Monoclonal antibody against human midkine

09840552 · 2017-12-12

Assignee

Inventors

Cpc classification

International classification

Abstract

A monoclonal antibody, which recognizes at least two amino acids among amino acids located at position 69, position 79, position 81 and position 102 of human midkine, has been found to have excellent reactivity with and excellent neutralizing activity against human midkine. Moreover, the activity of suppressing the proliferation of tumor has been observed in the antibody having excellent neutralizing activity. The use of the antibody of the present invention makes it possible to treat cancer effectively and to detect or purify midkine efficiently.

Claims

1. A monoclonal antibody comprising a light chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 21 to 23, and a heavy chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 24 to 26.

2. The monoclonal antibody according to claim 1, comprising a light chain variable region including the amino acid sequence defined by SEQ ID NO: 27, and a heavy chain variable region including the amino acid sequence defined by SEQ ID NO: 28.

3. A composition comprising the monoclonal antibody according to claim 1 as an active principle and a pharmaceutically acceptable carrier.

4. A method for treating a cancer in which the cancer cells have an increased expression of midkine, comprising administering to a human with said cancer a therapeutically effective amount of the monoclonal antibody according to claim 1, thereby suppressing proliferation of tumors.

5. The method according to claim 4, wherein the cancer is a neuroblastoma.

6. The method according to claim 4, wherein the cancer is selected from the group consisting of esophageal carcinoma, thyroid carcinoma, bladder cancer, stomach cancer, pancreatic cancer, liver cancer, pulmonary cancer, breast cancer, neuroblastoma, glioblastoma, uterine cancer, ovarian cancer, and Wilms tumor.

Description

BRIEF DESCRIPTION OF DRAWINGS

(1) FIG. 1 is graphs showing the results of analyses by ELISA of the reactivities of the acquired anti-midkine monoclonal antibodies with recombinant human midkine.

(2) FIG. 2 is graphs showing the results of analyses by ELISA of the reactivities of the acquired anti-midkine monoclonal antibodies with the recombinant human midkine.

(3) FIG. 3 is graphs showing the results of analyses by ELISA of the reactivities of the acquired anti-midkine monoclonal antibodies with the recombinant human midkine.

(4) FIG. 4 is graphs showing the results of analyses by ELISA of the reactivities of the acquired anti-midkine monoclonal antibodies with the recombinant human midkine.

(5) FIG. 5 is a graph showing the results of analyses by ELISA of the recognition sites in human midkine for the acquired anti-midkine monoclonal antibodies. “MK-full” represents the reactivity of each antibody with the human midkine full length, and “MK-C” represents the reactivity of each antibody with the human midkine C-terminal side (polypeptide comprising amino acids at positions 60 to 120).

(6) FIG. 6 is a graph showing the results of analyses of the neutralizing activity of the acquired anti-midkine monoclonal antibodies (FB53, FB54 and FB72) by evaluating the degree of inhibition of binding between alkaline phosphatase (AP)-labeled midkine (AP-MK) and the receptor on the cell surface. “AP” indicates a relative AP activity value (%) in an extract of cells incorporating only AP. “AP-MK+mAb” represents a relative AP activity value (%) in an extract of cells incorporating AP-MK and the anti-midkine monoclonal antibody. The term “none” denotes a relative AP activity value (%) in an extract of cells incorporating only AP-MK.

(7) FIG. 7 is graphs showing the results of analyses by ELISA of the reactivities of the acquired anti-midkine monoclonal antibodies (FB53, FB54, FB72, BF106 and FB74) with mutant midkine recombinant proteins (MK-W69A, MK-K79Q, MK-R81Q and MK-K102Q). In these graphs, “MK” signifies the reactivity of each antibody with a wild type midkine recombinant protein.

(8) FIG. 8 is a graph showing the results of analyses by ELISA of the reactivities of an anti-human midkine mouse monoclonal antibody (mFB54) and its chimerized antibody (chFB54) with recombinant human midkine.

(9) FIG. 9 is a graph showing the results of analyses by ELISA of the reactivities of a chimerized antibody for FB54 (an antibody having FB54-chH as the heavy chain variable region and FB54-chK as the light chain variable region) and humanized antibodies for FB54 (an antibody having FB54-rHa as the heavy chain variable region and FB54-rKa as the light chain variable region, an antibody having FB54-rHa as the heavy chain variable region and FB54-rKb as the light chain variable region, and an antibody having FB54-rHa as the heavy chain variable region and FB54-rKc as the light chain variable region) with recombinant human midkine.

(10) FIG. 10 is a graph showing the results of analyses by ELISA of the reactivities of a purified chimerized FB54 antibody (chFB54) and a purified humanized FB54 antibody (hFB54) with recombinant human midkine.

(11) FIG. 11 is a graph showing the results of evaluation of the antitumor activity of hFB54 by use of a mouse xenograft transplanted with a human neuroblastoma.

(12) FIG. 12 is a graph showing the results of analyses by ELISA of the reactivities, with recombinant human midkine (MKver10), of Fab antibodies having random mutations introduced into the antibody variable region of hFB54 (i.e., hFB54matu001 to 047). The term “original” represents the reactivity of hFB54 with recombinant human midkine.

(13) FIG. 13 is a graph showing the results of analyses by ELISA of the reactivities, with recombinant human midkine (MKver10), of Fab antibodies having random mutations introduced into the antibody variable region of hFB54 (i.e., hFB54matu048 to 094). The term “original” represents the reactivity of hFB54 with recombinant human midkine.

(14) FIG. 14 is a graph showing the results of analyses by ELISA of the reactivities, with mouse midkine (mMK), of Fab antibodies having random mutations introduced into the antibody variable region of mFB54 (i.e., mFB54matu001 to 047). The designation “original” represents the reactivity of mFB54 with mouse midkine.

(15) FIG. 15 is a graph showing the results of analyses by ELISA of the reactivities, with mouse midkine (mMK), of Fab antibodies having random mutations introduced into the antibody variable region of mFB54 (i.e., mFB54matu048 to 094). The designation “original” represents the reactivity of mFB54 with mouse midkine.

(16) FIG. 16 is a graph showing the results of analyses by ELISA of the reactivities of hFB54 and its affinity-improved antibodies (hFB54-matu014, hFB54-matu020, hFB54-matu024, hFB54-matu039, hFB54-matu054, hFB54-matu062, and hFB54-matu072) with recombinant human midkine (MKver10).

(17) FIG. 17 is a graph showing the results of analyses by ELISA of the reactivities of mFB54 and its affinity-improved antibodies (mFB54-matu002, mFB54-matu089) with mouse midkine (mMK).

(18) FIG. 18 is a graph showing the results of comparisons of the amino acid sequences of the heavy chain variable region and the light chain variable region between mFB54 and the affinity-improved antibodies of mFB54 (SEQ ID NOs: 7 and 8) (matu002 (SEQ ID NOs: 19 and 20), matu089 (SEQ ID NOs: 27 and 28)) and between hFB54 (SEQ ID NOs: 11 and 12) and the affinity-improved antibodies of hFB54 (matu014 (SEQ ID NOs: 35 and 36), matu020 (SEQ ID NOs: 43 and 44), matu024 (SEQ ID NOs: 51 and 52), matu039 (SEQ ID NOs: 59 and 60), matu054 (SEQ ID NOs: 67 and 68), matu062 (SEQ ID NOs: 75 and 76), and matu072 (SEQ ID NOs: 83 and 84)).

(19) FIG. 19 is a graph showing the results of analyses by ELISA of the reactivities of mFB54, the affinity-improved antibodies of mFB54, hFB54, and the affinity-improved antibodies of hFB54 with recombinant human midkine (MKver10).

(20) FIG. 20 is a graph showing the results of analyses by ELISA of the reactivities of mFB54, the affinity-improved antibodies of mFB54, hFB54, and the affinity-improved antibodies of hFB54 with mouse midkine (mMK).

(21) FIG. 21 is a graph showing the results of analyses of the neutralizing activities of the affinity-improved antibodies of mFB54, hFB54, the affinity-improved antibodies of hFB54, and chFB54 by evaluating the degree of inhibition of binding between AP-MK and the receptor on the cell surface. The symbol “AP” indicates a relative AP activity value (%) in an extract of cells incorporating only AP. The symbol “AP-MK+mAb” represents a relative AP activity value (%) in an extract of cells incorporating AP-MK and the anti-midkine monoclonal antibody. The designation “none” denotes a relative AP activity value (%) in an extract of cells incorporating only AP-MK.

DESCRIPTION OF EMBODIMENTS

(22) The present invention provides a monoclonal antibody which recognizes at least two amino acids among amino acids at position 69, position 79, position 81 and position 102 of human midkine and which has neutralizing activity against human midkine.

(23) The term “midkine” in the present invention refers to a protein, also called neurite growth promoting factor 2 (NEGF2), which is rich in basic amino acids and cysteine and has a molecular weight of about 13 KDa. Midkine has been shown to promote the survival and migration of cells and partake in the progression of cancer, the occurrence of inflammatory disease, and the preservation and repair of injured tissue. The substance “human midkine”, to which the antibody of the present invention binds, refers to midkine derived from humans. Typically, human midkine is a protein comprising lysine at the 23-position to aspartic acid at the 143-position in a protein specified as RefSeq ID:NP_001012333 (a protein encoded by DNA specified as RefSeq ID:NM_001012333). The protein specified as RefSeq ID:NP_001012333 is a precursor including a signal peptide, and the “protein comprising lysine at the 23-position to aspartic acid at the 143-position” is a matured secretory human midkine deprived of the signal peptide. Normally, in human midkine, the 23-position lysine is defined as the 1-position amino acid, and thus such a definition is also given herein. That is, the “amino acids at position 69, position 79, position 81 and position 102 of human midkine” in the present invention correspond to 91-position tryptophan, 101-position lysine, 103-position arginine and 124-position lysine, respectively, in the protein (precursor) specified as RefSeq ID:NP_001012333.

(24) The antibody of the present invention recognizes at least two amino acids among the amino acids at position 69, position 79, position 81 and position 102 of human midkine, and has neutralizing activity against human midkine. For example, FB53 described in the Examples herein recognizes the two amino acids at position 69 and position 81 of human midkine, and FB54 and FB72 recognize all of the amino acids at position 69, position 79, position 81 and position 102 of human midkine (FIG. 7). Such recognition specificity in the antibodies was found to correlate with the neutralizing activity against human midkine. In particular, FB54 and FB72 recognizing all of the amino acids at positions 69, 79, 81 and 102 of human midkine, and the amino acid sequence mutants of FB54 (the antibodies improved in reactivity with midkine) had excellent neutralizing activities (FIGS. 6, 21). Hence, a preferred embodiment of the antibody of the present invention is an antibody recognizing all of the amino acids at positions 69, 79, 81 and 102 of human midkine.

(25) The recognition by the antibody of particular amino acids on human midkine can be evaluated, for example, by using, as an index, a decrease in reactivity with a peptide having the particular amino acids mutated, as described in Example 15. The “neutralizing activity against human midkine”, which the antibody has, can be evaluated as the activity of the test antibody in inhibiting the binding of labeled midkine to the midkine receptor, as described in Examples 12 and 24. The activity of the present invention is an antibody which, as compared with a control (no antibody), lowers the binding of midkine, preferably to 80% or less, more preferably to 70% or less, still more preferably to 60% or less, still more preferably to 50% or less, still more preferably to 40% or less, even more preferably to 30% or less, most preferably to 20% or less.

(26) Another preferred embodiment of the antibody of the present invention is an antibody having tumor proliferation suppressing activity. The “tumor proliferation suppressing activity” of the antibody can be evaluated, for example, by measuring the volume of a tumor after administration of the test antibody in an experiment using a mouse xenograft, as described in Example 21. The antibody of the present invention is an antibody which decreases the tumor volume at 29 days or later after transplantation of tumor cells (for example, at 29, 33, 36 or 41 days) to preferably 80% or less, more preferably 75% or less, more preferably 70% or less, more preferably 65% or less, more preferably 60% or less, more preferably 55% or less, in comparison with a control (without antibody). For example, FB54 described in the present Examples had excellent activity of suppressing tumor proliferation (FIG. 11). Because of this tumor proliferation suppressing activity, the antibody of the present invention can also exhibit the effect of prolonging the life of an individual.

(27) The antibody of the present invention is particularly preferably an antibody concurrently having a plurality of the above-mentioned activities.

(28) Another preferred embodiment of the antibody of the present invention is an antibody comprising a light chain variable region including light chain CDR1 to CDR3 and a heavy chain variable region including heavy chain CDR1 to CDR3 of FB54 described in the present Examples, or amino acid sequence mutants thereof. That is, the inventive antibody is an antibody comprising a light chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 1 to 3, or complementarity-determining regions comprising amino acid sequences having one or more amino acids substituted, deleted, added and/or inserted in at least one of the above amino acid sequences; and a heavy chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 4 to 6, or complementarity-determining regions comprising amino acid sequences having one or more amino acids substituted, deleted, added and/or inserted in at least of the above amino acid sequences.

(29) The preferred amino acid sequence mutants of FB54 are antibodies in which the amino acid at the 4-position of CDR1 of the light chain has been mutated from “T” into “I”, namely, the antibodies in which the amino acid at the 4-position of CDR1 among the complementarity-determining regions in the light chain variable region is isoleucine. Such antibodies have in common excellent reactivity with human midkine and mouse midkine (FIG. 18). Concrete examples of such antibodies are antibodies having a feature described in one of (a) to (i) below. <matu002>

(30) (a) comprising a light chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 13 to 15, and a heavy chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 16 to 18. <matu089>

(31) (b) comprising a light chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 21 to 23, and a heavy chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 24 to 26. <matu014>

(32) (c) comprising a light chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 29 to 31, and a heavy chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 32 to 34. <matu020>

(33) (d) comprising a light chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 37 to 39, and a heavy chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 40 to 42. <matu024>

(34) (e) comprising a light chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 45 to 47, and a heavy chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 48 to 50. <matu039>

(35) (f) comprising a light chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 53 to 55, and a heavy chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 56 to 58. <matu054>

(36) (g) comprising a light chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 61 to 63, and a heavy chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 64 to 66. <matu062>

(37) (h) comprising a light chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 69 to 71, and a heavy chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 72 to 74. <matu072>

(38) (i) comprising a light chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 77 to 79, and a heavy chain variable region including complementarity-determining regions comprising amino acid sequences defined by SEQ ID NOs: 80 to 82.

(39) Another preferred embodiment of the antibody of the present invention is an antibody comprising a light chain variable region and a heavy chain variable region of FB54 (mouse antibody), or amino acid sequence mutants thereof. That is, the inventive antibody is an antibody comprising a light chain variable region including the amino acid sequence defined by SEQ ID NO: 7, or the amino acid sequence having one or more amino acids substituted, deleted, added and/or inserted in at least anywhere in the above amino acid sequence; and a heavy chain variable region including the amino acid sequence defined by SEQ ID NO: 8, or an amino acid sequence having one or more amino acids substituted, deleted, added and/or inserted in at least anywhere in the above amino acid sequence.

(40) Another preferred embodiment of the antibody of the present invention is FB54 (humanized antibody), or an amino acid sequence mutant thereof. That is, the inventive antibody is a monoclonal antibody comprising a light chain variable region described in one of the following (a) to (c):

(41) (a) a light chain variable region including the amino acid sequence defined by SEQ ID NO: 9, or the amino acid sequence having one or more amino acids substituted, deleted, added and/or inserted in at least anywhere in the above amino acid sequence,

(42) (b) a light chain variable region including the amino acid sequence defined by SEQ ID NO: 10, or an amino acid sequence having one or more amino acids substituted, deleted, added and/or inserted in at least anywhere in the above amino acid sequence,

(43) (c) a light chain variable region including the amino acid sequence defined by SEQ ID NO: 11, or the amino acid sequence having one or more amino acids substituted, deleted, added and/or inserted in at least anywhere in the above amino acid sequence;

(44) and

(45) a heavy chain variable region including the amino acid sequence defined by SEQ ID NO: 12, or the amino acid sequence having one or more amino acids substituted, deleted, added and/or inserted in at least anywhere in the above amino acid sequence.

(46) The preferred amino acid sequence mutant of FB54 (mouse antibody and humanized antibody) is an antibody in which the amino acid at the 4-position of CDR1 of its light chain has been mutated from “T” into “I”, namely, the antibody in which the amino acid at the 4-position of CDR1 among the complementarity-determining regions in the light chain variable region is isoleucine. Concrete examples of such an antibody are antibodies having a feature described in any one of (a) to (i) below. <matu002>

(47) (a) comprising a light chain variable region including the amino acid sequence defined by SEQ ID NO: 19, and a heavy chain variable region including the amino acid sequence defined by SEQ ID NO: 20. <matu089>

(48) (b) comprising a light chain variable region including the amino acid sequence defined by SEQ ID NO:27, and a heavy chain variable region including the amino acid sequence defined by SEQ ID NO:28. <matu014>

(49) (c) comprising a light chain variable region including the amino acid sequence defined by SEQ ID NO:35, and a heavy chain variable region including the amino acid sequence defined by SEQ ID NO:36. <matu020>

(50) (d) comprising a light chain variable region including the amino acid sequence defined by SEQ ID NO:43, and a heavy chain variable region including the amino acid sequence defined by SEQ ID NO:44. <matu024>

(51) (e) comprising a light chain variable region including the amino acid sequence defined by SEQ ID NO:51, and a heavy chain variable region including the amino acid sequence defined by SEQ ID NO:52. <matu039>

(52) (f) comprising a light chain variable region including the amino acid sequence defined by SEQ ID NO:59, and a heavy chain variable region including the amino acid sequence defined by SEQ ID NO:60. <matu054>

(53) (g) comprising a light chain variable region including the amino acid sequence defined by SEQ ID NO:67, and a heavy chain variable region including the amino acid sequence defined by SEQ ID NO:68. <matu062>

(54) (h) comprising a light chain variable region including the amino acid sequence defined by SEQ ID NO:75, and a heavy chain variable region including the amino acid sequence defined by SEQ ID NO:76. <matu072>

(55) (i) comprising a light chain variable region including the amino acid sequence defined by SEQ ID NO:83, and a heavy chain variable region including the amino acid sequence defined by SEQ ID NO:84.

(56) The “monoclonal antibody” in the present invention refers to an antibody (including an antibody fragment) obtained from a population of substantially homogeneous antibodies. As contrasted with a polyclonal antibody, the monoclonal antibody recognizes a single determinant on an antigen. The antibody of the present invention is an antibody separated and/or recovered (namely, isolated) from components in the natural environment.

(57) The antibodies of the present invention include chimeric antibodies, humanized antibodies, human antibodies, and functional fragments of these antibodies. When the antibody of the present invention is administered to a human as a medicine, its form as a chimeric antibody, a humanized antibody or a human antibody is desirable from the viewpoint of reducing adverse reactions.

(58) The “chimeric antibody” in the present invention refers to an antibody formed by joining a variable region of a certain type of antibody to a constant region of a different type of antibody. The chimeric antibody can be obtained, for example, by immunizing a mouse with an antigen, cutting an antibody variable region, which binds to the antigen, out of a gene of a monoclonal antibody from the mouse, bonding the antibody variable region to a human bone marrow-derived antibody constant region gene, integrating the bonding product into an expression vector, and transducing the expression vector into a host for production (for example, JP-A-7-194384, Japanese Patent No. 3238049, U.S. Pat. No. 4,816,397, U.S. Pat. No. 4,816,567, U.S. Pat. No. 5,807,715). The “humanized antibody” in the present invention is an antibody constructed by transplanting the genetic sequence of an antigen-binding site (CDR) of a nonhuman-derived antibody into a human antibody gene (CDR grafting), and methods for its preparation are publicly known (see, for example, Japanese Patent No. 2912618, Japanese Patent No. 2828340, Japanese Patent No. 3068507, European Patent No. 239400, European Patent No. 125023, and WO90/07861, WO96/02576). In the present invention, the “human antibody” refers to an antibody having all regions human-derived. For the preparation of the human antibody, it is possible to utilize a transgenic animal (e.g., mouse) which, when immunized, can produce a repertoire of human antibodies. Methods for preparation of the human antibody are publicly known (for example, Nature, 362:255-258 (1992), Intern. Rev. Immunol, 13:65-93 (1995), J. Mol. Biol, 222:581-597 (1991), Nature Genetics, 15:146-156 (1997), Proc. Natl. Acad. Sci. USA, 97:722-727 (2000), JP-A-10-146194, JP-A-10-155492, Japanese Patent No. 2938569, JP-A-11-206387, JP-T-8-509612, JP-T-11-505107). In the present Examples, success has been achieved in preparing chimeric antibodies and humanized antibodies having excellent reactivities with and excellent neutralizing activities against midkine on the basis of the FB54 gene (FIGS. 8 to 10, 19 to 21).

(59) The “functional fragment” of the antibody in the present invention refers to a part of the antibody (partial fragment) which recognizes human midkine. Its concrete examples are Fab, Fab′, F(ab′)2, a variable region fragment (Fv), a disulfide bond Fv, single-stranded Fv (scFv), sc(Fv)2, and polymers of them.

(60) The “Fab” refers to a monovalent antigen-binding fragment of an immunoglobulin which is composed of a light chain and a part of a heavy chain. The Fab can be obtained by papain digestion of the antibody, or by a recombination process. In the present Examples, the present invention has been successful in preparing Fab having excellent reactivity with midkine based on the FB54 gene (FIGS. 12 to 17). The “Fab′” is different from Fab because of the addition of limited amounts of residues at the carboxyl terminal of the heavy CH1 domain, including one or more cysteines of the hinge region of the antibody. The “F(ab′)2” refers to a divalent antigen-binding fragment of an immunoglobulin composed of both light chains and portions of both heavy chains.

(61) The “variable region fragment (Fv)” is the smallest antibody fragment having complete antigen recognizing and binding sites. Fv is a dimer having a heavy chain variable region and a light chain variable region joined more strongly by a noncovalent bond. The “single-stranded Fv (sFv)” includes the heavy chain variable region and the light chain variable region of the antibody, and these regions are present in a single polypeptide chain. The “sc(Fv)2” is in a single-stranded configuration composed of two heavy chain variable regions and two light chain variable regions bonded by a linker or the like.

(62) The antibody of the present invention includes an antibody having an amino acid sequence modified without reductions in its desirable activities (for example, reactivity with human midkine and mouse midkine, neutralizing activity again human midkine, and tumor proliferation suppressing activity). Amino acid sequence mutants of the antibody of the present invention can be prepared by introduction of a mutation into DNA coding for the antibody chain of the present invention, or by peptide synthesis. Such a modification includes, for example, substitution, deletion, addition and/or insertion of the residue within the amino acid sequence of the antibody of the present invention. The site where the amino acid sequence of the antibody is altered may be the heavy chain or light chain constant region of the antibody, or may be the variable region (framework region or CDR), as long as the altered antibody has activity comparable to that of the antibody before alteration. The alteration of the amino acid in a portion other than CDR is assumed to exert relatively little influence on antigen-binding affinity. Nowadays, methods for screening for antibodies with affinity for antigens improved by alteration of the amino acid of CDR are publicly known (PNAS, 102:8466-8471 (2005), Protein Engineering, Design & Selection, 21:485-493(2008), WO2002/051870, J. Biol. Chem., 280:24880-24887 (2005), Protein Engineering, Design & Selection, 21:345-351 (2008)). The amino acids to be altered are preferably 10 amino acids or less, more preferably 5 amino acids or less, most preferably 3 amino acids or less (for example, 2 amino acids or less, or 1 amino acid). Actually, in the present Examples, mutations were introduced into the variable regions of FB54 (framework regions and CDRs), and success was achieved in preparing a number of amino acid sequence mutants having excellent reactivities with human midkine and mouse midkine and excellent neutralizing activities against human midkine (Examples 22 to 24, FIG. 18).

(63) In the present invention, moreover, an amino acid to be deamidated for the purpose of increasing the stability of the antibody, or an amino acid adjacent to the amino acid to be deamidated, may be substituted by other amino acid, whereby deamidation can be suppressed. Alternatively, glutamic acid can be substituted by other amino acid to increase the stability of the antibody. The present invention also provides an antibody stabilized in this manner.

(64) The antibody of the present invention can be prepared by the hybridoma process or the recombinant DNA process. A typical example of the hybridoma process is the method of Kohler & Milstein (Nature, 256:495 (1975)). Antibody-producing cells used in the cell fusion step of this method are spleen cells, lymph node cells, peripheral blood leukocytes, etc. of an animal (e.g., mouse, rat, hamster, rabbit, monkey, goat) immunized with an antigen (human midkine, its partial peptide, or cells expressing them). It is also possible to use antibody-producing cells obtained by allowing an antigen to act in a culture medium on the above cells or lymphocytes isolated in advance from an unimmunized animal. As myeloma cells, publicly known various cell strains can be used. The antibody-producing cells and myeloma cells may originate indifferent animal species, if they are mutually fusible; preferably, however, they are of the same animal species origin. Hybridomas, for example, are produced by cell fusion between spleen cells obtained from an antigen-immunized mouse and mouse myeloma cells, and subsequent screening can obtain hybridomas producing a monoclonal antibody against human midkine. The monoclonal antibody against human midkine can be yielded from a culture of the hybridomas, or from an ascitic fluid of a mammal administered the hybridomas.

(65) The recombinant DNA process is a method for producing the antibody of the present invention as a recombinant antibody by cloning DNA encoding the antibody or peptide of the present invention from hybridomas or B cells, integrating the clone into a suitable vector, and transducing the vector into host cells (e.g., mammalian cell line, E. coli, yeast cells, insect cells, plant cells, etc.) (for example, P. J. Delves, Antibody Production: Essential Techniques, 1997 WILEY, P. Shepherd and C. Dean Monoclonal Antibodies, 2000 OXFORD UNIVERSITY PRESS, Vandamme A. M. et al., Eur. J. Biochem. 192:767-775 (1990)). For the expression of DNA encoding the antibody of the present invention, DNA encoding the heavy chain and DNA encoding the light chain may be separately integrated into expression vectors to transform host cells, or DNA encoding the heavy chain and DNA encoding the light chain may be integrated into a single expression vector to transform host cells (see WO94/11523). The antibody of the present invention can be yielded in a substantially pure uniform shape by culturing the above host cells, and separating and purifying the product from within the host cells or from a culture broth. For the separation and purification of the antibody, a customary method used in polypeptide purification can be used. If a transgenic animal (cattle, goat, sheep or pig) incorporating the antibody gene is prepared using a transgenic animal preparation technology, monoclonal antibodies derived from the antibody gene can be yielded in large amounts from the milk of the transgenic animal.

(66) The present invention provides a DNA coding for the antibody of the present invention, and a vector containing the DNA. The invention also provides a cell or an organism which produces the antibody of the present invention, or which contains the DNA of the present invention. Further, the present invention provides a method for producing the antibody, including the steps of culturing the cell, or breeding the organism, and recovering the antibody. Examples of the cell, which produces the antibody of the present invention or which contains the DNA of the present invention, are the aforementioned hybridomas and the aforesaid host cells. Examples of the organism, which produces the antibody of the present invention or which contains the DNA of the present invention, are the aforementioned transgenic animal and the aforementioned animal immunized with the antigen or the like.

(67) Since the antibody of the present invention has neutralizing activity against human midkine, it can be used as a therapeutic drug and a prophylactic drug for a midkine-related disease. Examples of the midkine-related disease are diseases due to cell proliferation or neovascularization, such as cancer (neuroblastoma, glioblastoma, esophageal carcinoma, thyroid carcinoma, bladder cancer, large bowel cancer, stomach cancer, pancreatic cancer, breast cancer, liver cancer, pulmonary cancer, mammary carcinoma, uterine cancer, ovarian cancer, prostatic cancer, Wilms tumor), and endometriosis; inflammatory diseases or chemotaxis-associated diseases, such as arthritis, autoimmune diseases (organ-specific autoimmune disease, etc.), articular rheumatism (rheumatoid arthritis (RA), osteoarthrosis (OA)), multiple sclerosis (relapsing-remitting multiple sclerosis, etc.), inflammatory enteritis (Crohn disease, etc.), systemic lupus erythematosus (SLE), progressive systemic sclerosis (PSS), Sjögren syndrome, polymyositis (PM), dermatomyositis (DM), polyarteritis nodosa (PN), thyroid disease (Basedow disease, etc.), Guillain-Barré syndrome, primary biliary cirrhosis (PBC), sudden thrombocytopenic purpura, autoimmune hemolytic anemia, myasthenia gravis (EAMG), amyotrophic lateral sclerosis (ALS), type 1 diabetes mellitus, transplant rejection, postoperative adhesion, endometriosis, psoriasis, lupus, allergy, asthma, and neutrophil dysfunction; and vascular obstructive diseases or diseases attributed to intimal thickening, such as restenosis after revascularization, coronary vascular obstructive disease, cerebrovascular obstructive disease, renovascular obstructive disease, peripheral vessel obstructive disease, arteriosclerosis, and cerebral infarction. Thus, the present invention also provides a drug for treating or preventing a midkine-related disease, the drug containing the antibody of the present invention as an active principle; and provides a method for treating or preventing a midkine-related disease, including the step of administering an effective amount of the inventive antibody to a mammal including a human.

(68) The antibody of the present invention, as shown in the present Examples, has the excellent activity of suppressing tumor proliferation, and is thus suitable as an anticancer drug. Thus, the present invention, in its preferred embodiments, also provides an anticancer drug containing the antibody of the present invention as an active principle; and provides a method for treating or preventing cancer, including the step of administering an effective amount of the inventive antibody to a patient (e.g., a mammal including a human).

(69) The anticancer drug containing the antibody of the present invention as an active principle can be used in the form of a composition containing the antibody of the present invention and an optional ingredient, for example, physiological saline, an aqueous solution of glucose, or a phosphate buffer solution. The pharmaceutical composition of the present invention may be formulated, if desired, in a liquid or lyophilized form, and may optionally contain a pharmaceutically acceptable carrier or medium, for example, a stabilizer, a preservative, an isotonizing agent or the like.

(70) As the pharmaceutically acceptable carrier, mannitol, lactose, saccharose, and human albumin can be cited as examples in the case of the lyophilized preparation. In the case of the liquid preparation, examples of the carrier are, but not limited to, physiological saline, water for injection, a phosphate buffer solution, and aluminum hydroxide.

(71) The method of administering the anticancer drug of the present invention differs according to the age, body weight, sex, health state, etc. of the subject for administration. However, the anticancer drug can be administered by any of the following routes, oral route and parenteral route (e.g., intravenous administration, intraarterial administration, local administration). The preferred method of administration is the parenteral administration. The dosage of the anticancer drug of the present invention can be varied according to the age, body weight, sex or health condition of the patient, the degree of progression of cancer, and the ingredients of the anticancer drug to be administered. Generally, for intravenous administration, the dosage for an adult is 0.1 to 1000 mg, preferably 1 to 100 mg, daily per kg body weight.

(72) Since the antibody of the present invention has excellent reactivity with human midkine and mouse midkine, it is expected to be applied as an agent for the detection of these midkines (for example, detection in experiments or diagnosis) or for the purification of the midkines. When used for detection of midkine, the antibody of the present invention may be a labeled one. For labeling, a radioactive substance, a fluorescent dye, a chemiluminescent substance, an enzyme, or a coenzyme, for example, can be used. Their examples are radioisotopes, fluorescein, rhodamine, dansyl chloride, luciferase, peroxidase, alkaline phosphatase, lysozyme, and biotin/avidin. In formulating the antibody of the present invention as a drug, an optional means appropriate for the intended purpose can be adopted to obtain the drug in an arbitrary dosage form. For example, it is permissible to measure the purified antibody for the antibody titer, dilute it appropriately with PBS (phosphate buffer solution containing physiological saline) or the like, and then add 0.1% sodium azide or the like as a preservative. It is also possible, for example, to determine the antibody titer of the inventive antibody adsorbed to latex or the like, dilute it at a suitable ratio, and add a preservative before use.

EXAMPLES

(73) The present invention will now be described more specifically based on the following Examples, but is in no way limited to these Examples.

(Example 1) Acquisition of cDNA of MK

(74) Based on the cDNA sequence of human MK (NM_001012333), primers to be shown below were designed in a 5′UTR region and a 3′UTR region. From total RNA extracted from human prostatic cancer cells PC3, cDNA was prepared using SuperScriptIII cells direct cDNA Synthesis System (Invitrogen). Using it as a template, cDNA containing the protein coding region full length of MK was amplified by nested PCR using KOD Plus Ver.2 (TOYOBO). The 1.sup.st PCR conducted amplification with 25 cycles of [98° C. 20 seconds, 57° C. 20 seconds, 68° C. 45 seconds], and the 2.sup.nd PCR conducted amplification with 30 cycles of [98° C. 15 seconds, 58° C. 15 seconds, 68° C. 45 seconds]. The amplification product of the 2.sup.nd PCR was cloned into the cloning vector pT7Blue T-Vector (Novagen) to confirm its nucleotidesequence. Confirmation of the nucleotide sequence used an autosequencer (Applied Biosystems). The cloned cDNA coincided with the sequence of human MK, and was thus designated as hMK-pT7.

(75) TABLE-US-00001 1.sup.stPCR 5′ primer: (SEQ ID NO: 85) 5′-GAGTCGCCTCTTAGCGGATGC-3′ 3′ primer: (SEQ ID NO: 86) 5′-GCTCCTTGGCATCCAGGCTTG-3′ 2.sup.nd PCR 5′ primer: (SEQ ID NO: 87) 5′-CGGATGCAGCACCGAGGCTTC-3′ 3′ primer: (SEQ ID NO: 88) 5′-GGCTTGGCGTCTAGTCCTTTCC-3′

(76) Similarly, cDNA containing the protein coding region full length of mouse MK was amplified. Mouse fetus visceral tissue-derived cDNA was used as a template. Primers were designed based on the DNA sequence of mouse MK (NM_001012336). The cloned cDNA coincided with the sequence of mouse MK, and was thus designated as mMK-pT7.

(77) TABLE-US-00002 1.sup.st PCR 5′ primer: (SEQ ID NO: 89) 5′-AAGCATCGAGCAGTGAGCGAGATG-3′ 3′ primer: (SEQ ID NO: 90) 5′-AACAAGTATCAGGGTGGGGAGAAC-3′ 2.sup.nd PCR 5′ primer: (SEQ ID NO: 91) 5′-GATGCAGCACCGAGGCTTCTTC-3′ 3′ primer: (SEQ ID NO: 92) 5′-TATGGGGAGGCTCACTTTCCAG-3′

(Example 2) Production of Cells Secreting and Expressing MK

(78) Animal cells expressing the aa1-aa121 portion of human MK (MKver10) or the aa57-aa121 portion of human MK (MKver50), or aa1-aa119 of mouse MK (mMK) were produced in the following manner:

(79) An MK partial length fragment amplified by PCR using primers indicated below, with hMK-pT7 or mMK-pT7 as a template, was cleaved at the ends with NotI and BamHI, and inserted into the NotI-BamHI site of an expression vector for animal cells. As the expression vector for animal cells, there was used pQCxmhIPG controlled by a CMV promoter and expressing the target gene and Puromycin-EGFP fused protein simultaneously by use of an IRES sequence. The pQCxmhIPG is a vector modified by the inventors from pQCXIP Retroviral Vector of “BD Retro-X Q Vectors” (Clontech). The resulting vectors were designated as MKver10-pQCxmhIPG, MKver50-pQCxmhIPG, and mMK-pQCxmhIPG.

(80) TABLE-US-00003 MKver10 5′ primer: 5′-aataGCGGCCGCACCATGCAGCACCGAGGCTTCCTC-3′ (SEQ ID NO: 93; the underlined portion is NotI recognition sequence) 3′ primer: 5′-cgGGATCCGTCCTTTCCCTTCCCTTTCTTG-3′ (SEQ ID NO: 94; the underlined portion is BamHI recognition sequence) MKver50 5′ primer: 5′-aataGCGGCCGCGGAGTTTGGAGCCGACTGC-3′ (SEQ ID NO: 95; the underlined portion is NotI recognition sequence) 3′ primer: 5′-cgGGATCCGTCCTTTCCCTTCCCTTTCTTG-3′ (SEQ ID NO: 96; the underlined portion is BamHI recognition sequence) mMK 5′ primer: 5′-aataGCGGCCGCACCATGCAGCACCGAGGCTTCTTC-3′ (SEQ ID NO: 97; the underlined portion is NotI recognition sequence) 3′ primer: 5′-cgGGATCCGTCCTTTCCTTTTCCTTTCTTGGC-3′ (SEQ ID NO: 98; the underlined portion is BamHI recognition sequence)

(81) MK secreting/expressing cell lines were prepared using Pantropic Retroviral Expression System (Clontech: K1063-1). GP2-293 (Clontech: K1063-1) in an 80 to 90% confluent state was readied in a collagen-coated 100 mm dish, and the expression vectors constructed above (MKver10-pQCxmhIPG, MKver50-pQCxmhIPG, or mMK-pQCxmhIPG) and pVSV-G (Clontech: K1063-1) were cotransduced in an amount of 11.2 μg each using Lipofectamine 2000 (Invitrogen). After a lapse of 48 hours, the supernatant containing viral particles was recovered, and the viral particles were precipitated by ultracentrifugation (18,000 rpm, 1.5 hours, 4° C.). The precipitate was suspended with 30 μL THE (50 mM Tris-HCl [pH=7.8], 130 mM NaCl, 1 mM EDTA) to prepare a retrovirus vector concentrate. The retrovirus vector concentrate (5 μL) was diluted with 150 μL DMEM (SIGMA: D5796)-10% FBS containing 8 μg/mL hexadimethrine bromide (SIGMA: H-9268) to prepare a viral particles-containing culture medium. A culture medium of 293T readied so as to be in an approximately 40% confluent state on a 96-well microplate was replaced by the prepared viral particles-containing culture medium to introduce the desired gene. After introduction, the gene was expansively cultured with DMEM (SIGMA: D5796)-10% FBS containing 5 μg/mL Puromycin (SIGMA: P-8833) to establish antigen expression cell lines (MKver10/st293T, MKver50/st293T, mMK/st293T).

(Example 3) Preparation MK Purified Proteins (Animal Cell-Derived Recombinant Proteins)

(82) The expression cell lines established as above (MKver10/st293T, MKver50/st293T, mMK/st293T) were each cultured with 1 L CD293 (Invitrogen). The culture supernatant was recovered, and recombinant proteins (MKver10, MKver50, mMK) were each purified therefrom using TALON Purification Kit (Clontech: K1253-1), followed by confirming the purified proteins by SDS-PAGE and Western blot. Their protein concentrations were determined using Protein Assay Kit II (BioRad: 500-0002JA).

(Example 4) Production of E. coli Expressing MK

(83) E. coli recombinant proteins of the aa23-aa121 (MKver60) and aa57-aa121 (MKver80) portions of human MK were produced in the following manner: An MK partial length fragment amplified by PCR using primers indicated below, with hMK-pT7 as a template, was cleaved at the ends with BamHI and XhoI, and inserted into the BamHI-XhoI site of pET28a to construct E. coli expression vectors. Using these vectors, BL21 was transformed. The resulting transformants were designated as MKver60/BL21 and MKver80/BL21.

(84) TABLE-US-00004 MKver60 5′ primer: 5′-cgGGATCCAAAAAGAAAGATAAGGTGAAGAAG-3′ (SEQ ID NO: 99; the underlined portion is BamHI recognition sequence) 3′ primer: 5′-ccgCTCGAGGTCCTTTCCCTTCCCTTTCTTG-3′ (SEQ ID NO: 100; the underlined portion is XhoI recognition sequence) MKver80 5′ primer: 5′-cgGGATCCGAGTTTGGAGCCGACTGCAAG-3′ (SEQ ID NO: 101; the underlined portion is BamHI recognition sequence) 3′ primer: 5′-ccgCTCGAGGTCCTTTCCCTTCCCTTTCTTG-3′ (SEQ ID NO: 102; the underlined portion is XhoI recognition sequence)

(Example 5) Preparation of MK Purified Proteins (E. coli-Derived Recombinant Proteins)

(85) The E. coli strains MKver60/BL21 and MKver80/BL21 established as above were each cultured in a 1 L kanamycin-containing LB medium, and induced expression was performed using 1 mM IPTG. The resulting recombinant proteins were each purified from a PBS soluble fraction with the use of TALON Purification Kit (Clontech: K1253-1). The purified proteins were confirmed by SDS-PAGE and Western blot. Their protein concentrations were determined using Protein Assay Kit II (BioRad: 500-0002JA).

(Example 6) Immunization with Antigen

(86) MKver10, MKver50, MKver60, or MKver80 was mixed with the same amount of a complete adjuvant (SIGMA: F5881) to form an emulsion. Four- to 5-week-old Balb/c mice (Japan SLC, Inc.) were immunized with 5 to 20 μg of the emulsion per mouse 6 times at intervals of 3 to 7 days. Lymphocytes were extracted from the mouse 3 days after final immunization, and fused to mouse myeloma cells P3U1 (P3-X63Ag8U1).

(Example 7) Cell Fusion

(87) Cell fusion was performed basically by the following general method: FBS in all culture media was inactivated, before use, by a treatment involving heat insulation at 56° C. for 30 minutes. P3U1 was cultured in RPMI1640-10% FBS (containing penicillin-streptomycin) and readied. The extracted mouse lymphocytic cells and P3U1 were mixed at a ratio of 10:1 to 2:1, and centrifuged. To the precipitated cells, 50% polyethylene glycol 4000 (Merck: 1.09727.0100) was slowly added with gentle mixing, and then the mixture was centrifuged. Precipitated fused cells were diluted, as appropriate, with a 15% FBS-containing HAT medium (RPMI1640, HAT-supplement (Invitrogen: 11067-030), penicillin-streptomycin), and the dilution was inoculated to a 96-well microplate in an amount of 200 μL/well. The fused cells were cultured in a CO.sub.2 incubator (5% CO.sub.2, 37° C.) and, when colonies were formed, the culture supernatant was sampled, and screened as described below.

(Example 8) Selection of Anti-MK Monoclonal Antibody Producing Cells

(88) Hybridomas producing anti-MK antibodies were selected by enzyme-linked immunosorbent assay (ELISA). The assay used the aforementioned recombinant human MK (MKver10) which had been dispensed in a 96-well ELISA plate (nunc) in an amount of 0.5 μg/mL (50 μL/well) and left to stand for 2 hours at room temperature or overnight at 40° C. for adsorption. After removal of the resulting solution, 1% BSA (Nacalai: 01863-35)-5% Sucrose (WAKO)-PBS was added in an amount of 150 μL/well, and the system was allowed to stand for 2 hours at room temperature to block the remaining active groups. After standing of the system, the resulting solution was removed, and the hybridoma culture supernatant (50 μL/well) was dispensed as a primary antibody, whereafter the system was allowed to stand for 1 hour. After the plate was washed with 0.05% Tween 20-PBS, HRP-labeled goat anti-mouse IgG (MBL: 330) diluted 1:10000 was added as a secondary antibody in an amount of 50 μL/well, and the system was allowed to stand for 1 hour at room temperature. After the plate was washed with 0.05% Tween 20-PBS, a color developing solution (5 mM sodium citrate, 0.8 mM 3,3′,5,5′-tetramethylbenzidine-2HCl, 10% N,N-dimethylformamide, 0.625% polyethylene glycol 4000, 5 mM citric acid monohydrate, 5 mM H.sub.2O.sub.2) was added in an amount of 50 μL/well, and the system was allowed to stand for 20 minutes at room temperature to develop a color. 1M phosphoric acid was added in an amount of 50 μL/well to terminate color development, and then the absorbance at 450 nm was measured using a plate reader (Thermo Fisher Scientific).

(89) The cells selected here were expansively cultured in a 15% FBS-containing HT medium (RPMI1640, HT-supplement (Invitrogen: 21060-017), Penicillin-Streptomycin), and then they were subjected to monocloning by the limiting dilution method.

(90) In the above manner, a total of 48 hybridomas producing anti-MK antibodies were obtained (5 clones with MKver10 as an immunogen, 4 clones with MKver50 as an immunogen, 31 clones with MKver60 as an immunogen, and 8 clones with MKver80 as an immunogen).

(Example 9) Reactivity of Obtained Antibodies with MK

(91) From the culture supernatant of each hybridoma clone, antibodies were purified by the general affinity purification method using Protein A-Sepharose. The reactivities of these antibodies with human MK were confirmed by enzyme-linked immunosorbent assay (ELISA) in the same manner as stated earlier. The anti-MK antibody at a maximum concentration of 5 μg/mL was serially diluted with PBS, and used as a primary antibody. As a result, it was confirmed that all the antibodies reacted concentration-dependently with the recombinant human MK (FIGS. 1 to 4).

(92) It was also confirmed by the same ELISA that the antibodies reacted with MK prepared by peptide synthesis (PEPTIDE INSTITUTE, INC.: 4298-v). Based on these findings, the resulting antibodies were confirmed to recognize MK, rather than the tag portion or linker portion of the recombinant protein. Furthermore, their reactivity with the C-terminal side purified peptide of MK (aa60-aa121) (PEPTIDE INSTITUTE, INC.: 4299-s) was also evaluated by ELISA. These assays used the full length or C-terminal side purified peptide of MK (PEPTIDE INSTITUTE, INC.: 4298-v or 4299-s) which had been dispensed in an ELISA plate (nunc) in an amount of 0.5 μg/mL or 50 μL/well and allowed to stand overnight at 4° C. for adsorption. The anti-MK antibody adjusted to 5 μg/mL with PBS was used as a primary antibody. As a result, 25 of the obtained antibodies showed comparable reactivity with the full length and the C-terminal side. Hence, they were judged to be antibodies recognizing the C-terminal site, while the other 23 antibodies were judged to be antibodies recognizing the N-terminal region of MK (FIG. 5). From left to right in the drawing, the 5 clones K40 to K98, the 4 clones FB53 to FB74, the 31 clones 5F20 to BF2-461, and the 8 clones FB29 to Fb6-13 are antibodies obtained with MKver10, ver50, ver60 and ver80 as immunogens.

(93) On the other hand, the reactivity with pleiotrophin, the only factor belonging to the same family as MK, was evaluated similarly by ELISA. For this assay, the full length purified peptide of pleiotrophin (PEPTIDE INSTITUTE, INC.: 4335-v) was used. The antibodies obtained showed no reactivity with pleiotrophin, and were thus judged to recognize MK specifically.

(Example 10) Construction of Expression Vector Expressing AP-Labeled MK

(94) Whether or not the obtained anti-MK antibodies have MK neutralizing activity was evaluated by having them inhibit MK from binding to the receptor on the cell surface (AP-MK binding inhibition assay). A recombinant protein having alkaline phosphatase (AP) fused to the N-terminal of aa23-121 of MK (AP-MK) was prepared as described below.

(95) MK cDNA amplified by PCR using primers indicated below was cleaved at the ends with XhoI and XbaI, and inserted into the XhoI-XbaI site of pAPtag-5 vector (GenHunter, QV5) to construct an expression vector. This vector was designated as MK-APtag5.

(96) TABLE-US-00005 Forward primer: 5′-CTCGAGAAAAAGAAAGATAAGGTG-3′ (SEQ ID NO: 103; the underlined portion is XhoI recognition sequence) Reverse primer: 5′-TCTAGACTAGTCCTTTCCCTTCCC-3′ (SEQ ID NO: 104; the underlined portion is XbaI recognition sequence)

(Example 11) Preparation of AP-Labeled MK and AP

(97) 2.0×10.sup.6 cells of 293T were inoculated to a 100 mm dish coated with collagen I. After a lapse of 24 hours, the culture medium was replaced by 10 ml OPTI-MEM I (GIBCO: 31985) containing 1% Insulin-Transferrin-Selenium-A (GIBCO: 51300-044) at a concentration of 1%. An Eppendorf tube was charged with 600 μL OPTI-MEM I and 15 μL FuGENE6 (Roche: 1815091), which were blended, and allowed to stand for 5 minutes at room temperature. Then, 7.5 μg of the expression vector (MK-APtag5 or pAPtag-5) was added for mixing, and the mixture was allowed to stand further for 15 minutes. The mixture was added to the culture medium of the 293T cells, and the system was cultured for 5 days at 37° C. The culture medium was recovered into protein low binding PROTEOSAVE SS (SUMITOMO BAKELITE: MS-52150), and centrifuged for 5 minutes at 1500 rpm, whereafter the supernatant was passed through a 0.22 μm filter. The activity of AP-MK or AP in the recovered solution was measured as follows:

(98) To 2 μL of the culture supernatant, 48 μL Milli-Q water and 50 μL AP assay reagent A (GenHunter: Q501) were added, and the mixture was allowed to stand for 10 minutes at 37° C. to develop a color. 0.5N NaOH was added in an amount of 100 μL to terminate color development, and 800 μL Milli-Q water was added. Then, the absorbance at 405 nm was measured using Shimadzu UV 160 Spectrophotometer. The AP activity was calculated from the measured absorbance. For this calculation, the following equation was used:
AP activity [U/ml]=(OD405×54)/(reaction time [min]×liquid amount [μl])

(Example 12) AP-MK Binding Inhibition Assay

(99) 1.0×10.sup.5 cells of TNB1 cells were inoculated to a 6-well plate coated with collagen I. After a lapse of 24 hours, the culture medium was removed, and the system was washed once with HBHA (0.5 mg/mL BSA-20 mM HEPES (pH7.8)-HBSS (GIBCO: 14175)). Then, AP-MK or AP diluted to 0.6 U/ml with OPTI-MEM was added in an amount of 1 mL/well, and the system was allowed to stand for 90 minutes at room temperature. On this occasion, the anti-MK antibody or control antibody for evaluation of the AP-MK binding inhibition activity was added in an amount of 90 μg/mL.

(100) After washing 5 times with HBHA, Cell Lysis Buffer (GenHunter: Q504) was added in an amount of 200 μL/well for cell lysis, and a cell extract was recovered. The cell extract was centrifuged (4° C., 15000 rpm, 2 min), and the supernatant separated was treated for 10 minutes at 65° C. Then, 50 μL of the treated supernatant was aliquoted, 50 μL AP assay reagent A (GenHunter: Q501) was added, and the mixture was allowed to stand for 30 minutes at 37° C. to develop a color. 0.5N NaOH (100 μL) was added to terminate color development, and 800 μL Milli-Q water was added. Then, the absorbance at 405 nm was measured using Shimadzu UV 160 Spectrophotometer. The AP activity was calculated from the measured absorbance by use of the aforementioned equation. With the AP activity in the well containing only AP-MK as 100%, the AP activities in the respective wells were expressed as relative values.

(101) Some of the results are shown in FIG. 6. Each assay was conducted for 3 wells, and the results are indicated by mean values and error bars. The AP activity was lowered to 75.5%, 29.5%, and 61.4%, respectively, in the wells containing FB53, FB54 and FB72, as compared with the wells containing AP-MK alone. No decline in the AP activity was observed in the wells containing the anti-MK antibodies other than FB53, FB54 and FB72, and the control antibody. Of the anti-MK antibodies obtained, therefore, the three antibodies FB53, FB54 and FB72 were found to have the activity of inhibiting AP-MK from binding to the receptor. As shown in FIG. 6, moreover, FB54 among these three antibodies was demonstrated to have the strongest activity of inhibiting the binding of AP-MK to the receptor.

(Example 13) Production of Cells Secreting and Expressing Mutant MKs

(102) Animal cells expressing mutant MKs (MK-W69A, -K79Q, -R81Q, -K102Q) were produced in the following manner:

(103) With MKver10-pQCxmhIPG as a template, the 5′ fragment and the 3′ fragment, respectively, were amplified by PCR using primer pairs shown below. Approximately equal amounts of the respective amplification products were mixed, and fused together by PCR using a primer pair for fusion of the 5′ fragment and the 3′ fragment. The amplified fragments were cleaved at the ends with NotI and BamHI, and inserted into the NotI-BamHI site of an expression vector for animal cells. The above-mentioned pQCxmhIPG was used as the expression vector for animal cells. The constructed vectors were designated as MK-W69A-pQCxmhIPG, MK-K79Q-pQCxmhIPG, MK-R81Q-pQCxmhIPG, and MK-K102Q-pQCxmhIPG.

(104) TABLE-US-00006 W69A For 5′ fragment: (SEQ ID NO: 105) 5′-GAGACGCCATCCACGCTGTTTTG-3′ and (SEQ ID NO: 106) 5′-CACGCACCCGCGTTCTCAAAC-3′ For 3′ fragment: (SEQ ID NO: 107) 5′-GTTTGAGAACGCGGGTGCGTG-3′ and (SEQ ID NO: 108) 5′-GAGGGGCGGATAAACTCAATGGTG-3′ K79Q For 5′ fragment: (SEQ ID NO: 105) 5′-GAGACGCCATCCACGCTGTTTTG-3′ and (SEQ ID NO: 109) 5′-CTTGGCGGACTTGGGTGCCTG-3′ For 3′ fragment: (SEQ ID NO: 110) 5′-CAGGCACCCAAGTCCGCCAAG-3′ and (SEQ ID NO: 108) 5′-GAGGGGCGGATAAACTCAATGGTG-3′ R81Q For 5′ fragment: (SEQ ID NO: 105) 5′-GAGACGCCATCCACGCTGTTTTG-3′ and (SEQ ID NO: 111) 5′-GGTGCCTTGCTGGACTTTGGTG-3′ For 3′ fragment: (SEQ ID NO: 112) 5′-CACCAAAGTCCAGCAAGGCACC-3′ and (SEQ ID NO: 108) 5′-GAGGGGCGGATAAACTCAATGGTG-3′ K102Q For 5′ fragment: (SEQ ID NO: 105) 5′-GAGACGCCATCCACGCTGTTTTG-3′ and (SEQ ID NO: 113) 5′-CAGGGCTGGGTGACGCGGATG-3′ For 3′ fragment: (SEQ ID NO: 114) 5′-CATCCGCGTCACCCAGCCCTG-3′ and (SEQ ID NO: 108) 5′-GAGGGGCGGATAAACTCAATGGTG-3′ Fusion between 5′ fragment and 3′ fragment (SEQ ID NO: 105) 5′-GAGACGCCATCCACGCTGTTTTG-3′ and (SEQ ID NO: 108) 5′-GAGGGGCGGATAAACTCAATGGTG-3′

(105) Using the underlined nucleotides, amino acids were substituted. Moreover, 5′-GAGACGCCATCCACGCTGTTTTG-3′ (SEQ ID NO: 105) and 5′-GAGGGGCGGATAAACTCAATGGTG-3′ (SEQ ID NO: 108) are sequences corresponding to the outside of the MK coding region of the expression vector.

(106) Using the so constructed expression vectors, cell lines secreting and expressing mutant MK were established by the same method as the above method (MK-W69A/st293T, MK-K79Q/st293T, MK-R81Q/st293T, MK-K102Q/st293T).

(Example 14) Preparation of Mutant MK Purified Proteins

(107) The established expression cell lines were each cultured with 500 mL CD293 (Invitrogen). The culture supernatant was recovered, and mutant MK recombinant proteins (MK-W69A, MK-K79Q, MK-R81Q, MK-K102Q) were purified by the same method as described above.

(Example 15) Reactivities of Obtained Antibodies with Mutant MKs

(108) The reactivities of the resulting antibodies with the mutant MKs were confirmed by the same enzyme-linked immunosorbent assay (ELISA) as described above. The assays used plates having wild type human MK (MKver10) or the above-mentioned mutant MK (MK-W69A, MK-K79Q, MK-R81Q and MK-K102Q) adsorbed thereto. The anti-MK antibody at a maximum concentration of 5 μg/mL was serially diluted with PBS, and used as a primary antibody. As examples of the antibodies recognizing the N-terminal side or the C-terminal side of midkine, but showing no neutralizing activity, BF106 and FB74 were also evaluated similarly.

(109) Some of the results are shown in FIG. 7. The three antibodies showing neutralizing activity, FB53, FB54 and FB72, had lower reactivity with the mutant MK than reactivity with the wild type MK. The other anti-MK antibodies showing no neutralizing activity reacted with the mutant MK as with the wild type MK.

(Example 16) Isolation of Heavy Chain and Light Chain Variable Region Genes of FB54 Antibody and Identification of their CDRs

(110) The hybridoma was cultured, and its total RNA was extracted by a general method. Then, cDNA was obtained by the 5′-RACE method using GeneRacer Kit (Invitrogen). With this cDNA as a template, PCR (35 cycles, each cycle comprising [94° C. 30 seconds, 57° C. 30 seconds, 72° C. 50 seconds]) was performed with Platinum Taq High Fidelity (Invitrogen) using GeneRacer 5′ Primer (5′-CGACTGGAGCACGAGGACACTGA-3′ (SEQ ID NO: 115)) and CH1 (mouse IgG1 constant region 1) 3′ Primer (5′-AATTTTCTTGTCCACCTGG-3′ (SEQ ID NO: 116)) to amplify the gene of the antibody heavy chain variable region (cDNA). In connection with the antibody light chain, on the other hand, PCR was performed in the same manner using GeneRacer 5′ Primer and Ck (κconstant region) 3′ Primer (5′-CTAACACTCATTCCTGTTGAAGCTCT-3 (SEQ ID NO: 117)) to amplify the gene (cDNA). The amplified gene fragments of the heavy chain variable region and the light chain variable region were each cloned into pT7Blue T-Vector (Novagen). The resulting clones were analyzed for sequence by means of an autosequencer (Applied Biosystems). As a result, amino acids encoded by the resulting nucleotide sequences, and the sequences of the respective CDRs were determined. The results are as follows:

(111) TABLE-US-00007 <FB54 heavy chain variable region> (SEQ ID NO: 8) EVMLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVAT ISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYFCARHN YRYDEYYYAMDYWGQGTSVTVSS CDR1 of FB54 heavy chain variable region (SEQ ID NO: 4) SYAMS CDR2 of FB54 heavy chain variable region (SEQ ID NO: 5) TISSGGSYTYYPDSVKG CDR3 of FB54 heavy chain variable region (SEQ ID NO: 6) HNYRYDEYYYAMDY <FB54 light chain variable region> (SEQ ID NO: 7) ETTVTQSPTSLSMAIGEKVTIRCITSTDIDDEMNWYQQKPGEPPKLLISE GNTLRPGVPSRFSSSGYGTDFVFTIENMLSEDVADYYCLQSDNLPYTFGG GTKLEIK CDR1 of FB54 light chain variable region (SEQ ID NO: 1) ITSTDIDDEMN CDR2 of FB54 light chain variable region (SEQ ID NO: 2) EGNTLRP CDR3 of FB54 light chain variable region (SEQ ID NO: 3) LQSDNLPYT

(Example 17) Preparation of FB54 Chimerized Antibodies

(112) Based on the determined gene sequences, primers for PCR amplification to be shown below were designed, and antibody variable regions were amplified by 2 rounds of PCR. On this occasion, the secretion signal sequences were converted into sequences recommended by Lonza, and restriction enzyme recognition sequences were added to the ends of the amplified fragments (HindIII recognition sequence and BamHI recognition sequence were added for the heavy chain variable region, while HindIII and BsiWI recognition sequences were added for the light chain variable region).

(113) TABLE-US-00008 1.sup.st PCR for heavy chain HC-signal-l: 5′-GTTCTTTCTGTCCGTGACCACAGGCGTGCATTCTGAAGTGATGCTGG TGGAGTCTGG-3′ (SEQ ID NO: 118) HC-reverse: 5′-atataCTCGAGACGGTGACTGAGG-3′ (SEQ ID NO: 119; the underlined portion is BamHI recognition sequence) 2.sup.nd PCR for heavy chain HC-signal-2: 5′-atataAAGCTTACCATGGAATGGAGCTGGGTGTTCCTGTTCTTTCTG TCCGTGACCACAGGCGTGC-3′ (SEQ ID NO: 120; the under- lined portion is HindIII recognition sequence) HC-reverse: 5′-atataCTCGAGACGGTGACTGAGG-3′ (SEQ ID NO: 119; the underlined port ion is BamHI recognition sequence) 1.sup.st PCR for light chain LC-signal-1: 5′-GGGACTGCTGCTGCTGTGGCTGACAGACGCCCGCTGTGAAACAACTG TGACCCAGTCTCC-3′ (SEQ ID NO: 121) LC-reverse: 5′-atataCGTACGTTTGATTTCCAGCTTGGTGCC-3′ (SEQ ID NO: 122; the underlined portion is BsiWI recognition sequence) 2.sup.nd PCR for light chain LC-signal-2: 5′-atataAAGCTTACCATGTCTGTGCCTACCCAGGTGCTGGGACTGCTG CTGCTGTGGCTGACAGACGCC-3′ (SEQ ID NO: 123; the underlined portion is HindIII recognition sequence) LC-reverse: 5′-atataCGTACGTTTGATTTCCAGCTTGGTGCC-3′ (SEQ ID NO: 122; the underlined portion is BsiWI recognition sequence).

(114) The resulting PCR products were cleaved with the above restriction enzymes, and the cleaved products were inserted by the customary method into Lonza's human IgG1 antibody-producing vectors incorporating the constant region of human IgG1 (FB54-chH and FB54-chK). Based on a protocol recommended by Lonza, a chimeric antibody producing cell line was established. From its culture supernatant, a chimerized FB54 antibody was purified using Protein A. Hereinbelow, this antibody will be described as chFB54.

(Example 18) Evaluation of Reactivity of FB54 Chimerized Antibody

(115) The reactivity of chFB54 with human MK was confirmed by enzyme-linked immunosorbent assay (ELISA). The assay was performed in the same manner as described above. The chFB54 or mouse FB54 antibody as a control, at a maximum concentration of 5 μg/mL, was serially diluted with PBS, and used as a primary antibody. HRP-labeled goat anti-human IgG (MBL: 206) or HRP-labeled goat anti-mouse IgG (MBL: 330) was used as a secondary antibody. As a result, chFB54 showed binding activity comparable to that of the original mouse antibody FB54 (FIG. 8)

(Example 19) Preparation of FB54 Humanized Antibodies

(116) In accordance with the CDR-grafting method, human frameworks (hereinafter, FR1 to FR4 regions; collectively called FR regions) were selected, and substituted with CDRs of the mouse monoclonal antibody FB54. Concretely, a homology search was conducted in connection with the heavy chain FR regions versus the light chain FR regions, and the FB54 heavy chain was found to be highly homologous to the FR regions of Accession Number AF471493 of the human antibody. The homology of the FR regions was 73/87=83.9%. A humanized antibody heavy chain variable region was designed so that CDR1 to CDR3 of the FB54 heavy chain would be transplanted appropriately into the FR regions of AF471493. The corresponding humanized antibody heavy chain will be expressed as FB54-rHa. Similarly, the FB54 antibody light chain was found to be highly homologous to the FR regions of Accession Number X70463 of the human antibody. The homology of the FR regions was 55/80=68.8%. A humanized antibody light chain variable region was designed so that CDR1 to CDR3 of the FB54 light chain would be transplanted appropriately into the FR regions of X70463. The corresponding humanized antibody light chain will be expressed as FB54-rKa.

(117) In connection with the light chain, there were further designed a light chain in which the VCI site of the FR region was converted into the amino acids used in the mouse germ line and, in addition, a light chain in which the amino acids at a distance of within 5 Å from the CDR were converted into the amino acids used in the mouse germ line. These light chains will sometimes be referred to hereinafter as FB54-rKb and FB54-rKc.

(118) TABLE-US-00009 <AF471493> (SEQ ID NO: 124) EVQLVESGGGLVKPGGYLRLSCAASGFTFSLHSMSWVRQAPGKGLDWVAY ITGSSNTIYYGDSVKGRFTISRDNAKNSLYLQMNSLTDDDTAVYFCARGP ISAANTFDLWGQGTLVTVSS FR1 of AF471493 (SEQ ID NO: 125) EVQLVESGGGLVKPGGYLRLSCAASGFTFS FR2 of AF471493 (SEQ ID NO: 126) WVRQAPGKGLDWVA FR3 of AF471493 (SEQ ID NO: 127) RFTISRDNAKNSLYLQMNSLTDDDTAVYFCAR FR4 of AF471493 (SEQ ID NO: 128) WGQGTLVTVSS <FB54-rHa (humanized antibody heavy chain variable region a version)> (SEQ ID NO: 12) EVQLVESGGGLVKPGGYLRLSCAASGFTFSSYAMSWVRQAPGKGLDWVAT ISSGGSYTYYPDSVKGRFTISRDNAKNSLYLQMNSLTDDDTAVYFCARHN YRYDEYYYAMDYWGQGTLVTVSS <X70463> (SEQ ID NO: 129) DIQMTQSPSSLSASVGDRVTITCRASQSIGSFLHWYQQKPGKGPKLLISA ASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSFSTLYTFGQ GTKLEIK FR1 of X70463 (SEQ ID NO: 130) DIQMTQSPSSLSASVGDRVTITC FR2 of X70463 (SEQ ID NO: 131) WYQQKPGKGPKLLIS FR3 of X70463 (SEQ ID NO: 132) GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC FR4 of X70463 (SEQ ID NO: 133) FGQGTKLEIK <FB54-rKa (humanized antibody light chain variable region a version)> (SEQ ID NO: 9) DIQMTQSPSSLSASVGDRVTITCITSTDIDDEMNWYQQKPGKGPKLLISE GNTLRPGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQSDNLPYTFGQ GTKLEIK <FB54-rKb (humanized antibody light chain variable region b version)> (SEQ ID NO: 10) DTQVTQSPSSLSASVGDRVTITCITSTDIDDEMNWYQQKPGKGPKLLISE GNTLRPGVPSRFSSSGSGTDFTLTISSLQPEDFATYYCLQSDNLPYTFGQ GTKLEIK <FB54-rKc (humanized antibody light chain variable region c version)> (SEQ ID NO: 11) ETTVTQSPSSLSASVGDRVTIRCITSTDIDDEMNWYQQKPGKGPKLLISE GNTLRPGVPSRFSSSGYGTDFTLTISSLQPEDFATYYCLQSDNLPYTFGQ GTKLEIK

(119) The heavy chain and light chain variable region genes of the humanized antibody were prepared by oligo DNA synthesis. On this occasion, the secretion signal sequences were converted into the sequences recommended by Lonza, and restriction enzyme recognition sequences were added to the ends of the chains (HindIII and BamHI recognition sequences were added for the heavy chain, while HindIII and BsiWI recognition sequences were added for the light chain). After cleavage with the restriction enzymes, the cleaved genes were transduced, respectively, into pEE6.4 vector (Lonza) into which human IgG1 constant region had been cloned, and into pEE14.4 vector (Lonza) into which human κ chain constant region had been cloned.

(120) The constructed heavy chain and light chain expression vectors were cotransfected, in combinations of FB54-rHa and FB54-rKa, FB54-rHa and FB54-rKb and FB54-rHa and FB54-rKc, into 293T cells by the customary method using Lipofectamine 2000 (Invitrogen). As controls, the expression vectors (FB54-chH and FB54-chK) for the chimeric antibody prepared above were also transfected.

(121) At 48 hours after gene transfection, the culture supernatants were recovered, and their IgG concentrations were calculated from a calibration curve for commercially available purified human IgG (Cappel) by Sandwich ELISA using goat anti-human IgG antibody, Fcγ fragment-specific (Stratech Scientific) and goat anti-human kappa light chain peroxidase conjugate (Sigma).

(122) Using these culture supernatants, reactivities with human MK were confirmed by enzyme-linked immunosorbent assay (ELISA). The assays were performed in the same manner as described above. The above culture supernatant was adjusted to a human IgG concentration of 10 μg/mL, and used as a primary antibody. HRP-labeled goat anti-human IgG (MBL: 206) was used as a secondary antibody. As a result, the chimeric antibody (FB54-chH/FB54-chK) and the humanized antibody (FB54-rHa/FB54-rKc) were confirmed to have comparable activity. Thus, success was achieved in designing the humanized FB54 antibodies (FIG. 9). Hereinbelow, the humanized antibody (FB54-rHa/FB54-rKc) will also be described as hFB54.

(Example 20) Evaluation of Reactivity of FB54 Humanized Antibody

(123) Next, the expression vectors for FB54-rHa and FB54-rKc were joined together based on Lonza's protocol, and the joined product was transfected into CHOK1SV cells. A CHOK1SV monoclonal cell line highly expressing hFB54 was established, and an antibody was purified from its culture supernatant with the use of Protein A.

(124) The reactivity of the resulting humanized antibody with human MK was confirmed by enzyme-linked immunosorbent assay (ELISA). The assay was performed in the same manner as described above. The hFB54 or chFB54 antibody as a control, at a maximum concentration of 5 μg/mL, was serially diluted with PBS, and used as a primary antibody. HRP-labeled goat anti-human IgG (MBL: 206) was used as a secondary antibody. As a result, hFB54 showed binding activity comparable to that of chFB54 (FIG. 10).

(Example 21) Evaluation of Antitumor Activity Using Mouse Xenograft

(125) The antitumor activity of hFB54 was evaluated using a mouse xenograft. The human neuroblastoma cell line TNB1 (Riken BRC: RCB0481) was exfoliated with a solution of collagenase Type I (GIBCO: 17100-017) added in an amount of 2 mg/mL to Cell Dissociation Buffer enzyme free PBS-based (Invitrogen: 13151-014). After washing, the system was suspended in RPMI1640 medium (GIBCO) to a cell count of 5×10.sup.7 cells/mL. An equal amount of Matrigel (BD: 354230) was added, and the mixture was suspended. Then, the suspension was subcutaneously transplanted to the right ventral part of 6-week-old female nude mice (Japan SLC: BALB/cSIc-nu/nu) in an amount of 200 μL each. From the same day onwards, 300 μL of a solution of the antibody diluted with 0.05% Tween 20-PBS to a concentration of 1 mg/mL, or 300 μL of 0.05% Tween 20-PBS, was intraperitoneally administered (8 mice/group). The antibody solution or the control was administered a total of 7 times, i.e., on the day of transplantation and twice weekly from Day 8. The diameter of a tumor was measured with a vernier caliper, beginning at a time when the tumor was observed. The tumor volume was calculated from the following equation:
Tumor volume (mm.sup.3)=major diameter×minor diameter.sup.2×0.5

(126) The results are shown in FIG. 11. The tumor volumes in the hFB54-administered group were 54% at 29 days, 51% at 33 days, 50% at 36 days, and 54% at 41 days, compared with the corresponding tumor volumes in the control group. As these findings demonstrate, the anti-MK antibody hFB54 inhibited enlargement of the tumor significantly (P<0.05). In regard to the survival rate, all the animals were dead at about 90 days in the control group. In the hFB54 treatment group, by contrast, as many as 30% of the animals were alive even after 100 days, thus confirming the life-prolonging effect of the antibody. Hence, it has become clear that the anti-MK antibody hFB54 has an antitumor effect in initial cancer models.

(Example 22) FB54 In Vitro Affinity Maturation (Affinity Improvement)

(127) (1) Transformation of IgG Antibodies into Fab Antibodies

(128) With IgG antibody expression vectors for hFB54 and mFB54 as templates, the variable regions of the heavy chain and the light chain were amplified by PCR. The amplification products were cloned into Fab type antibody expression phagemid vectors. The reactivities of the Fab antibodies with MK were confirmed by enzyme-linked immunosorbent assay (ELISA).

(129) (2) Preparation of Fab Antibodies Having Random Mutations Introduced into Antibody Variable Regions (Mutation-Introduced Library)

(130) Mutations were introduced into the variable regions of the heavy chain and the light chain by error-prone PCR, and these mutated regions were cloned into Fab type antibody expression phagemid vectors in the same manner as above. As a result, a mutation-introduced Fab antibody phase library having various mutations introduced only into the antibody variable regions was prepared.

(131) (3) Enrichment (Panning) of Clones with Improved Affinity

(132) (i) The antigen (MKver10 for hFB54, mMK for mFB54) was immobilized to ImmunoTube (nunc) tubes.

(133) (ii) The mutation-introduced Fab antibody phage library was added, and bound to the antigen.

(134) (iii) After a washing operation, the antibody phages bound to the antigen were recovered, and transferred to E. coli for infection (50 ml culture solution, shake culture for 1 hr at 37° C.).

(135) (iv) E. coli holding phagemids was selected using a medication. (A solution from (iii) was added to 600 ml of a culture solution containing 100 μg/ml of ampicillin, and the mixture was shake cultured for 16 hours at 30° C.).

(136) (v) A helper phage was allowed to infect, producing antibody phages.

(137) (vi) The antibody phages were separated and concentrated.

(138) (vii) Using the separated and concentrated antibody phage library, the steps (i) to (vi) were repeated a total of 3 times. The conditions for the hFB54 panning and the mFB54 panning are shown in Tables 1 and 2, respectively.

(139) TABLE-US-00010 TABLE 1 Number of Amount of Antigen antibody reaction Reaction (MKver10) phages liquor time Washing 1st 2.0 3 × 10.sup.13 4 [ml] 5 [days] 3 times .fwdarw. [nmole] 2 [days] .fwdarw. 3 times 2nd 0.2 3 × 10.sup.13 4 [ml] 5 [days] 3 times .fwdarw. [nmole] 7 [days] .fwdarw. 3 times 3rd 0.2 3 × 10.sup.13 4 [ml] 5 [days] 3 times .fwdarw. [nmole] 7 [days] .fwdarw. 3 times

(140) TABLE-US-00011 TABLE 2 Number of Amount of Antigen antibody reaction Reaction (mMK) phages liquor time Washing 1st 2.0 3 × 10.sup.13 4 [ml] 6 [days] 3 times [nmole] 2nd 0.2 3 × 10.sup.13 4 [ml] 6 [days] 3 times .fwdarw. [nmole] 6 [days] .fwdarw. 3 times 3rd 0.2 3 × 10.sup.13 4 [ml] 6 [days] 3 times .fwdarw. [nmole] 7 [days] .fwdarw. 3 times

(141) (4) Evaluation of Affinity of Affinity-Improved Clones (ELISA Using E. coli Culture Supernatants)

(142) From the libraries (hFB54: 3.75×10.sup.7 clones, mFB54: 1.75×10.sup.7 clones) after panning repeated 3 times, 94 clones of Fab antibody phage-infected E. coli were isolated, respectively. The reactivities of the Fab antibodies, secreted by these E. coli clones into the culture broth, with MK were confirmed by enzyme-linked immunosorbent assay (ELISA).

(143) For the assays, recombinant human MK (MKver10) or mouse MK (mMK) was dispensed, in an amount of 5 μg/mL or 100 μL/well, into a 96-well ELISA plate (nunc), and the system was allowed to stand overnight at 4° C. for adsorption before the system was used. After the resulting solution was removed, 1% BSA-5% sucrose-0.05% NaN3-PBS was added in an amount of 200 μL/well, and the system was allowed to stand overnight at 4° C. to block the remaining active groups. After the resulting solution was removed, the E. coli culture supernatant was dispensed in an amount of 100 μL/well as a primary antibody into the plate, and system was allowed to stand for 2 hours at 37° C. After the plate was washed with PBS, a 1:2000 diluted rabbit anti-cp3 antibody (MBL) as a secondary antibody was added in an amount of 100 μL/well, and the plate was allowed to stand for 1 hour at 37° C. After the plate was washed with PBS, a 1:2500 diluted HRP-labeled goat anti-rabbit antibody (MBL: 458) as a tertiary antibody was added in an amount of 100 μL/well, and the plate was allowed to stand for 1 hour at 37° C. After the plate was washed with PBS, an OPD development solution was added to develop a color, and the absorbance at 492 nm was measured with a plate reader.

(144) As a result, stronger reactivity than that of the original Fab-converted antibody was confirmed in a plurality of the clones. From the clones derived from hFB54, 9 clones with high absorbances (hFB54-matu014, 020, 024, 034, 039, 054, 062, 072, 086) were selected. Similarly, 4 clones with high absorbances (mFB54-matu002, 024, 025, 089) were selected from the mFB54-derived clones (FIGS. 12 to 15).

(145) (5) Affinity Evaluation of Affinity-Improved Clones (ELISA Using Purified Fab Antibodies)

(146) The Fab antibodies of the total 13 clones selected in the preceding step (9 clones derived from hFB54, 4 clones derived from mFB54) and the original antibodies (hFB54, mFB54) were purified. Then, the reactivities of these Fab antibodies with MK were evaluated by enzyme-linked immunosorbent assay (ELISA). The assays were performed in the same manner as described above. For a solid phase of the antigen, the antigen was adjusted to 2 μg/mL and used. The Fab antibody, at a maximum concentration of 5 μg/mL, was serially diluted with PBS, and used.

(147) As a result, of the hFB54-derived nine clones, 7 clones were confirmed to be improved in reactivity with MKver10 (FIG. 16). In connection with the mFB54-derived four clones, 2 clones were confirmed to be improved in reactivity with mMK (FIG. 17).

(148) The above findings showed that success was achieved in obtaining 7 clones of the Fab antibody with improved reactivity with human MK based on the Fab-converted antibody of humanized FB54, and 2 clones of the Fab antibody with improved reactivity with mouse MK based on the Fab-converted antibody of mouse FB54.

(149) (6) Sequence Analysis of Affinity-Improved Clones

(150) The sequences of the variable regions of the antibody heavy chain and light chain of the total 9 clones selected in the preceding item were analyzed using an autosequencer. The results are shown in FIG. 18 and below. In FIG. 18, the same amino acid residues as those in the original antibody were indicated by “-”, whereas different residues were indicated by the substituting amino acids. The surrounding lines represent the CDR regions.

(151) As clear from the results shown in FIG. 18, confirmation of the sequences of the CDRs in the 9 clones showed that in all the clones, the 4-position amino acid of the CDR1 of the light chain variable region was isoleucine. It was suggested, therefore, that the substitution of the amino acid at this site by isoleucine was important for the improvement of affinity and so on.

(152) TABLE-US-00012 <matu002 heavy chain variable region> (SEQ ID NO: 20) EVMLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQTPEKRLEWVAT ISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYFCARHN YRYDEYYYAMDYWGQGTSVTVSS CDR1 of matu002 heavy chain variable region (SEQ ID NO: 16) SYAMS CDR2 of matu002 heavy chain variable region (SEQ ID NO: 17) TISSGGSYTYYPDSVKG CDR3 of matu002 heavy chain variable region (SEQ ID NO: 18) HNYRYDEYYYAMDY <matu002 light chain variable region> (SEQ ID NO: 19) ETTVTQSPTSLSMAIGEKVTIRCTTSIDIDDEMNWYQQMPGEPPKLLISE GNTLRPGVPSRFSSSGYGTDFVFTIENMLSEDVADYYCLQSDNLPYTFGG GTKLEIK CDR1 of matu002 light chain variable region (SEQ ID NO: 13) TTSIDIDDEMN CDR2 of matu002 light chain variable region (SEQ ID NO: 14) EGNTLRP CDR3 of matu002 light chain variable region (SEQ ID NO: 15) LQSDNLPYT <matu089 heavy chain variable region> (SEQ ID NO: 28) EVMLVESGGGLVEPGGSLKLSCTVSGFTFSSYAMSWVRQTPEKRLEWVAT ISSGGSYTYYPDSVKGRFTISRDNAKNTLYLQMSSLRSEDTAMYFCARHN YRYDEYYYAMDYWGHGTSVTVSS CDR1 of matu089 heavy chain variable region (SEQ ID NO: 24) SYAMS CDR2 of matu089 heavy chain variable region (SEQ ID NO: 25) TISSGGSYTYYPDSVKG CDR3 of matu089 heavy chain variable region (SEQ ID NO: 26) HNYRYDEYYYAMDY <matu089 light chain variable region> (SEQ ID NO: 27) ETTVTQSPTSLSMAIGEKVTIRCITSIDIDDEMNWYQQKPGEPPKLLISE GNTLRPGVPSRFSSSGYGTDFVFTIENVLSEDVADYYCLQSDNLPYTFGG GTKLEIK CDR1 of matu089 light chain variable region (SEQ ID NO: 21) ITSIDIDDEMN CDR2 of matu089 light chain variable region (SEQ ID NO: 22) EGNTLRP CDR3 of matu089 light chain variable region (SEQ ID NO: 23) LQSDNLPYT <matu014 heavy chain variable region> (SEQ ID NO: 36) EVQLVESGGGLVKPGGYLRLSCAASGFTFSSYAMSWVRQTPGKGLDWVAT ISSGGSYTYYPDSVKGRFTISRDNVKNSLYLQMNSLTDDDTAVYFCARHN YRYDEYYYAMDYWGQGTLVTVSS CDR1 of matu014 heavy chain variable region (SEQ ID NO: 32) SYAMS  CDR2 of matu014 heavy chain variable region (SSEQ ID NO: 33) TISSGGSYTYYPDSVKG  CDR3 of matu014 heavy chain variable region (SEQ ID NO: 34) HNYRYDEYYYAMDY  <matu014 light chain variable region> (SSEQ ID NO: 35) ETTVTQSPSSLSASVGDRVTIRCITNIDIDDEMNWYQQKPGKGPKLLISE GNTLRPGVPSRFSSSGYGTDFTLTISSLQPEDFATYYCLQSDNLPYTFGR GTKLEIK CDR1 of matu014 light chain variable region (SEQ ID NO: 29) ITNIDIDDEMN  CDR2 of matu014 light chain variable region (SEQ ID NO: 30) EGNTLRP  CDR3 of matu014 light chain variable region (SEQ ID NO: 31) LQSDNLPYT  <matu020 heavy chain variable region> (SEQ ID NO: 44) EVQLVESGGGLVKPGGYQRLSCAASGFTFSSYAMSWVRQAPGKGLDWVAT ISSGGSYTYYPDSVKGRFTISRDNAKNSLYLQMNNLTDDDTAVYFCARHN YRYDEYYHAMDYWGQGTLVTVSS  CDR1 of matu020 heavy chain variable region (SEQ ID NO: 40) SYAMS  CDR2 of matu020 heavy chain variable region (SEQ ID NO: 41) TISSGGSYTYYPDSVKG  CDR3 of matu020 heavy chain variable region (SEQ ID NO: 42) HNYRYDEYYHAMDY <matu020 light chain variable region> (SEQ ID NO: 43) ETTVTQSPSSLSASVGDRVTIRCITSIDIDDEMNWYQQKPGKGPKLLISE GNTLRPGVPSRFSSSGYGTDFTLTISSLQPEDFATYYCLQSDNLPYTFGQ GTKLEIK CDR1 of matu020 light chain variable region (SEQ ID NO: 37) ITSIDIDDEMN  CDR2 of matu020 light chain variable region (SEQ ID NO: 38) EGNTLRP  CDR3 of matu020 light chain variable region (SEQ ID NO: 39) LQSDNLPYT  <matu024 heavy chain variable region> (SEQ ID NO: 52) EVQLVESGGGLVKPGGYLRLSCAASGFTFSSYAMSWVRQAPGKGLDWVAT ISSGGSYTYYPDSVKGRFTISRDNAKNSLYLQMNSLTDDDTAVYFCARHN YRYGEYYYAMDYWGQGTLVTVSS CDR1 of matu024 heavy chain variable region (SEQ ID NO: 48) SYAMS  CDR2 of matu024 heavy chain variable region (SEQ ID NO: 49) TISSGGSYTYYPDSVKG CDR3 of matu024 heavy chain variable region (SEQ ID NO: 50) HNYRYGEYYYAMDY <matu024 light chain variable region> (SEQ ID NO: 51) ETTVTQSPSSLSASVGDRVTIRCITSIDIDDEMNWYQQKSGKGPKLLISE GNTLRPGVPSRFSSSGYGTDFTLTISSLQPEDFATYYCLQSDNLPYTFGQ GTKLEIK CDR1 of matu024 light chain variable region (SEQ ID NO: 45) ITSIDIDDEMN  CDR2 of matu024 light chain variable region (SEQ ID NO: 46) EGNTLRP  CDR3 of matu024 light chain variable region (SEQ ID NO: 47) LQSDNLPYT  <matu039 heavy chain variable region> (SEQ ID NO: 60) EVRLVESGGGLVKPGGYLRLSCAASGFTFSSYAMSWVRQAPGKGLDWVAT ISSGGSYTYYPDSVKERFTISRDNAKNSLYLQMNSLTDDDTAVYFCARHN YRYDEYYYGMDYWGQGTLVTVSS  CDR1 of matu039 heavy chain variable region (SEQ ID NO: 56) SYAMS  CDR2 of matu039 heavy chain variable region (SEQ ID NO: 57) TISSGGSYTYYPDSVKE  CDR3 of matu039 heavy chain variable region (SEQ ID NO: 58) HNYRYDEYYYGMDY  <matu039 light chain variable region> (SEQ ID NO: 59) ETTVTQSPSSLSASVGDRVTIRCKTSIDIDDEMNWYQQKPGKGPKLLISE GNTLRPGVPSRFSSSGYGTDFTLTISSLQPEDFATYYCLQSDNLPYTFGQ GTKLGIK CDR1 of matu039 light chain variable region (SEQ ID NO: 53) KTSIDIDDEMN  CDR2 of matu039 light chain variable region (SEQ ID NO: 54) EGNTLRP  CDR3 of matu039 light chain variable region (SEQ ID NO: 55) LQSDNLPYT  <matu054 heavy chain variable region> (SEQ ID NO: 68) EVQLVESGGGLVKPGGYLRLSCAASGFTFSSYAMSWVRQAPGKGLDWVAT ISSGGSYTYYPDSVKGRFTISRDNTKNTLYLQMNSLTDDDTAVYFCARHN YRYDEYYYAMDYWGQGTLVTVSS CDR1 of matu054 heavy chain variable region (SEQ ID NO: 64) SYAMS CDR2 of matu054 heavy chain variable region (SEQ ID NO: 65) TISSGGSYTYYPDSVKG CDR3 of matu054 heavy chain variable region (SEQ ID NO: 66) HNYRYDEYYYAMDY <matu054 light chain variable region> (SSEQ ID NO: 67) ETTVTQSPSSLSASVGDRVTIRCITSIDIEDEMNWYQQKPGKGPKLLISE GNTLRPGVPSRFSSSGYGTDFTLTISSLQPEDFATYYCLQSDNLPYTFGQ GTKLEIK CDR1 of matu054 light chain variable region (SEQ ID NO: 61) ITSIDIEDEMN CDR2 of matu054 light chain variable region (SEQ ID NO: 62) EGNTLRP CDR3 of matu054 light chain variable region (SEQ ID NO: 63) LQSDNLPYT <matu062 heavy chain variable region> (SEQ ID NO: 76) EVQLVESGGGLVKPGGYLRLSCAASGFTFSSYAMSWVRQAPGKGLDWVAT ISSGGSYTYYPDSVKGRFTISRDNAENTLYLQMNSLTNDDTAVYFCARHN YRYDEYYYAMDYWGQGTLVTVSS CDR1 of matu062 heavy chain variable region (SEQ ID NO: 72) SYAMS CDR2 of matu062 heavy chain variable region (SEQ ID NO: 73) TISSGGSYTYYPDSVKG  CDR3 of matu062 heavy chain variable region (SEQ ID NO: 74) HNYRYDEYYYAMDY  <matu062 light chain variable region> (SEQ ID NO: 75) ETTVTQSPSSLSAFVGGRVAIRCITNIDIDDEMNWYQQKPGKGPKLLISE GNTLRPGVPSRFSSSGYGTDFTLTISSLQPEDFATYYCMQSDNLPYTFGQ GTKLEIK CDR1 of matu062 light chain variable region (SEQ ID NO: 69) ITNIDIDDEMN  CDR2 of matu062 light chain variable region (SEQ ID NO: 70) EGNTLRP  CDR3 of matu062 light chain variable region (SEQ ID NO: 71) MQSDNLPYT  <matu072 heavy chain variable region> (SEQ ID NO: 84) EVQLVESGGGLVKPGGYLRLSCAASGFTFSSYAMSWVRQAPGKGLDWVAT ISSGGSYTYYPDNVKGRFTISRDNAKNSLYLQMNSLTDDDTAVYFCARHN YRYDEYYHAMDYWGQGTLVTVSS  CDR1 of matu072 heavy chain variable region (SEQ ID NO: 80) SYAMS  CDR2 of matu072 heavy chain variable region (SEQ ID NO: 81) TISSGGSYTYYPDNVKG  CDR3 of matu072 heavy chain variable region (SEQ ID NO: 82) HNYRYDEYYHAMDY  <matu072 light chain variable region> (SEQ ID NO: 83) ETTVTQSPSSLFASVGDKVTIRCITSIDIDDEMNWYQQKPGKGPKLLISE GNTLRPGVPSRFSSSGYGTDFTLTISSLQPEDFATYYCLQSDNLPYTFGQ GTKLEIK CDR1 of matu072 light chain variable region (SEQ ID NO: 77) ITSIDIDDEMN CDR2 of matu072 light chain variable region (SEQ ID NO: 78) EGNTLRP CDR3 of matu072 light chain variable region (SEQ ID NO: 79) LQSDNLPYT

(153) (7) Conversion of Fab Antibodies into IgG Antibodies

(154) The affinity-improved antibodies (Fab) of the aforementioned total 9 clones were converted into human IgG1 or mouse IgG1 in the following manner:

(155) With Fab antibody expression vectors as templates, the heavy chain and light chain variable regions of the antibodies were amplified by PCR using primers to be described below. For both of the heavy chain and the light chain, the signal peptide portion and the variable region portion were separately amplified. Then, the amplification products were mixed, and coupled by PCR.

(156) Like the preparation of the aforementioned chimeric antibodies and humanized antibodies, the coupled products were cleaved with restriction enzymes, and the cleaved products were introduced, respectively, into pEE6.4 vector (Lonza) into which the human IgG1 or mouse IgG1 constant region had been cloned, and pEE14.4 vector (Lonza) into which the human κ chain or mouse κ chain constant region had been cloned.

(157) The expression vectors for the heavy chain and the light chain were bound and introduced into CHOK1SV cells based on Lonza's protocol. CHOK1SV monoclonal cell lines for increased production of the desired antibodies were established, and antibodies were purified from their culture supernatants by use of Protein A.

(158) hFB54-matu014, 020, 024, 054, 062, 072 heavy chain signal peptide portion

(159) TABLE-US-00013 VH_signal_F_HindIII: 5′-atataAAGCTTACCATGGAATGGAGCTGGG-3′ (SEQ ID NO: 134; the underlined portion is HindIll recognition sequence) hFB54VH_signal_R: 5′-CCAGCTGCACCTCAGAATGCACGCCTGTGGTC-3′ (SEQ ID NO: 135)

(160) hFB54-matu039 heavy chain signal peptide portion

(161) TABLE-US-00014 VH_signal_F_HindIII: 5′-atataAAGCTTACCATGGAATGGAGCTGGG-3′ (SEQ ID NO: 134; the underlined portion is HindIII recognition sequence) hFB54VH039_signal_R: 5′-CCAGCcGCACCTCAGAATGCACGCCTGTGGTC-3′ (SEQ ID NO: 136)

(162) mFB54-matu002, 089 heavy chain signal peptide portion

(163) TABLE-US-00015 VH_signal_F_HindIII: 5′-atataAAGCTTACCATGGAATGGAGCTGGG-3′ (SEQ ID NO: 134; the underlined portion is HindIII recognition sequence) mFB54VH_signal_R: 5′-CCAGCATCACTTCAGAATGCACGCCTGTG GTC-3′ (SEQ ID NO: 137)

(164) hFB54-matu014, 020, 024, 054, 062, 072 heavy chain variable region portion

(165) TABLE-US-00016 hFB54VH_F: 5′-CGTGCATTCTGAGGTGCAGCTGGTGGAGTCG-3′ (SEQ ID NO: 138) hFB54VH_R_XhoI: 5′-atataCTCGAGACGGTGACCAGGG-3′ (SEQ ID NO: 139; the underlined portion is XhoI recognition sequence)

(166) hFB54-matu039 heavy chain variable region portion

(167) TABLE-US-00017 hFB54VH039_F: 5′-CGTGCATTCTGAGGTGCGGCTGGTGGAGTCG-3′ (SEQ ID NO: 140) hFB54VH_R_XhoI: 5′-atataCTCGAGACGGTGACCAGGG-3′ (SEQ ID NO: 139; the underlined portion is XhoI recognition sequence)

(168) mFB54-matu002, 089 heavy chain variable region portion

(169) TABLE-US-00018 mFB54VH_F: 5′ -CGTGCATTCTGAAGTGATGCTGGTGGAGTCTGG- 3′ (SEQ ID NO: 141) HC-reverse: 5′ -atataCTCGAGACGGTGACTGAGG-3′ (SEQ ID NO: 142; the underlined portion is XhoI recognition sequence)

(170) Coupling between hFB54-matu014, 020, 024, 039, 054, 062, 072 heavy chain signal peptide portion and variable region portion

(171) TABLE-US-00019 VH_signal_F_HindIII: 5′-atataAAGCTTACCATGGAATGGAGCTGGG-3′(SEQ ID NO: 134; the underlined portion is HindIII recognition sequence) hFB54VH_R_XhoI: 5′-atataCTCGAGACGGTGACCAGGG-3′ (SEQ ID NO: 139; the underlined portion is XhoI recognition sequence)

(172) Coupling between mFB54-matu002, 089 heavy chain signal peptide portion and variable region portion

(173) TABLE-US-00020 VH_signal_F_HindIII: 5′-atataAAGCTTACCATGGAATGGAGCTGGG-3′ (SEQ ID NO: 134; the underlined portion is HindIII recognition sequence) HC-reverse: 5′-atataCTCGAGACGGTGACTGAGG-3′ (SEQ ID NO: 142; the underlined portion is XhoI recognition sequence)

(174) hFB54-matu014, 020, 024, 039, 054, 062, 072, mFB54-matu002, 089 light chain signal peptide portion

(175) TABLE-US-00021 VK_signal_F_HindIII: 5′-atataAAGCTTACCATGTCTGTGCCTACCCAGG-3′ (SEQ ID NO: 134; the underlined portion is HindIII recognition sequence) mhFB54VK_signal_R: (SEQ ID NO: 143) 5′-CAGTTGTTTCACAGCGGGCGTCTGTCAGCC-3′

(176) hFB54-matu014, 020, 024, 054, 062, 072, mFB54-matu002, 089 light chain variable region portion

(177) TABLE-US-00022 mhFB54VK_F: 5′-ACGCCCGCTGTGAAACAACTGTGACCC-3′ (SEQ ID   NO: 144) LC-reverse: 5′-atataCGTACGTTTGATTTCCAGCTTGGTGCC-3′ (SEQ ID NO: 122; the underlined portion is BsiWI recognition sequence)

(178) hFB54-matu039 light chain variable region portion

(179) TABLE-US-00023 mhFB54VKF: 5′-ACGCCCGCTGTGAAACAACTGTGACCC-3′ (SEQ ID NO: 143) hFB54VK039_R_BsiWI: 5′-atataCGTACGTTTGATCCCCAGCTTGGTTCC-3′ (SEQ ID NO: 145; the underlined portion is BsiWI recognition sequence)

(180) Coupling between hFB54-matu014, 020, 024, 054, 062, 072, mFB54-matu002, 089 light chain signal peptide portion and variable region portion

(181) TABLE-US-00024 VK_signal_F_HindIII: 5′-atataAAGCTTACCATGTCTGTGCCTACCCAGG-3′ (SEQ ID NO: 134; the underlined portion is HindIII recognition sequence) LC-reverse: 5′-atataCGTACGTTTGATTTCCAGCTTGGTGCC-3′ (SEQ ID NO: 122; the underlined portion is BsiWI recognition sequence)

(182) Coupling between hFB54-matu039 light chain signal peptide portion and variable region portion

(183) TABLE-US-00025 VK_signal_F_HindIII: 5′-atataAAGCTTACCATGTCTGTGCCTACCCAGG-3′ (SEQ ID NO: 134; the underlined portion is HindIII recognition sequence) hFB54VK039_R_BsiWI: 5′-atataCGTACGTTTGATCCCCAGCTTGGTTCC-3′ (SEQ ID NO: 145; the underlined portion is BsiWI recognition sequence)

(Example 23) Affinity Evaluation of FB54 Affinity-Improved Antibodies

(184) The reactivities of the obtained affinity-improved antibodies with MK were confirmed by enzyme-linked immunosorbent assay (ELISA). The assays were performed in the same manner as described above. The affinity-improved antibodies (hFB54-matu014, 020, 024, 039, 054, 062, 072, mFB54-matu002, 089) and the hFB54 or mouse FB54 antibody as a control, at a maximum concentration of 5 μg/mL, were each serially diluted with PBS, and used as a primary antibody. HRP-labeled goat anti-human IgG (MBL: 206) or HRP-labeled goat anti-mouse IgG (MBL: 330) was used as a secondary antibody.

(185) As a result, all of the affinity-improved antibodies were confirmed to be improved in reactivities with both of human MK and mouse MK (FIGS. 19, 20).

(Example 24) AP-MK Binding Inhibition Assay (FB54 Affinity-Improved Antibodies)

(186) The MK neutralizing activity of the obtained FB54-derived affinity-improved antibodies was evaluated by the same AP-MK binding inhibition assay as the assay described earlier. However, each antibody was added in an amount of 10 μg/mL. The results obtained are shown in FIG. 21.

(187) As shown in FIG. 21, the activity of AP was lowered to 81.8% in the wells containing humanized FB54 (hFB54), as compared with the wells containing AP-MK alone. In the wells containing the affinity-improved antibodies of FB54, the activities of AP were lowered to 18.9%, 20.0%, 25.6%, 26.8%, 22.7%, 30.1%, 33.5%, 28.3% and 33.0%, respectively, in mFB54-002, mFB54-089, hFB54-014, hFB54-020, hFB54-024, hFB54-039, hFB54-054, hFB54-062, and hFB54-072. No decline in the AP activity was observed in the wells containing the control antibody. Based on these findings, the affinity-improved antibodies were confirmed to have even stronger neutralizing activity than the original antibodies.

INDUSTRIAL APPLICABILITY

(188) The antibody of present invention has neutralizing activity against human midkine, and its tumor proliferation suppressing activity is also observed. Thus, the antibody of present invention can be used for the treatment of cancer. Because of its high reactivity with midkine, moreover, the antibody of present invention can also be applied as an agent for detection or purification of midkine.

SEQUENCE LISTING FREE TEXT

(189) SEQ ID NO: 1

(190) <223> CDR1 of light chain variable region (FB54)

(191) SEQ ID NO: 2

(192) <223> CDR2 of light chain variable region (FB54)

(193) SEQ ID NO: 3

(194) <223> CDR3 of light chain variable region (FB54)

(195) SEQ ID NO: 4

(196) <223> CDR1 of heavy chain variable region (FB54)

(197) SEQ ID NO: 5

(198) <223> CDR2 of heavy chain variable region (FB54)

(199) SEQ ID NO: 6

(200) <223> CDR3 of heavy chain variable region (FB54)

(201) SEQ ID NO: 7

(202) <223> Light chain variable region (FB54)

(203) SEQ ID NO: 8

(204) <223> Heavy chain variable region (FB54)

(205) SEQ ID NO: 9

(206) <223> Artificially humanized light chain variable region

(207) <223> Light chain variable region (FB54-rKa)

(208) SEQ ID NO: 10

(209) <223> Artificially humanized light chain variable region

(210) <223> Light chain variable region (FB54-rKb)

(211) SEQ ID NO: 11

(212) <223> Artificially humanized light chain variable region

(213) <223> Light chain variable region (FB54-rKc)

(214) SEQ ID NO: 12

(215) <223> Artificially humanized heavy chain variable region

(216) <223> Heavy chain variable region (FB54-rHa)

(217) SEQ ID NO: 13

(218) <223> CDR1 of artificially mutated light chain variable region

(219) <223> CDR1 of light chain variable region (matu002)

(220) SEQ ID NO: 14

(221) <223> CDR2 of light chain variable region (matu002)

(222) SEQ ID NO: 15

(223) <223> CDR3 of light chain variable region (matu002)

(224) SEQ ID NO: 16

(225) <223> CDR1 of heavy chain variable region (matu002)

(226) SEQ ID NO: 17

(227) <223> CDR2 of heavy chain variable region (matu002)

(228) SEQ ID NO: 18

(229) <223> CDR3 of heavy chain variable region (matu002)

(230) SEQ ID NO: 19

(231) <223> Artificially mutated light chain variable region

(232) <223> Light chain variable region (matu002)

(233) SEQ ID NO: 20

(234) <223> Heavy chain variable region (matu002)

(235) SEQ ID NO: 21

(236) <223> CDR1 of artificially mutated light chain variable region

(237) <223> CDR1 of light chain variable region (matu089)

(238) SEQ ID NO: 22

(239) <223> CDR2 of light chain variable region (matu089)

(240) SEQ ID NO: 23

(241) <223> CDR3 of light chain variable region (matu089)

(242) SEQ ID NO: 24

(243) <223> CDR1 of heavy chain variable region (matu089)

(244) SEQ ID NO: 25

(245) <223> CDR2 of heavy chain variable region (matu089)

(246) SEQ ID NO: 26

(247) <223> CDR3 of heavy chain variable region (matu089)

(248) SEQ ID NO: 27

(249) <223> Artificially mutated light chain variable region

(250) <223> Light chain variable region (matu089)

(251) SEQ ID NO: 28

(252) <223> Artificially mutated heavy chain variable region

(253) <223> Heavy chain variable region (matu089)

(254) SEQ ID NO: 29

(255) <223> CDR1 of artificially mutated light chain variable region

(256) <223> CDR1 of light chain variable region (matu014)

(257) SEQ ID NO: 30

(258) <223> CDR2 of light chain variable region (matu014)

(259) SEQ ID NO: 31

(260) <223> CDR3 of light chain variable region (matu014)

(261) SEQ ID NO: 32

(262) <223> CDR1 of heavy chain variable region (matu014)

(263) SEQ ID NO: 33

(264) <223> CDR2 of heavy chain variable region (matu014)

(265) SEQ ID NO: 34

(266) <223> CDR3 of heavy chain variable region (matu014)

(267) SEQ ID NO: 35

(268) <223> Artificially mutated light chain variable region

(269) <223> Light chain variable region (matu014)

(270) SEQ ID NO: 36

(271) <223> Artificially mutated heavy chain variable region

(272) <223> Heavy chain variable region (matu014)

(273) SEQ ID NO: 37

(274) <223> CDR1 of artificially mutated light chain variable region

(275) <223> CDR1 of light chain variable region (matu020)

(276) SEQ ID NO: 38

(277) <223> CDR2 of light chain variable region (matu020)

(278) SEQ ID NO: 39

(279) <223> CDR3 of light chain variable region (matu020)

(280) SEQ ID NO: 40

(281) <223> CDR1 of heavy chain variable region (matu020)

(282) SEQ ID NO: 41

(283) <223> CDR2 of heavy chain variable region (matu020)

(284) SEQ ID NO: 42

(285) <223> CDR3 of artificially mutated heavy chain variable region

(286) <223> CDR3 of heavy chain variable region (matu020)

(287) SEQ ID NO: 43

(288) <223> Artificially mutated light chain variable region

(289) <223> Light chain variable region (matu020)

(290) SEQ ID NO: 44

(291) <223> Artificially mutated heavy chain variable region

(292) <223> Heavy chain variable region (matu020)

(293) SEQ ID NO: 45

(294) <223> CDR1 of artificially mutated light chain variable region

(295) <223> CDR1 of light chain variable region (matu024)

(296) SEQ ID NO: 46

(297) <223> CDR2 of light chain variable region (matu024)

(298) SEQ ID NO: 47

(299) <223> CDR3 of light chain variable region (matu024)

(300) SEQ ID NO: 48

(301) <223> CDR1 of heavy chain variable region (matu024)

(302) SEQ ID NO: 49

(303) <223> CDR2 of heavy chain variable region (matu024)

(304) SEQ ID NO: 50

(305) <223> CDR3 of artificially mutated heavy chain variable region

(306) <223> CDR3 of heavy chain variable region (matu024)

(307) SEQ ID NO: 51

(308) <223> Artificially mutated light chain variable region

(309) <223> Light chain variable region (matu024)

(310) SEQ ID NO: 52

(311) <223> Artificially mutated heavy chain variable region

(312) <223> Heavy chain variable region (matu024)

(313) SEQ ID NO: 53

(314) <223> CDR1 of artificially mutated light chain variable region

(315) <223> CDR1 of light chain variable region (matu039)

(316) SEQ ID NO: 54

(317) <223> CDR2 of light chain variable region (matu039)

(318) SEQ ID NO: 55

(319) <223> CDR3 of light chain variable region (matu039)

(320) SEQ ID NO: 56

(321) <223> CDR1 of heavy chain variable region (matu039)

(322) SEQ ID NO: 57

(323) <223> CDR2 of artificially mutated heavy chain variable region

(324) <223> CDR2 of heavy chain variable region (matu039)

(325) SEQ ID NO: 58

(326) <223> CDR3 of artificially mutated heavy chain variable region

(327) <223> CDR3 of heavy chain variable region (matu039)

(328) SEQ ID NO: 59

(329) <223> Artificially mutated light chain variable region

(330) <223> Light chain variable region (matu039)

(331) SEQ ID NO: 60

(332) <223> Artificially mutated heavy chain variable region

(333) <223> Heavy chain variable region (matu039)

(334) SEQ ID NO: 61

(335) <223> CDR1 of artificially mutated light chain variable region

(336) <223> CDR1 of light chain variable region (matu054)

(337) SEQ ID NO: 62

(338) <223> CDR2 of light chain variable region (matu054)

(339) SEQ ID NO: 63

(340) <223> CDR3 of light chain variable region (matu054)

(341) SEQ ID NO: 64

(342) <223> CDR1 of heavy chain variable region (matu054)

(343) SEQ ID NO: 65

(344) <223> CDR2 of heavy chain variable region (matu054)

(345) SEQ ID NO: 66

(346) <223> CDR3 of heavy chain variable region (matu054)

(347) SEQ ID NO: 67

(348) <223> Artificially mutated light chain variable region

(349) <223> Light chain variable region (matu054)

(350) SEQ ID NO: 68

(351) <223> Artificially mutated heavy chain variable region

(352) <223> Heavy chain variable region (matu054)

(353) SEQ ID NO: 69

(354) <223> CDR1 of artificially mutated light chain variable region

(355) <223> CDR1 of light chain variable region (matu062)

(356) SEQ ID NO: 70

(357) <223> CDR2 of light chain variable region (matu062)

(358) SEQ ID NO: 71

(359) <223> CDR3 of artificially mutated light chain variable region

(360) <223> CDR3 of light chain variable region (matu062)

(361) SEQ ID NO: 72

(362) <223> CDR1 of heavy chain variable region (matu062)

(363) SEQ ID NO: 73

(364) <223> CDR2 of heavy chain variable region (matu062)

(365) SEQ ID NO: 74

(366) <223> CDR3 of heavy chain variable region (matu062)

(367) SEQ ID NO: 75

(368) <223> Artificially mutated light chain variable region

(369) <223> Light chain variable region (matu062)

(370) SEQ ID NO: 76

(371) <223> Artificially mutated heavy chain variable region

(372) <223> Heavy chain variable region (matu062)

(373) SEQ ID NO: 77

(374) <223> CDR1 of artificially mutated light chain variable region

(375) <223> CDR1 of light chain variable region (matu072)

(376) SEQ ID NO: 78

(377) <223> CDR2 of light chain variable region (matu072)

(378) SEQ ID NO: 79

(379) <223> CDR3 of artificially mutated light chain variable region

(380) <223> CDR3 of light chain variable region (matu072)

(381) SEQ ID NO: 80

(382) <223> CDR1 of heavy chain variable region (matu072)

(383) SEQ ID NO: 81

(384) <223> CDR2 of artificially mutated heavy chain variable region

(385) <223> CDR2 of heavy chain variable region (matu072)

(386) SEQ ID NO: 82

(387) <223> CDR3 of artificially mutated heavy chain variable region

(388) <223> CDR3 of heavy chain variable region (matu072)

(389) SEQ ID NO: 83

(390) <223> Artificially mutated light chain variable region

(391) <223> Light chain variable region (matu072)

(392) SEQ ID NO: 84

(393) <223> Artificially mutated heavy chain variable region

(394) <223> Heavy chain variable region (matu072)

(395) SEQ ID NO: 85 to 123 and 134 to 145

(396) <223> Artificially synthesized primer sequence

(397) SEQ ID NO: 124

(398) <223> Heavy chain variable region (AF471493)

(399) SEQ ID NO: 125

(400) <223> FR1 of heavy chain variable region (AF471493)

(401) SEQ ID NO: 126

(402) <223> FR2 of heavy chain variable region (AF471493)

(403) SEQ ID NO: 127

(404) <223> FR3 of heavy chain variable region (AF471493)

(405) SEQ ID NO: 128

(406) <223> FR4 of heavy chain variable region (AF471493)

(407) SEQ ID NO: 129

(408) <223> Light chain variable region (X70463)

(409) SEQ ID NO: 130

(410) <223> FR1 of light chain variable region (X70463)

(411) SEQ ID NO: 131

(412) <223> FR2 of light chain variable region (X70463)

(413) SEQ ID NO: 132

(414) <223> FR3 of light chain variable region (X70463)

(415) SEQ ID NO: 133

(416) <223> FR4 of light chain variable region (X70463)