monomer by SEC (%) Centrifugation IVIg 86 N/A 1.4 9.8 88.8 Filtration hs-IVIg 97 36 3.7 14.6 81.8
SEQUENCES
[0309] TABLE-US-00016 SEQ ID NO: 1 (IgG1) EEQYNSTYR
TABLE-US-00017 SEQ ID NO: 2 (IgG2/3) EEQFNSTFR
TABLE-US-00018 SEQ ID NO: 3 (IgG3/4) EEQYNSTFR
TABLE-US-00019 SEQ ID NO: 4 (IgG3/4) EEQFNSTYR
TABLE-US-00020 SEQ ID NO: 5 (NP_001488.2 B4GALT1 [organism=Homo sapiens] [GeneID=2683] [isoform=1]) MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRL PQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDS SPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVD LELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHP VLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVD LIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTI NGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNE PNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
TABLE-US-00021 SEQ ID NO: 6 (NP_001365424.1 B4GALT1 [organism=Homo sapiens] [GeneID=2683] [isoform=2]) MPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGG SNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASN LTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKM GGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYV INQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCF SQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGE DDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTK ETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
TABLE-US-00022 SEQ ID NO: 7 (NP_001365425.1 B4GALT1 [organism=Homo sapiens] [GeneID=2683] [isoform=3]) MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRL PQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDS SPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVD LELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHP VLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVD LIPMNDHNAYRCFSQPRHISVAMDKFGFRLVFRGMSISRPNAVVGRCRMI RHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQIT VDIGTPS
TABLE-US-00023 SEQ ID NO: 8 (NP_001365426.1 B4GALT1 [organism=Homo sapiens] [GeneID=2683] [isoform=4]) MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRL PQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDS SPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVD LELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHP VLQRQQLDYGIYVINQYEKIRRLLW
TABLE-US-00024 SEQ ID NO: 9 MRLREPLLSGSAAMPGASLQRACR
TABLE-US-00025 SEQ ID NO: 10 LLVAVCALHLGVTLVYYLAG
TABLE-US-00026 SEQ ID NO: 11 RDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQP RPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIE FNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYW LYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCF VFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSK QQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHS RDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDI GTPS
TABLE-US-00027 SEQ ID NO: 12 (B4GalT) GPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQN PNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLD YGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHN AYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYW GWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDR IAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
TABLE-US-00028 SEQ ID NO: 13 (B4GalT) gssplldmGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVD LELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHP VLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVD LIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTI NGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNE PNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPSpr dhhhhhhh
TABLE-US-00029 SEQ ID NO: 14 (NP_001340845.1 (NP_003023.1, NP_775323.1) ST6GAL1 [organism=Homo sapiens] [GeneID=6480] [isoform=a]) MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKS LGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDS SSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNV SMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGR EIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYN EGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQM PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKT DVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPG FRTIHC
TABLE-US-00030 SEQ ID NO: 15 (NP_775324.1 ST6GAL1 [organism=Homo sapiens] [GeneID=6480] [isoform=b]) MNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNY KTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIM MTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKH LNQGTDEDIYLLGKATLPGFRTIHC
TABLE-US-00031 SEQ ID NO: 16 MIHTNLKKK
TABLE-US-00032 SEQ ID NO: 17 FSCCVLVFLLFAVICVW
TABLE-US-00033 SEQ ID NO: 18 KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQ TLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSY KGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRT KAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTK TTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYN FFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGML GIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEK NLVKHLNQGTDEDIYLLGKATLPGFRTIHC
TABLE-US-00034 SEQ ID NO: 19 (ST6Gal1) AKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFS AEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAV VSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQL VTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRK LHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCD QVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGT DEDIYLLGKATLPGFRTIHC
TABLE-US-00035 SEQ ID NO: 20 (ST6Gal1) gssplldmlehhhhhhhhmAKPEASFQVWNKDSSSKNLIPRLQKIWKNYL SMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEG YLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTA NFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIP KWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQ PNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMG AYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
OTHER EMBODIMENTS
[0310] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.