CARDIAC CELL PROLIFERATION BY ADMINISTERING INHIBITORS OF SAV1, NF2, MOB1 AND/OR MUTANT SRF

20230193267 · 2023-06-22

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed are DsiRNA inhibitors for the genes encoding SAV1, NF2 and MOB1, which cause proliferation of cardiomyocytes on administration to a mammal. The DsiRNA inhibitors can also be administered with a mutant SRF(153-A3) or an mRNA encoding it, and/or Yap5SA (a Yap mutant) or an encoding mRNA, which enhance the proliferative effect on cardiomyocytes. Mutant SRF(153-A3) with Yap5SA alone also induce myocyte replication.

    Claims

    1. A method of inducing replication of cardiac cells in a mammal, comprising: administering to the mammal one or more of the following complementary DsiRNA pairs, or sequences having 95% or more sequence identity to one or more of the sequences in said one or more complementary DsiRNA pairs, wherein the complementary DsiRNA pairs are selected from the group consisting of: SEQ ID NOS: 1 & 2; SEQ ID NOS: 3 & 4; SEQ ID NOS: 5 & 6; SEQ ID NOS: 7 & 8; SEQ ID NOS: 9 & 10; SEQ ID NOS: 11 & 12; SEQ ID NOS: 13 & 14; SEQ ID NOS: 15 & 16; SEQ ID NOS: 17 & 18; SEQ ID NOS: 19 & 20; SEQ ID NOS: 21 & 22; SEQ ID NOS: 23 & 24; SEQ ID NOS: 25 & 26; SEQ ID NOS: 27 & 28; SEQ ID NOS: 29 & 30; SEQ ID NOS: 31 & 32; SEQ ID NOS: 33 & 34; SEQ ID NOS: 35 & 36; SEQ ID NOS: 37 & 38; SEQ ID NOS: 39 & 40; SEQ ID NOS: 41 & 42; SEQ ID NOS: 43 & 44; SEQ ID NOS: 45 & 46 and SEQ ID NOS: 47 & 48.

    2. The method of claim 1 wherein the complementary DsiRNA pairs target the Sav1 gene and are selected from the group consisting of: SEQ ID NOS: 1 & 2; SEQ ID NOS: 3 & 4; SEQ ID NOS: 5 & 6; SEQ ID NOS: 7 & 8; SEQ ID NOS: 9 & 10; SEQ ID NOS: 11 & 12; SEQ ID NOS: 13 & 14; and SEQ ID NOS: 15 & 16.

    3. The method of claim 1 wherein the complementary DsiRNA pairs target the NF2 gene and are selected from the group consisting of: SEQ ID NOS: 17 & 18; SEQ ID NOS: 19 & 20; SEQ ID NOS: 21 & 22; SEQ ID NOS: 23 & 24; SEQ ID NOS: 25 & 26; SEQ ID NOS: 27 & 28; SEQ ID NOS: 29 & 30; and SEQ ID NOS: 31 & 32.

    4. The method of claim 1 wherein the complementary DsiRNA pairs target the MOB 1 gene and are selected from the group consisting of: SEQ ID NOS: 33 & 34; SEQ ID NOS: 35 & 36; SEQ ID NOS: 37 & 38; SEQ ID NOS: 39 & 40; SEQ ID NOS: 41 & 42; SEQ ID NOS: 43 & 44; SEQ ID NOS: 45 & 46 and SEQ ID NOS: 47 & 48.

    5. The method of claim 1 wherein the mammal is a human and the complementary DsiRNA pairs are selected from the group consisting of: SEQ ID NOS: 11 & 12; SEQ ID NOS: 13 & 14; SEQ ID NOS: 15 & 16; SEQ ID NOS: 27 & 28; SEQ ID NOS: 29 & 30; SEQ ID NOS: 31 & 32; SEQ ID NOS: 43 & 44; SEQ ID NOS: 45 & 46 and SEQ ID NOS: 47 & 48.

    6. The method of claim 1 wherein the cardiac cells are cardiomyocytes.

    7. The method of claim 1 further including administering the mutant SRF(153-A3) having a sequence at least 95% identical to (SEQ ID NO: 50).

    8. The method of claim 1 further including administering the mutant SRF, wherein the mutant SRF comprises at least 20 residues of the sequence SGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLT (SEQ ID NO: 57) or the mRNA encoding it.

    9. The method of claim 7, wherein the mutant SRF comprises a mutation or mutations selected from an insertion, deletions or substitution in region of KMEFIDN of SEQ ID NO: 50 and the encoding mRNA.

    10. The method of claim 7, wherein the mutant SRF is administered in the form of a polypeptide, a protein, a nucleotide sequence that expresses the mutant SRF, or combinations thereof.

    11. The method of claim 7, wherein the mutant SRF is administered in the form of a messenger RNA sequence that expresses the mutant SRF.

    12. The method of claim 1 further including administering Yap5SA.

    13. The method of claim 12, wherein Yap5SA is administered in the form of a messenger RNA sequence that expresses Yap5SA.

    14. The method of claim 1, wherein the administering is by oral administration, inhalation, subcutaneous administration, intravenous administration, intraperitoneal administration, intramuscular administration, intrathecal injection, intra-articular administration, topical administration, central administration, peripheral administration, aerosol-based administration, nasal administration, transmucosal administration, transdermal administration, parenteral administration, or combinations thereof.

    15. The composition of claim 1, wherein the composition comprises a delivery vehicle.

    16. The composition of claim 1, wherein the delivery vehicle comprises liposomes.

    17. A method of inducing replication of myocytes in a mammal, comprising: administering to the mammal a mutant SRF153(A3), having a sequence at least 95% identical to SEQ ID NO: 50, with Yap5SA.

    18. The method of claim 17, wherein the myocytes are neonatal rat ventricular myocytes.

    Description

    DESCRIPTION OF THE DRAWINGS

    [0012] FIGS. 1A, 1B & 1C respectively show levels of knockdown of proteins SAV1, NF2, and MOB1, in H9C2 differentiated rat heart myocytes, 72 h post transfection, where transfection was with equal proportions of the DsiRNA pairs in SEQ ID NO: 1; SEQ ID NO: 2 with SEQ ID NO: 3; SEQ ID NO: 4 (for SAV1 KD); SEQ ID NO: 17; SEQ ID NO: 18 with SEQ ID NO: 19; SEQ ID NO: 20 (for NF2 KD) and SEQ ID NO: 33; SEQ ID NO: 34 with SEQ ID NO: 35; SEQ ID NO: 36 (for MOB-1 KD). NC-1 is a control DsiRNA used in the transfections. GAPDH is a ubiquitous protein whose levels are included for comparison. FIG. 1A are Western blots showing post-transfection knockdown (“KD”) of each protein. In FIGS. 1A, 1B, the data is a representation of one experiment done 3 times, where “*” indicates a statistically significant difference between the control and the treatment, P<0.01. FIG. 1B shows post-transfection knockdown of each protein transcript; FIG. 1C shows transcript level of CTGF, AuroraKB and CDC2 following SAV1 KD, NF2 KD or MOB1 KD.

    [0013] FIGS. 2A, 2B show the knockdown in H9C2 differentiated rat heart myocytes, 72 h post transfection, where transfection was with equal proportions of the DsiRNA pairs in SEQ ID NO: 33; SEQ ID NO: 34 with SEQ ID NO: 35; SEQ ID NO: 36 (for MOB-1 KD). Data is a representation of three independent experiments. Error bars represent the standard error of the mean. “**” indicates a statistically significant difference between the treatment and the control (P<0.01). Scale bar represents 100 microns where knockdown of MOB1 is measured by an Edu reaction and assay. FIG. 2A shows MOB1 knockdown post-transfection, as determined by Edu incorporation. In FIG. 2B it shows the effect on the myocytes of MOB 1 knockdown as measured by EdU immunofluorescence at 48 h post MOB 1 DsiRNA transfection.

    [0014] FIGS. 3A, 3B show the effect of knockdown by the DsiRNAs and proportions as in FIGS. 1A, 1B & 1C, i.e., to knockdown SAV1, MOB1 and NF2, as well as on NC-1, on rat primary neonatal cardiomyocyte confluence. FIG. 3A shows cell confluence at the time of the transfection (0 h) or 48 h after transfection (48h) with an applied confluence mask. Scale represents 200 microns. FIG. 3B shows the percentage of the confluency of the cells over time, and that there is an increase in MOB1 KD cell confluency. Data is the mean of 2 independent experiments. Error bars represent the standard error.

    [0015] FIGS. 4A, 4B & 4C show the effect of DsiRNAs for the inhibitory proteins, the control NC-1, and a combination with YAP1, DsiRNA knockdnown, on rat neonatal cardiomyocyte proliferation 72 h post transfection. FIGS. 4A & 4B show EdU proliferation imaging results, where the scale bars in FIG. 4B represent 100 microns, imaging analysis representing the mean of 4 independent experiments, and″*” indicates a significant difference between the indicated treatment (“*” indicates P<0.05; “**” indicates P<0.01; “***” indicates P<0.001). Error bars represent the SEM;

    [0016] FIG. 4B are Western blots showing a decrease of both NF2 and SAV1 levels in double-knockdown (NF2 and SAV1) DsiRNA treated cells. FIG. 4C shows the effects of DsiRNA knockdnown, and combinations of DsiRNA knockdnowns, of other proteins, on determined by an EdU proliferation assay.

    [0017] FIGS. 5A, 5B show live cell imaging of rat neonatal cardiomyocytes transfected with the cell cycle ESFUCCI system combined with equal proportions of MOB1 KD DsiRNAs (SEQ ID NO: 33; SEQ ID NO: 34 with SEQ ID NO: 35; SEQ ID NO: 36) or control (NC-1 KD) over 48 h. MOB 1 KD increases the number of cells reentering the cell cycle as detected by the number of red nuclei (objects). Select images of the three treatments 48 h post transfection show cells in G1/S phase (as plotted in FIG. 5B) and their detection by the live cell imaging system (Incucyte). Yellow arrows indicate cells in G1/S phase. Scale bars represent 300 microns.

    [0018] FIGS. 6A, 6B & 6C show the results of a differential gene expression analysis, following treating Rat neonatal cardiomyocytes with 10 pmols of equal proportions of the DsiRNA pairs for MOB1: SEQ ID NO: 33; SEQ ID NO: 34 and SEQ ID NO: 35; SEQ ID NO: 36, 48 h post DsiRNA transfection. The results are a representation of relevant pathways for cell proliferation and cardiac dedifferentiation. Normalized enrichment score (NES) is represented. FIG. 6A, left side, shows top 15 downregulated pathways and the right side shows the top 15 upregulated pathways. FIG. 6B shows cell cycle pathways upregulated after MOB 1 knockdown and heatmap representation of relevant genes. FIG. 6C shows the heatmap of relevant gene expression related to muscle and heart differentiation and contraction and downregulated pathways.

    [0019] FIGS. 7A, 7C, 7D, 7F, 7G to 7I show relative gene expression profiles for transcripts encoding SAV1, NF2, and MOB1,and FIGS. 7B, 7E, and 7H show Edu assay results for SAV1, NF2, and MOB1,where NIH3t3 mouse fibroblast cells were transfected with equal proportions of the following SAV1 KD, NF2 KD, and MOB1 KD DsiRNAs pairs, i.e., for SAV1 KD: SEQ ID NO: 5; SEQ ID NO: 6 (dsiRNA#1) with SEQ ID NO: 7; SEQ ID NO: 8 (dsiRNA#2) with SEQ ID NO: 9; SEQ ID NO: 10 (dsiRNA#3)); for NF2 KD: SEQ ID NO: 21; SEQ ID NO: 22 (dsiRNA#1) with SEQ ID NO: 23; SEQ ID NO: 24 (dsiRNA#2) with SEQ ID NO: 25; SEQ ID NO: 26 (dsiRNA#3); and for MOB-1 KD: SEQ ID NO: 37; SEQ ID NO: 38 (dsiRNA#1) with SEQ ID NO: 39; SEQ ID NO: 40 (dsiRNA#2) and SEQ ID NO: 41; with SEQ ID NO: 42 (dsiRNA#2), where gene silencing was verified with RT-PCR. NC-1 dsiRNA is a non-targeting siRNA. All three tested gene DsiRNAs were effective in reducing SAV1, NF2 and MOB1 transcript levels. FIG. 7A shows transcript level of SAV1 72 h post transfection; FIG. 7B shows EdU incorporation level in a flow cytometry assay 72 h post SAV1 transfection; FIG. 7C shows CTGF transcript level 72 h post SAV1 KD; FIG. 7D shows transcript levels of NF2 72 h post transfection; FIG. 7E shows EdU incorporation level on a flow cytometry assay 72 h post NF2 transfection; FIG. 7D shows CTGF transcript level 72 h post NF2 K; FIG. 7G shows) transcript level of MOB 1 72 h post transfection; FIG. 7H shows EdU incorporation level in a flow cytometry assay 72 h post MOB1 DsiRNAs transfection; and FIG. 7I shows CTGF transcript level 72 h post MOB1 KD.

    [0020] FIGS. 8A, 8B show the results of a luciferase assay on NIH3t3 cells (a fibroblast cell line that was isolated from a mouse NIH/Swiss embryo), 24 h post NF2 DsiRNA transfection (FIG. 8A) and 24 h post SAV1 DsiRNA transfection (FIG. 8B), where the NC-1 gene expression is a control.

    [0021] FIGS. 9A, 9B show the results of a assay demonstrating the effect of overexpression of MOB Binding Domain (MBD) peptide on NIH3t3 fibroblasts, 96 h post plating. FIG. 9A is a flow cytometry EdU assay demonstrating that MBD overexpression induces cell proliferation 96 h post treatment. FIG. 9B shows relative gene expression in the NIH3t3 fibroblasts. “***” indicates P<0.001.

    [0022] FIG. 10 shows immunofluorescence imaging representations of mitosis by immunostaining with a mitosis marker (phospho-Histone H3 phH3 positive), in control and MOB1 KD rat neonatal cardiomyocytes. Arrows are pointing at cells (Troponin Tnni3 positive) undergoing mitosis. Scale bars represent 50 microns.

    [0023] FIG. 11 illustrates manipulating the Hippo pathway to induce cardiac cell proliferation.

    [0024] FIGS. 12A to 12F illustate that SRF mutations block Nkx2-5 and Gata4 interaction with the MADS box inhibit DNA binding to the cardiac actin promoter and reporter activity. FIG. 12A is a schematic diagram of the SRF regulatory domains including the MADS box. Cofactors Nkx2-5, Gata4/6, Crp2, and inhibitor Hop1 bind to the N-terminal extension. ETS factors Elkland SAP1 bind to the beta loop and compete with MRTF-A. Tead factors bind to the 2.sup.nd alpha helix. Yap may indirectly bind to SRF through MRTF-A and Tead interaction sites. FIG. 12B is a schematic diagram showing how phosphorylated ETS factors facilitate phosphorylated SRF binding to the C-FOS promoter to drive cardiomyocyte replication, while Nkx2-5 and Gata4 facilitate SRF binding to myogenic specified genes to drive cardiomyocyte differentiation. It shows the mutual inhibitory activity shared between myocyte replication and myocyte differentiation. FIG. 12C shows extracts of SRF null murine ES cells rescued by lentiviral expressed SRF triplet alanine scanning mutants, spanning the N-terminal extension to the start of alpha helix 1, were used in EMSA DNA binding assays to the [P32] labeled alpha-cardiac promoter in the presence of lentiviral expressed Gata4. FIG. 12D shows that extracts of SRF null murine ES cells rescued by lentiviral expressed SRF triplet alanine scanning mutants, spanning the N-terminal extension to the start of alpha helix 1, were used in EMSA DNA binding assays to the [P32] labeled alpha-cardiac promoter the presence of virally expressed Nkx2-5 in SRF null murine ES cells. FIG. 12E shows results of a luciferase reporter assay of viral transfected alpha cardiac actin promoter luciferase reporter with SRF mutants and virally co-expressed Gata4. FIG. 12F shows results of a luciferase reporter assay of viral transfected alpha cardiac actin promoter luciferase reporter with SRF mutants and virally co-iexpressed Nkx2-5.

    [0025] FIGS. 13A to 13E show that Stemin (153(A3)) facilitates myocyte replication, but not myocyte differentiation in rescued SRF null murine ES cells. FIG. 13A is a heat map of gene expression following lentiviral transfection of SRFwt and SRF153(A3) mutant rescue of null SRF murine ES cells. Note the increased expression of stem cell marker genes and cyclins, which, however, does not support the expression of many cardiac specified genes and assembly genes needed for sarcomerogenesis. FIG. 13B shows that MADS box DNA contact sites were shown by X-ray crystal analysis. FIG. 13C shows that EMSA of expressed Nkx2-5 and or Gata4 in the context of the alpha cardiac actin promoter failed to stabilize the single alanine point mutant, Lys154Ala, as a critical base contact. FIG. 13D shows that EMSA of expressed ETS factor, Elk1, in the context of a FOS promoter, stabilized SRF (SRF154A) DNA binding revealed by the appearance of a ternary complex factors (tcf). FIG. 13E shows a schematic model of where Stemin (153(A3)) supports cardiac myocyte replication, because Elk1 stabilized Stemin binding to C-FOS promoter due to an adjacent ETS Binding Sequence (EBS) but blocks cardiac differentiation because Nkx2-5 and Gata4 cofactors failed to facilitate SRF DNA binding to the cardiac sarcomeric actin gene.

    TABLE OF SEQUENCES

    [0026] An explanation of SEQ ID NOS: 1 to 58 is in the Summary section above, where the sequences in SEQ ID NOS: 49 to 58 are shown. SEQ ID NOS: 1 to 48 are as follows.

    TABLE-US-00008 SEQ ID NO: 1 ggcaacuuacuauuuggaauuacaa

    TABLE-US-00009 SEQ ID NO: 2 uuccguugaaugauaaaccuuaauguu

    TABLE-US-00010 SEQ ID NO: 3 auauuaugaauacaaccaugauctc

    TABLE-US-00011 SEQ ID NO: 4 ucuauaauacuuauguugguacuagag

    TABLE-US-00012 SEQ ID NO: 5 ggaaucucaugccuucauucauucg

    TABLE-US-00013 SEQ ID NO: 6 cgccuuagaguacggaaguaaguaagc

    TABLE-US-00014 SEQ ID NO: 7 cgaggugucuaagccggccgaggtg

    TABLE-US-00015 SEQ ID NO: 8 uugcuccacagauucggccggcuccac

    TABLE-US-00016 SEQ ID NO: 9 cgucguugagccggcugacuucccg

    TABLE-US-00017  SEQ ID NO: 10 ccgcagcaacucggccgacugaagggc

    TABLE-US-00018 SEQ ID NO: 11 GAUUUGGAACCUUAUUGUGAUAAAT

    TABLE-US-00019 SEQ ID NO: 12 UCCUAAACCUUGGAAUAACACUAUUUA

    TABLE-US-00020 SEQ ID NO: 13 ACUGAAAGAAAUCAGUCCCUUCUGG

    TABLE-US-00021 SEQ ID NO: 14 UUUGACUUUCUUUAGUCAGGGAAGACC

    TABLE-US-00022 SEQ ID NO: 15 CAAUUCCAAGACGAACUGAUAUCTG

    TABLE-US-00023  SEQ ID NO: 16 UUGUUAAGGUUCUGCUUGACUAUAGAC

    TABLE-US-00024  SEQ ID NO: 17 CAGUAAGGACCUGACUAGAAGCATG

    TABLE-US-00025 SEQ ID NO: 18 gugucauuccuggacugaucuucguac

    TABLE-US-00026 SEQ ID NO: 19 ccuugguacugaaacaguaagucac

    TABLE-US-00027 SEQ ID NO: 20 auggaaccaugacuuuguacauucagug

    TABLE-US-00028 SEQ ID NO: 21 gcuagaaagcagauggaaaggcagc

    TABLE-US-00029 SEQ ID NO: 22 uccgaucuuucgucuaccuuuccgucg

    TABLE-US-00030 SEQ ID NO: 23 ggaggagcuaguucaagagaucacg

    TABLE-US-00031 SEQ ID NO: 24 cuccuccucgaucaaguucucuagugc

    TABLE-US-00032 SEQ ID NO: 25 ggcugaucaguuaaagcaagacutg

    TABLE-US-00033 SEQ ID NO: 26 cuccgacuagucaauuucguucugaac

    TABLE-US-00034 SEQ ID NO: 27 AUGAGCUUCAGCUCUCUCAAGAGGA

    TABLE-US-00035 SEQ ID NO: 28 CGUACUCGAAGUCGAGAGAGUUCUUCUCCU

    TABLE-US-00036 SEQ ID NO: 29 GACAUACCAAGCUUCAACCUCAUTG

    TABLE-US-00037 SEQ ID NO: 30 GACUGUAUGGUUCGAAGUUGGAGUAAC

    TABLE-US-00038 SEQ ID NO: 31 GAAUUACUGCUUGGUACGCAGAGCA

    TABLE-US-00039 SEQ ID NO: 32 CUCUUAAUGACGAACCAUGCGUCUCGU

    TABLE-US-00040 SEQ ID NO: 33 cuucaggaacuaauugagaagcutg

    TABLE-US-00041 SEQ ID NO: 34 gugaaguccuugauuaacucuucgaac

    TABLE-US-00042 SEQ ID NO: 35 acugaagcaacugcauugaaauuca

    TABLE-US-00043 SEQ ID NO: 36 aaugacuucguugacguaacuuuaagu

    TABLE-US-00044 SEQ ID NO: 37 ggaccucaaugaauggauugcuguu

    TABLE-US-00045 SEQ ID NO: 38 ccuggaguuacuuaccuaacgacaa

    TABLE-US-00046 SEQ ID NO: 39 ggaucuaaagacagauaaauguuuc

    TABLE-US-00047 SEQ ID NO: 40 ccuagauuucugucuauuuacaaag

    TABLE-US-00048 SEQ ID NO: 41 gguauggacuaaaugauaCuGACuA

    TABLE-US-00049 SEQ ID NO: 42 ccauaccugauuuacuauGacugau

    TABLE-US-00050 SEQ ID NO: 43 5′ GCAGGUCCGAGAUAUGAAUAUCACT 3′

    TABLE-US-00051 SEQ ID NO: 44 3′ GACGUCCAGGCUCUAUACUUAUAGUGA 5′

    TABLE-US-00052 SEQ ID NO: 45 5′ GUGAUAGUUUCCGAGUAAGACCUTA 3′

    TABLE-US-00053 SEQ ID NO: 46 3′ CACACUAUCAAAGGCUCAUUCUGGAAU 5′

    TABLE-US-00054 SEQ ID NO: 47 5′ CAAAGACUAUUCUAAAGCGUCUGTT 3′

    TABLE-US-00055 SEQ ID NO: 48 5′ CCGUUUCUGAUAAGAUUUCGCAGACAA 3′

    [0027] The following sequences show the primers used in determining protein levels in the experiments shown in some of the figures.

    [0028] SEQ ID NOS: 59; 60 are respectively the forward and reverse primers used to monitor mouse SAV1 gene expression.

    TABLE-US-00056 SEQ ID NO: 59 CTGTCCCGCAAGAAAACCAAA

    TABLE-US-00057 SEQ ID NO: 60 AATGAAGGCATGAGATTCCGC

    [0029] SEQ ID NOS. 61; 62 are respectively the forward and reverse primers used to monitor mouse NF2 gene expression.

    TABLE-US-00058 SEQ ID NO: 61 GCCATCGCTTCTCGCATGA

    TABLE-US-00059 SEQ ID NO: 62 CGCAGTTGAACTCCATCTCGG

    [0030] SEQ ID NOS. 63; 64 are respectively the forward and reverse primers used to monitor mouse MOB 1 gene expression.

    TABLE-US-00060 SEQ ID NO: 63 GGCAGGTCCCAGGTATGAATA

    TABLE-US-00061 SEQ ID NO: 64 TCAAGCTGATCCTGAACCCAA

    [0031] SEQ ID NOS. 65; 66 are respectively the forward and reverse primers used to monitor mouse CTGF gene expression (FIGS. 7C; 7F; 7I)

    TABLE-US-00062 SEQ ID NO: 65 CAAGGACCGCACAGCAGTT

    TABLE-US-00063 SEQ ID NO: 66 AGAACAGGCGCTCCACTCTG

    [0032] SEQ ID NOS. 67; 68 are respectively the forward and reverse primers used to monitor mouse GAPDH gene expression (FIG. 4B).

    TABLE-US-00064 SEQ ID NO: 67 AGGTCGGTGTGAACGGATTTG

    TABLE-US-00065 SEQ ID NO: 68 TGTAGACCATGTAGTTGAGGTCA

    [0033] SEQ ID NOS. 69; 70 are respectively the forward and reverse primers used to monitor rat Aurkb.

    TABLE-US-00066 SEQ ID NO: 69 ATGAGCAGCGGACTGCCACG

    TABLE-US-00067 SEQ ID NO: 70 GTCCAGGGTGCCGCACATGG

    [0034] SEQ ID NOS. 71; 72 are respectively the forward and reverse primers used to monitor rat Ccna2 (FIG. 6B).

    TABLE-US-00068 SEQ ID NO: 71 CCCGGAGCCAGAAAACCACTGGT

    TABLE-US-00069 SEQ ID NO: 72 GTCCACAAGGATGGCCCGCAT

    [0035] SEQ ID NOS. 73; 74 are respectively the forward and reverse primers used to monitor rat Cdc20.

    TABLE-US-00070 SEQ ID NO: 73 GGCTGGGTTCCCCTGCAGACAT

    TABLE-US-00071 SEQ ID NO: 74 TGGGCAAAGCCATGGCCTGAGA

    [0036] SEQ ID NOS. 75; 76 are respectively the forward and reverse primers used to monitor rat Cdc2.

    TABLE-US-00072 SEQ ID NO: 75 TTTCGGCCTTGCCAGAGCGTT

    TABLE-US-00073 SEQ ID NO: 76 GTGGAGTAGCGAGCCGAGCC

    [0037] The primers for the following genes were purchased from IDT Technology (Newark, NJ) [0038] GAPDH (sequence name: Rn.PT.39a.11180736.g); [0039] NF2 (sequence name: Rn.PT.58.35891527); [0040] YAP1 (sequence name: Rn.PT.58.10413179); [0041] SAV1 (sequence name: Rn.PT.58.37256237); [0042] CTGF (sequence name: Rn.PT.58.37685462.g).

    DETAILED DESCRIPTION

    [0043] It is to be understood that both the foregoing general description and the following detailed description are illustrative and explanatory, and are not restrictive of the subject matter, as claimed. In this application, the use of the singular includes the plural, the word “a” or “an” means “at least one”, and the use of “or” means “and/or”, unless specifically stated otherwise. Furthermore, the use of the term “including”, as well as other forms, such as “includes” and “included”, is not limiting. Also, terms such as “element” or “component” encompass both elements or components comprising one unit and elements or components that include more than one unit unless specifically stated otherwise.

    [0044] The section headings used herein are for organizational purposes and are not to be construed as limiting the subject matter described. All documents, or portions of documents, cited in this application, including, but not limited to, patents, patent applications, articles, books, and treatises, are hereby expressly incorporated herein by reference in their entirety for any purpose. In the event that one or more of the incorporated literature and similar materials defines a term in a manner that contradicts the definition of that term in this application, this application controls.

    Dosage and Administration

    [0045] The dosage and administration regimen can be determined for humans and larger mammals by extrapolating, based on mammalian mass, the dosage and regimen required to cause cardiac cell proliferation in mice and/or rats. Various administration routes can be used to administer one or more inhibitors and mutant SRFs to subject mammals, including oral administration, inhalation, subcutaneous administration, intravenous administration, intraperitoneal administration, intramuscular administration, intrathecal injection, intra-articular administration, topical administration, central administration, peripheral administration, aerosol-based administration, nasal administration, transmucosal administration, transdermal administration, parenteral administration, and combinations thereof.

    Induction of Cell Proliferation in Vitro

    [0046] The compositions of the can be used to proliferate various types of cardiac cells in vitro, e.g., in a container such as a petri dish. In some embodiments, the cardiac cells are held in a scaffold, such as in a scaffold for a heart or cardiac tissue.

    Additional Embodiments

    [0047] Reference will now be made to more specific embodiments of the present disclosure and experimental results that provide support for such embodiments. However, Applicant notes that the disclosure below is for illustrative purposes only and is not intended to limit the scope of the claimed subject matter in any way.

    [0048] The experiments described below and shown in the figures support the use of the DSiRNAs described herein for cardiac cell replication.

    Materials and Methods

    Cell Culture

    [0049] H9C2 rat cardiomyocyte cell line was purchased from the ATCC. For proliferation, cells were maintained in DMEM/high glucose with 2 mM Glutamax, 1 mM sodium Pyruvate, and 100 U/ml penicillin-streptomycin (ThermoFisher Scientific) supplemented with 10% Fetal Bovine Serum (Gendepot). Only cells at low passage number were used and cells were passaged before reaching 70% confluency. For differentiation, media supplemented with 1% Fetal Bovine Serum was changed every other day and 1 .Math.M retinoic acid (Sigma-Aldrich) was added every day for a week.

    [0050] NIH3t3s cells were purchased from the ATCC. Cells were maintained in DMEM/high glucose with 2 mM Glutamax, 1 mM sodium Pyruvate, and 100 U/ml penicillin-streptomycin (ThermoFisher Scientific) supplemented with 10% fetal bovine serum (Gendepot). Cells were passaged at 70% confluency. All cell types were passaged using 0.25% trypsin (ThermoFisher Scientific) before reaching confluency.

    [0051] Rat neonatal cardiomyocytes were purchased from Cell Applications and maintained in the basal media supplemented with growth supplements provided by the same manufacturer according to their recommended guidelines.

    DsiRNA Transfection

    [0052] DsiRNA (Dicer Substrate siRNAs) RNA duplexes were purchased from IDT Technology. When H9C2 cells were used, they were plated and allowed to differentiate for 1 week. On the day of transfection, medium was changed, and cells were transfected with Lipofectamine RNAiMax following the manufacturer’s guidelines (ThermoFisher Scientific). Twenty-five pmoles of DsiRNA for a 6-well format, 10 pmol for a 12-well format or 5 pmol on a 24-well format was used for all experiments. Control transfection was performed using non-targeting DsiRNA (NC-1) and transfection efficiency was checked using DsiRNA conjugated with a fluorophore Tye593 (IDT). Cells were harvested or treated as indicated for 24, 48, or 72 h post transfection. For H9C2 cells and rat neo-natal cardiomyocytes, an equal mix of respective DsiRNAs complementary pairs, as below, were used for all experiments. [0053] Rat MOB1a: SEQ ID NOS: 33 & 34; 35 & 36; [0054] Rat NF2: SEQ ID NOS: 17 & 18; 19 & 20; [0055] Rat SAVI: SEQ ID NOS: 1 & 2; 3 & 4; [0056] NC-1 (Negive Control DsiRNA).

    [0057] QPCR experiments were performed in a 12-well format and samples were harvested at the indicated times. RNA was isolated using RNAeasy kit (Qiagen) following the manufacturers’ guidelines. RNA concentration was determined using a Nanodrop (ThermoFisher Scientific), and then cDNA was synthesized using one microgram of total RNA and the qscript cDNA superMix reagent following the manufacturer’s guidelines (Quanta Biosciences). Next, cDNA samples were diluted in water and QPCR was performed using the Power SYBER Green PCR MasterMix reagent and an Applied Biosystems 7900HT real time PCR system. All PCR primer sequences are provided in the supplemental methods.

    [0058] The relative gene expression was estimated using the comparative Ct method. The relative Ct value of an mRNA transcript was calculated first by subtracting the Ct value of the housekeeping gene GAPDH from the mRNA Ct value of the gene of interest. The relative Ct values were normalized to non-transfected cells to determine the fold-change in gene expression. Statistical significance was determined by performing unpaired t-tests between untreated and treated samples.

    Western Blot

    [0059] Western Blot samples were collected from a 6-well format. Samples were harvested 72 h after transfection. Cells were rinsed with PBS and scraped in RIPA buffer (Genedepot) with antiprotease and anti-phosphatase cocktail (ThermoFisher Scientific). Protein concentration was determined using a BCA protein assay (ThermoFisher Scientific) according to the manufacturer’s guidelines. The same protein amount for each sample was loaded on a Nupage 10% bis-tris electrophoresis gel and transferred to a PVDF membrane. Membrane was washed with TBS buffer with 0.1% Tween 20 (TBST) then blocked in 5% bovine serum albumin for 1 h. at room temperature. Primary antibodies (Anti-MOB1 (1:1000) (Cell Signaling 13730S); Anti-SAV1 (1:1000) (Cell Signaling 3507) and anti-NF2 (1:1000) (Abcam Ab88957) were added and incubated overnight at 4° C. Membranes were then washed with TBST and secondary HRP antibody was added (anti-rabbit Cell Signaling #7074; anti-mouse Cell Signaling #7076) at 1:10000 for 1 h. at room temperature. After washing with TBST, the membrane was developed using Pierce ECL western blotting substrate (ThermoFisher Scientific). Membranes were stripped using western blot restore PLUS western blot stripping buffer (ThermoFisher Scientific). Membranes were then incubated with rabbit anti-GAPDH conjugated with HRP (Santa Cruz Biotechnology) overnight in 5% milk followed by washing and detection with the same western blotting substrate.

    EdU Flow Cytometry

    [0060] Cells were plated in 6-well format and transfected as previously described. Cells were lifted using trypsin and the trypsin action was stopped by the addition of medium with serum. The samples were centrifuged, washed with PBS with 1% BSA to prevent cells from clumping. Cells were then fixed and permeabilized with ice-cold 100% methanol while being gently vortexed then incubated on ice for 30 min. Excess PBS was then added, and samples were centrifuged and washed with PBS twice. Edu reaction was performed according to the manufacturer’s instructions using the Click-it EdU Alexa Fluor flow cytometry assay kit (ThermoFisher Scientific).

    [0061] After Edu reaction, cells were washed in PBS, then DNase-free RNAse A (Thermo Scientific) was added at a final concentration of 0.2 mg/ml, then propidium iodide (Invitrogen) was added at a concentration of 3 .Math.M. Samples were analyzed using a BD LSR II flow cytometer (BD Biosciences).

    EdU and Immunostaining Assay

    [0062] Cells were plated on 0.1% gelatin coated coverslips in 24-well format. Cells were transfected like described previously. Medium was changed after 24 h and 10 .Math.M of Edu was added. 48 h after transfection, 10 .Math.M Edu were added and 6 h later cells were fixed. Cells were washed in PBS then fixed in 4% Paraformaldehyde in PBS for 10 min. Edu reaction was performed according the manufacturer’s instructions using the Click-it EdU Alexa Fluor® Imaging Kit (ThermoFisher Scientific). Additional staining for cardiac markers was performed with the primary antibodies (Anti-heavy chain cardiac myosin antibody [BA-G5] (Abcam: ab50967); anti cardiac-Troponin T [1C11] (Abcam ab8295) 1:200 ) diluted in 1% bovine serum albumin overnight at 4° C. Cells were washed with PBS, then incubated with secondary Fluorescent Antibodies Alexa goat anti-rabbit or anti-mouse (ThermoFisher Scientific) for 1 h at room temperature in dark conditions (1:250). Finally, the coverslips were washed with PBS with Hoechst 33342 and mounted with slow-fade mounting medium (ThermoFisher Scientific). Images were captured with Nikon Eclipse Ti microscope.

    Mitosis Detection on Rat Neonatal Cardiomyocytes

    [0063] Cells were fixed using 4% formaldehyde in PBS for 10 min, then washed with PBS. Fixed cells were permeabilized with 0.25% tritonX-100 in PBS for 15 min, then washed with PBS. Samples were incubated with image-it FX signal Enhancer for 30 min before washing with PBS. Samples were blocked with 5% BSA in PBS for 1 h at room temperature. Mitosis was detected using the Rabbit phospho-histone 3 H3 (Ser10) Antibody mitosis marker (Sigma-Aldrich 06-570) (1:200). Cardiac marker troponin Tnni3 was detected using the mouse anti-troponin T (ab8295 Abcam) (1:250). Both primary antibodies were diluted in 1% BSA in PBS and samples were incubated overnight at 4° C. After washes, secondary antibodies (Alexa Fluor goat anti-rabbit 488, Alexa Fluor goat anti-mouse 647 (ThermoFisher Scientific) both at 1:250 in PBS + 1%BSA) were added for 1 h at room temperature under dark conditions. Samples were then washed and incubated with Hoechst 33342 to stain the nucleus. Nikon Ti eclipse epi-fluorescence microscope was used for capturing the images.

    Live Cell Imaging

    [0064] H9C2 Cells were plated in a 24-well plate and differentiated for 10 days. Cells were transfected with DsiRNAs. The samples were incubated in the Incucyte S3 Live-Cell Analysis System using the 20X objective. The instrument was set to take a picture every hour of each well at 16 different locations for a period of 48 h. Cell confluence was measured and plotted using the Incucyte Zoom (Sartorius) software.

    [0065] Rat primary neonatal cardiomyocytes were purchased in a 12 well plate from Cell Applications. Cells were co-transfected with 400 ng of ES FUCCI which was a gift from Pierre Neveu (Addgene plasmid # 62451) (10) and DsiRNAs like described above, using Jetprime transfection reagent according to the manufacturer’s guidelines. Cells were then incubated in the Incucyte S3 Live-Cell Analysis System (Sartorius) under regular cell culture conditions. The instrument was set to take a picture every hour of each well at 16 different locations using a 10x objective for 48 h. Image analysis was performed using the Incucyte software analysis tool.

    RNA-Sequencing Assay

    [0066] Rat neonatal cardiomyocytes plated on a 12-well plate were treated with 10 pmols of DsiRNAs using Lipofectamine RNAimax. Forty-eight h post transfection, cell lysates were harvested. RNA was extracted using RNeasy Mini Kit (Qiagen) with on-column RNase-Free DNase (Qiagen) digestion following manufacturer’s instructions. Extracted RNA samples underwent quality control assessment using the RNA tape on Tapestation 4200 (Agilent) and were quantified with Qubit fluorometer (Thermo Fisher). The RNA libraries were prepared and sequenced at the University of Houston Seq-N-Edit Core per standard protocols. RNA libraries were prepared with QIAseq Stranded Total RNA library Kit (Qiagen) using 100 ng input RNA. Ribosomal RNA was depleted with QIAseq FastSelect HMR kit (Qiagen). RNA was fragmented, reversetranscribed into cDNA, and ligated with Illumina sequencing adaptors at the 5′ and 3′ ends. The size selection for libraries was performed using SPRIselect beads (Beckman Coulter) and purity of the libraries was analyzed using the high sensitivity DNA 1000 tape on the Tapestation 4200 (Agilent) with a size of 300 bps. The prepared libraries were pooled and sequenced using NextSeq 500 (Illumina); generating ~15 million 2x76 bp paired-end reads per samples.

    [0067] For data analysis, trimGalore! was used to control the quality of the data, followed by alignment to the rat genome (Rn6 from ENSEMBL) using the STAR aligner. The limma/voom R-package was used to perform the differential gene analysis. Batch correction was performed using the SVA R-package followed by differential gene analysis using the limma/voom R-package. Pathway analysis was performed against a collection of rat-specific GO/KEGG pathways from the Ge lab using GSEA v3.0.

    Luciferase Assay

    [0068] NIH3t3 cells were plated at the indicated cell density on white opaque 96-well culture plates and transfected the same day with the YAP-TEAD-driven 8xGTIIC- firefly luciferase (Addgene plasmid #34615) (35). The pRL SV40 renilla luciferase (Promega) was also co-transfected for data normalization. Effectene (Qiagen) or lipofectamine 3000 were used to transfect 50 ng of each reporter according to the manufacturers’ guidelines.

    [0069] One pmole of siRNAs per well was transfected 24 h later using Lipofectamine RNAiMax, following the manufacturer’s guidelines (ThermoFisher Scientific). Cells were incubated overnight before measuring the luciferase activity using the Dual-Glo luciferase assay system (Promega) with the infinite 200Pro Tecan plate reader. Statistical significance was determined by comparing the mean of the relative fluorescence unit (RFU) of treated samples to untreated control samples using an unpaired t test.

    Results of SAV1, NF2, and MOB1 DsiRNAs Knockdown Experiments

    [0070] Hippo Pathway knockdowns stimulate cell proliferation in mouse fibroblasts. NIH3t3 mouse fibroblast cells were transfected with 3 different SAV1 KD, NF2 KD, and MOB1 KD DsiRNAs and the gene silencing was verified with RT-PCR. All tested DsiRNAs were effective in reducing SAV1, NF2 and MOB1 transcript levels (FIGS. 7A to 7I). Their efficiency was then tested in inducing cell proliferation and driving YAP-TEAD target genes. Different SAV1 DsiRNAs had a variable and relatively low efficiency of stimulating cellular proliferation as tested by a flow cytometry EdU incorporation assay (c & 7H) which indicates de novo DNA synthesis. Cells were transfected with a dual-luciferase reporter system where the firefly luciferase expression level is controlled by a YAP-TEAD synthetic promoter and a control promoter drives renilla luciferase expression for data normalization. SAV1-knockdown cells showed an increase in luciferase activity (FIGS. 8A, 8B).

    [0071] Similar experiments were run to test NF2 DsiRNAs and their effect on YAP activity and proliferation on NIH3t3 cells. NF2 transcript levels decreased with all NF2 DsiRNAs tested (FIG. 7D) and overall, they were more effective than SAV1 DsiRNAs in stimulating cellular proliferation (FIG. 7E). The CTGF level also increased, and DsiRNA was particularly efficient (FIG. 7F). Finally, the cells were tested with a YAP-TEAD reporter luciferase assay, and cells with NF2 knockdown exhibited an increase in YAP activity (FIGS. 8A, 8B). These findings support the idea of stimulating cellular proliferation of mouse fibroblasts with SAV1 and NF2 knockdowns. Similarly, MOB1 knockdown with the screened DsiRNA was effective and promoted cellular proliferation (FIG. 7H). However, CTGF levels following MOB 1 KD did not significantly increase (FIG. 7I). This preliminary data supports that SAV1 KD, NF2 KD and MOB1 KD DsiRNAs can efficiently silence the target genes and can enhance cell proliferation in mouse fibroblasts.

    [0072] It was also investigated whether inhibiting the interaction between MOB 1 and MST kinase could be beneficial for cell proliferation. MOB 1 acts as a kinase activator for both LATS and MST. It was hypothesized that blocking the interaction between MOB 1 and MST kinase can inhibit the Hippo pathway by inactivating its core kinases. The interaction of several MST-derived peptides of different lengths with MOB 1 has been described. A peptide derived from MST2 kinase was overexpressed: the MOB1 binding domain (MBD) in NIH3T3 cells and confirmed the overexpression of the MBD peptide with RT-PCR (FIG. 9B). Consistent with MOB1 knock-down results (FIG. 7H), cells transduced with a lentivirus expressing MBD peptide also induced novel DNA synthesis measured by EdU incorporation in mouse NIH3t3 cell line (FIG. 9A). The data proves the possibility of inducing an active cellular replication by specifically targeting MOB1-MST1/2 kinase interaction using a peptide.

    Knockdowns of Hippo Pathway Regulators in Rat Cardiac-Like Cells H9C2

    [0073] After confirming that DsiRNAs can promote cell proliferation of mouse fibroblasts, the study moved into cells with more cardiac-like properties, the H9C2 rat myoblast cell line. H9C2 cells were differentiated for a week and cultured in low serum medium supplemented with retinoic acid. Cells were transfected with NF2, MOB1 and SAV1 rat DsiRNAs. Reduced proteins levels due to gene silencing were checked with western blot. All three protein levels decreased as compared to the control (FIG. 1A). The transcript levels of each of the three proteins decreased as demonstrated by q-PCR (FIG. 1B) and the level of YAP target gene CTGF increased as a result of such gene silencing (FIG. 1C). Although MOB1 KD did not efficiently increase the CTGF level, it was more potent than NF2 and SAV1 in increasing the transcript levels of cell cycle genes Aurora kinase B and CDC2 (FIG. 1C). This indicates that MOB1 silencing has the potential to be more efficient than silencing of SAV1 and NF2 in inducing heart cell regeneration. This data supports that using DsiRNAs of Hippo regulators NF2, SAV1 and MOB 1 can successfully reduce their transcript and protein levels and lead to the reactivation of the cell cycle.

    [0074] Knocking down MOB 1 was then tested in differentiated H9C2 for proliferation using an EdU incorporation assays. In both flow cytometry and immunostaining assays, MOB1 knockdown significantly induced de novo DNA synthesis, which indicates cell proliferation (FIGS. 2A, 2B). The efficiency of NF2, SAV1 and MOB1 knockdown as compared with inducing cell H9C2 proliferation over 48 h using live cell imaging. Cell confluency increased over time more importantly in MOB1 KD cells than in the control, NF2 KD or SAV1 KD cells (FIG. 3). This data also suggests that MOB1 silencing may be more potent that NF2 and SAV1 in inducing cell proliferation.

    Knockdowns of Hippo Pathway Regulators in Rat Neonatal Cardiomyocytes

    [0075] Rat neonatal cardiomyocytes were treated with DsiRNAs for 72 h and pulsed twice with EdU to capture de novo DNA synthesis, which indicates cell proliferation. Both NF2 and SAV1 single knockdowns significantly increased cardiac cells proliferation (FIGS. 4A, 4B). This effect disappears when YAP is silenced. This demonstrates that the observed cardiomyocyte proliferation effect is driven in a YAP-dependent way (Hippo signaling inactivation). Interestingly, neonatal cardiomyocyte proliferation was significantly more pronounced when combining SAV1 and NF2 gene silencing compared to silencing each gene individually.

    [0076] Next, the effect of MOB 1 knockdown was investigated on rat neonatal cardiomyocytes using live cell imaging. To follow the cell cycle status of the cells, the cells were co-transfected with DsiRNA and a plasmid DNA containing a cell sensor system (ES-FUCCI) (Addgene plasmid # 62451). The FUCCI (Fluorescence Ubiquitination-based cell cycle indicator) system allows the visualization of the cell cycle using a fusion of fluorescent proteins conjugated with a portion of Geminin and Cdt1. Ubiquitination of Geminin and Cdt1 by E3 ligases leads to their degradation by the proteasome. E3 ligases activity is modulated by the cell cycle phase. In short, the system makes the nucleus appear red fluorescent during G1 and beginning of S phase (Geminin degraded), and green fluorescent during S, G2 and M phases (Cdt1 degraded). Silencing MOB1 with this system was tested. In a span of 48 h there was an increase of G1/S phase in MOB1 KD cells as compared to the control (FIGS. 5A, 5B). A transition to G2/M phase (green fluorescence) in 48 h post transfection was not observed, and an extended time may be necessary. The effect observed by immunostaining was confirmed with a mitosis marker (phospho-Histone 3 (ser10)). FIG. 10. Using coding RNA sequencing, the effect of knocking down MOB1 on primary rat neonatal cardiomyocytes was investigated in comparison to NF2 KD and SAV1 KD on primary rat neonatal cardiomyocytes after 48 h of treatment. All three gene transcript levels decreased significantly. MOB 1 knockdown showed the clearest and highest levels of enrichments for pathways linked to cell division (FIG. 6A; FIG. 6B).

    [0077] NF2 and SAV1 knockdowns show enrichments mainly for protein synthesis and organelle developments, and less enrichment for cell cycle related genes. MOB1 silencing resulted in the increase of the level of genes covering DNA replication, chromosome segregation, and all cell cycle phases and transitions (FIG. 6B). These upregulated cell cycle genes include cdk1(13), cdc6(14) ccna2(15), ccne2(16) (FIG. 6B).

    [0078] Upon MOB1-knockdown treatments, a downregulation of the cardiomyocyte differentiation and contraction was observed (FIG. 6C). This process was described previously as part of the process for cardiac proliferation in different organisms, where terminally differentiated cells dedifferentiate first before undergoing cell division. Another observation is that, at least using DsiRNAs, MOB1 silencing makes cell division occur faster than NF2 and Sav1 Knockdowns. Other downregulated pathways in MOB 1 knockdowns include cell junction, cell migration and the cytoskeleton (FIG. 6A).

    Mutant SRF For Enhanced Cardiac Cell Proliferation

    [0079] SRF is a member of an ancient DNA binding protein family that shares a highly conserved DNA-binding/dimerization domain of 90 amino acids termed the MADS box shown schematically in FIG. 1A. MADS boxes have similar DNA binding specificities and dimerize to symmetrically contact the serum response element with a consensus sequence CC(A/T).sub.6GG, also known as the SRE and or CArG box. The appearance and diversification of nascent embryonic cardiac and smooth muscle cells require the combinatorial interactions of SRF with other transcription factors, enriched in the early progenitor cells. Also, a feature of a large number of cardiac and virtually all of the smooth muscle-expressed genes to date is their dependence upon CArG boxes. Mutations that prevent SRF binding severely impair the expression of c-fos, as well as muscle-restricted genes. An Ets factor, such as ELK1 contains an interactive B box and stabilizes SRF binding to DNA, especially in the presence of an adjacent ETS site.

    [0080] In addition, CArG boxes recruit SRF and cofactors, such as Nkx2-5, and Gata4, that strongly enhance SRF-DNA binding affinity; thus, permitting the formation of higher-order DNA binding complexes at relatively low SRF input. Similarly, CArG boxes recruit the cysteine-rich protein 2 LIM protein, which bridges SRF and GATA6 factors through interaction with the MADS N-terminal extension and myocardin, which competes with Ets factors that interact with the loop region of the MADS box shown in FIG. 1A. All of these myogenic cofactors greatly enhance SRF transactivation.

    [0081] Disruption of Nkx2-5 and Gata4 co-interactions with SRF blocks cardiac differentiation gene programs. The interaction with Nkx2-5 and Gata4 was disrupted by generating alanine scanning mutations across the SRF N-terminus up to the alpha I helix of the SRF’s MADS box. FIG. 1A shows a schematic diagram of the MADS box domain binding to DNA. Site-directed PCR mutagenesis was used to create amino acid substituted mutations at specified residues across the SRF core domain. Residues were changed to alanines (giving a neutral charge and removing potential interacting side chains), as shown in FIG. 1B. An SRF mutant was identified, named Stemin, that no longer recognizes CArG boxes, nor is influenced by Nkx2-5 and Gata4 interactions. Thus, Stemin functions as a new synthetic transfactor that blocks cardiac differentiation and sarcomerogenesis.

    [0082] Stemin is drawn to other DNA binding targets that activate cell proliferation. An excellent example is the ETS factors, as previously mentioned. Other mediators of SRF cell signaling are the myocardin related transcription factors (MRTF’s MADS boxes; also known as MAL or MKL which provide the link between RhoA-dependent cytoskeletal regulation and SRF-dependent gene expression. TEAD, a critical YAP cofactor also associates with MRTF-A overlapping the myocardin binding site on the SRF’s MADS box leading to rho kinase activation and cell replication. TEAD was shown to also directly binds to the MADS box independent of MRTF-A. Recently, manipulating the Hippo pathway has attracted interest, as a strategy for increasing cardiac regeneration. Cardiac-specific KO of Sav1, Lats1/2, and Nf2 genes in mature cardiomyocytes revealed enhanced cardiomyocyte proliferation, and reduced scar formation post-MI. Human YAP1 contains five phosphorylation HXRXXS motifs. Previously, YAP was mutated by replacing individual serine residues in the HXRXXS motifs with alanine, generating YAP5SA mutant (aka YAP1) that resides in the nucleus. See U.S. Pat. No. 11,179,479 B2 (incorporated by reference). Central to the Hippo pathway is a cascade of phosphorylation events in which phosphorylation of YAP1 prevents shuttling of YAP1 into the nucleus, promotes 14-3-3 binding, and protein degradation. When the Hippo pathway is inactivated, unphosphorylated YAP1 enters the nucleus and binds to multiple transcription factors (e.g., TEAD/TEF and MRTF-A). YAP1 binding to its partners TEAD and MRTF-A in the nucleus typically promotes gene expression programs that favor proliferation. Even though previous study showed YAP and SRF don’t interact directly, Stemin caused myocytes to dedifferentiate and then complemented mutant YAP to induce proliferation of myocytes.

    [0083] Since, Si RNA knockdowns of Sal1, NF (Merlin) and MOB1 allow YAP to enter myocyte nuclei, just like the YAP5SA mutant, it’s likely that the addition of Stemin mmRNA with Si knockdowns of Sal, NF(Merlin) and MOB 1 will also act in a complementary manner to favor increased cardiac myocyte proliferation.

    SRF Mutants That Drive the Expression of Stem Cell Marker Genes and Blocks Cardiomyocyte-Specified Genes

    Lentivirus Production

    [0084] HEK293T human kidney cells (ATCC #CRL-11268) were used as the host for lentiviral production. psPAX2 (Addgene plasmid # 12260) was used as a lentiviral packaging plasmid. pMD2.G (Addgene plasmid # 12259) was used as the lentiviral envelope expression plasmid. HEK293T were seeded at 30-40% confluency in a 10-cm cell culture dish. For MOB binding Domain MBD peptide overexpression, a pLenti-MBD-Puro construct, was used to produce lentiviruses. 10 ug of pLenti-MBD-Puro were mixed with 5 ug of psPAX and 5 ug of pMD2.G plasmids. The mixture was transfected the day after using Fugene HD according to the manufacturer instructions. Medium was changed 24 h after transfection. The lentiviruses were collected 72 h after transfection by collecting the medium and filtrating with 0.45-.Math.m filters.

    Demonstrating SRF Mutant Activity

    [0085] The idea that SRF activity is largely controlled by its interaction with cofactors such as Nkx2-5, Gata4, and others was tested by a “gain-of-function” approach applied to Srf-null ES cells through Lentiviral rescue of murine wild type ES cells AB2.2 and Srf.sup.-/- ES cells. Thus, co-factor gene expression by the lentiviral rescue of SRF null ES cells will serve, as a screening tool to evaluate co-factors’ functional relationships. ES cells were maintained at the optimal conditions. Since Nkx2-5 and Gata4 facilitate SRF dependent activation of cardiac differentiated gene programs, would disrupt their co-interactions with SRF act as a default program to block differentiation and stimulate replication (FIG. 12C). FIG. 12A shows a schematic diagram of the MADS box domain binding to DNA. Triple alanine mutations were tested by electrophoretic mobility assays (EMSA) with a [P.sup.32] labeled cardiac alpha-actin promoter DNA, in the presence of cellular lentiviral expressed Gata4 and or Nkx2-5 in comparison to control wild-type SRF. As shown by the EMSA (FIGS. 12E and 12F), Gata4, and Nkx2-5 enhanced the binding of wild-type SRF. In comparison, the triple alanine mutations starting at 141, 147, and or 150 poorly bound DNA, and their binding were not facilitated by the presence of co-expressed Nkx2-5 and Gata4; even though, Nkx2-5 showed considerable direct DNA binding to an NKX site embedded within the second and third CArG boxes. Note there are no Gata binding sites within the alpha cardiac actin promoter. The SRF153(A3) mutant displayed weak EMSA binding that was not improved by either Gata4 and or Nkx2-5. Thus, SRF mutants that failed to shift in the EMSA assay, also failed to activate cardiac actin promoter luciferase reporter activity.

    [0086] Next, key triple alanine substitution mutant sites were dissected by examining single alanine amino acid mutation substitutions predicted by DNA contact sites, shown by X-ray crystal analysis (FIG. 13B) and validated by EMSA DNA binding (FIG. 13A). Single alanine substitutions at amino acid positions N153, K154, and L155 was selected. The alanine substitution at N153A and L155A did not block DNA binding but didn’t facilitate SRF’s EMSA with Nkx2-5 and or Gata4. FIG. 13C; 13E. The single point mutation at K154A efficiently blocked DNA binding, which could not be stabilized by Nkx2-5 and Gata4. FIGS. 13C; 13E. The X-ray crystal analysis of SRF complexed with specific SRE was scrutinized and showed amino acid substitution at Lys 154 was the most critical residue for DNA binding between aa153-aa155 (FIGS. 13A; 13C; 13D).

    [0087] An ETS factor containing a B box, Elk1, stabilized and facilitated binding of the SRF153(A3) and the SRF mutant K154A by binding to the c-fos promoter, which has an ETS 1 binding site adjacent to the SRF binding CArG box. In contradistinction, the cardiac alpha-actin promoter does not contain ETS sites adjacent to SREs. Thus, depending on the target context the SRF mutant SRF153(A3) will likely block cardiogenic specified genes that are dependent on Nkx2-5 and Gata4 co-association. Analysis of SRF153(A3) binding targets by ATAC sequencing will reveal the inability of SRF153(A3) to bind to consensus CArG sequences. Instead, SRF153(A3) may depend upon tethering with other transcription factors to bind to DNA targets other than CArG sequences.

    [0088] The schematic diagram in FIG. 13A shows the novel activity of the Stemin, as an inhibitor of cardiac gene activity that propels cell replication. The ability for SRF to be the “myogenic driver” was completely abrogated in the SRF null ES cells. The triplet SRF mutant, SRF153(A3) inhibited the induction of several cardiomyocyte specified genes, such as those encoding sarcomeric actins, heavy and light chain myosins, ion channels, and structural proteins. Expression of sarcomeric assembly factors such as Actinin2, Nebulin, Titin, Myomesin, Obscurin, and Smyd1 was suppressed in comparison to wild-type ES cells that formed cardiomyocytes, following hanging drop formation.

    [0089] The sarcomere occupies a large volume of cardiomyocytes, which physically impedes mitosis and cytokinesis. Thus, sarcomere disassembly is a prerequisite task for cardiomyocyte proliferation. SRF153(A3) caused sarcomere dissociation in transfected myoctes. SRF mutant SRF153(A3), was named Stemin (SEQ ID NO: 50) because it showed powerful activation of more than 12 stem cell marker genes, such as Egr1, Rex1, Nanog, Oct4, Sox2, Zic3, Dppa2, Dnmt1, Dnmt2, and proliferin, in comparison to SRF null ES cells FIG. 13A. The expression of cyclins appeared to be repressed in the absence of SRF in the SRF null ES cells. Rescue with wild-type SRF caused activation of cyclins, CnnB1, CnnD1, CnnC, and CnnE1, while Stemin strongly induced CnnA2, CnnB1, and CnnE1. Thus, Stemin elicited an imperfect or partial pluripotency program and activated replication evidenced by the appearance of cell cycle factors. The observation that a single transcription factor, Stemin, induced the expression of stem cell factors and blocked cardiomyocyte differentiation was unprecedented.

    Combination mmRNA Treated Cardiomyocytes Progress Through the Cell Cycle

    [0090] Next, it was investigated whether Stemin (SEQ ID NO: 50) complements the Si knockdowns of Sal1, NF2 and Mob1 activity to drive cardiomyocyte replication. To exclude the potential low transfection rate of cardiomyocytes through plasmid DNA and the biosafety concerns of viral vectors, a modified mRNA-based transfection system was applied with optimized solutions of Stemin or YAP5SA and/or both together with Lipofectamine MessengerMAX into NRVM (neonatal rat ventricular myocytes). These young NRVM have a very low replication rate of less than 1-2% at the baseline. Stemin was added to the NRVM once at the beginning of the first day with new media changes for 6 hrs. To identify replicating myocytes, 5-ethynyl-2′-deoxyuridine (EdU) was pulsed for 8 hrs to label any myocytes synthesizing DNA during the S phase of the cell cycle. Synthetic mRNA transduced myocytes were assessed for EdU incorporation. EdU+ cell versus DAPI was counted for groups of pulse at 24-32 hrs, 32-40 hrs, and 40-48 hrs (Figure). A drop in cells centering S-phase at the last time period was observed in Stemin mmRNA and SI RNA Combination groups, indicating a transient yet efficient gene delivery. At the end of day two, counted were: the number of Troponin T (TNNT2) marked myocytes stained with anti TNNT2 (or Tnt2) that were also labeled for DNA synthesis with α-Edu and coincided with nuclear DAPI stain (FIG. 3G). Virtually all of the EdU+/DAPI stained nuclei lay within TnnT2 stained cells. Under confocal fluorescent microscopy, Stemin induced DNA replication, in 27% of the myocytes. Supporting these results, Stemin mRNA alone drives expression of pluripotent factors, Nanog and Oct4 in SRF null ES cells and 24 hours post transfected myocytes. Stemin also facilitates the expression of mitotic genes by 32 hours and DNA packaging factors, including Histlhla, Histld, Histlhlb, Histlh2ba and Hist3h2ba in 40 hour transfected young NRVMs.

    [0091] Mob1 SiRNA synthetic mRNA, labeled 29% of the myocytes stained with EdU+/DAPI. Most exciting was the combination of Stemin and the Mob1 SI transfection of the myocytes increased co-staining of the EdU+/DAPI marked myocytes by 35% of the total number of cells. This is a likely underestimate since replicated cells may have synthesized DNA before the pulse of α-EdU. Nuclei, co-stained with α-EdU (Red) and DAPI (Blue) were observed, as pink in the merged images. Also, disorganized Tnnt2 stained myofilaments (green) were observed with labeled EdU+/DAPI nuclei. Therefore, two short pulses of Stemin and or Yap5SA induced myocyte nucleus division, in at least 27% to 35% of NRVMs.

    [0092] Without further elaboration, it is believed that one skilled in the art can, using the description herein, utilize the present disclosure to its fullest extent. The embodiments described herein are to be construed as illustrative and not as constraining the remainder of the disclosure in any way whatsoever. While the embodiments have been shown and described, many variations and modifications thereof can be made by one skilled in the art without departing from the spirit and teachings of the invention. Accordingly, the scope of protection is not limited by the description set out above, but is only limited by the claims, including all equivalents of the subject matter of the claims. The disclosures of all patents, patent applications and publications cited herein are hereby incorporated herein by reference, to the extent that they provide procedural or other details consistent with and supplementary to those set forth herein.