High affinity digoxigenin binding proteins
09840539 · 2017-12-12
Assignee
Inventors
- David Baker (Seattle, WA)
- Christine E. Tinberg (Seattle, WA, US)
- Sagar D. Khare (New Brunswick, NJ, US)
- Jiayi Dou (Seattle, WA, US)
Cpc classification
C12N15/1034
CHEMISTRY; METALLURGY
International classification
A61K38/16
HUMAN NECESSITIES
G01N33/74
PHYSICS
C07K1/00
CHEMISTRY; METALLURGY
Abstract
Isolated polypeptides with steroid binding activity and methods for their use as therapeutics and detection agents are disclosed herein.
Claims
1. An isolated polypeptide comprising a polypeptide at least 95% identical along its entire length to the amino acid sequence selected from the group consisting of SEQ ID NOS:10-23 wherein the amino acid sequence is not the amino acid sequence of SEQ ID NO: 24, wherein the isolated polypeptide binds to one or more of digoxigenin, digitoxigenin, progesterone, and β-estradiol, and digoxin.
2. The isolated polypeptide of claim 1, comprising a polypeptide at least 98% identical along its entire length to the amino acid sequence selected from the group consisting of SEQ ID NOS:10-23, wherein the amino acid sequence is not the amino acid sequence of SEQ ID NO: 24.
3. The isolated polypeptide of claim 1, comprising a polypeptide at least 99% identical along its entire length to the amino acid sequence selected from the group consisting of SEQ ID NOS:10-23, wherein the amino acid sequence is not the amino acid sequence of SEQ ID NO: 24.
4. The isolated polypeptide of claim 1, comprising the amino acid sequence selected from the group consisting of SEQ ID NOS:10-23.
5. The isolated polypeptide of claim 1, further comprising a detectable tag.
6. A pharmaceutical composition, comprising one or more polypeptides of claim 1 and a pharmaceutically acceptable carrier.
7. A method for treating digoxin overdose and/or toxicity, comprising administering to a subject in need thereof an amount effective of the polypeptide of claim 4 to treat the digoxin toxicity.
8. A method for detecting digoxin, comprising contacting a sample of interest with the polypeptide of claim 1 under suitable conditions for binding the detectable polypeptide to digoxin present in the sample to form a polypeptide-digoxin binding complex, and detecting the polypeptide-digoxin binding complex.
9. A pharmaceutical composition, comprising one or more polypeptides of claim 2 and a pharmaceutically acceptable carrier.
10. A pharmaceutical composition, comprising one or more polypeptides of claim 3 and a pharmaceutically acceptable carrier.
11. A pharmaceutical composition, comprising one or more polypeptides of claim 4 and a pharmaceutically acceptable carrier.
Description
DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
where x is the sum of enrichment values at position i, μ is the mean sum of enrichment values for all interrogated positions within the fragment library, and σ is the standard deviation of the sums of enrichment values for all interrogated positions within the fragment library. Blue is very optimal (mutations to all other amino acids are disfavored) and red is very suboptimal (mutations are preferred). c, Equilibrium fluorescence polarization measurements of DIG-PEG.sub.3-Alexa488 treated with increasing amounts of DIG10. DIG5, scaffold 1z1s, and negative control bovine serum albumin (left panel). Solid lines represent fits to the data to obtain dissociation constants (K.sub.d values) (right panel). Error bars represent standard deviations for at least three independent measurements. K.sub.d values of relevant designs and affinity matured DIG10 variants are given in the right panel. d, Mutations identified during affinity maturation to generate DIG10.1a, DIG10.2, and DIG10.3 mapped on to the computational model of DIG10.3.
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
DETAILED DESCRIPTION OF THE INVENTION
(24) All references cited are herein incorporated by reference in their entirety. Within this application, unless otherwise stated, the techniques utilized may be found in any of several well-known references such as: Molecular Cloning: A Laboratory Manual (Sambrook, et al., 1989, Cold Spring Harbor Laboratory Press), Gene Expression Technology (Methods in Enzymology, Vol. 185, edited by D. Goeddel, 1991. Academic Press, San Diego, Calif.), “Guide to Protein Purification” in Methods in Enzymology (M. P. Deutshcer, ed., (1990) Academic Press, Inc.); PCR Protocols: A Guide to Methods and Applications (Innis, et al. 1990. Academic Press, San Diego, Calif.), Culture of Animal Cells: A Manual of Basic Technique. 2.sup.nd Ed. (R. I. Freshney. 1987. Liss, Inc. New York, N.Y.), Gene Transfer and Expression Protocols, pp. 109-128, ed. E. J. Murray, The Humana Press Inc., Clifton, N.J.), and the Ambion 1998 Catalog (Ambion, Austin, Tex.).
(25) As used herein, the singular forms “a”, “an” and “the” include plural referents unless the context clearly dictates otherwise. “And” as used herein is interchangeably used with “or” unless expressly stated otherwise.
(26) As used herein, the amino acid residues are abbreviated as follows: alanine (Ala; A), asparagine (Asn; N), aspartic acid (Asp; D), arginine (Arg; R), cysteine (Cys; C), glutamic acid (Glu; E), glutamine (Gln; Q), glycine (Gly; G), histidine (His; H), isoleucine (Ile; I), leucine (Leu; L), lysine (Lys: K), methionine (Met; M), phenylalanine (Phe: F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).
(27) All embodiments of any aspect of the invention can be used in combination, unless the context clearly dictates otherwise.
(28) Unless the context clearly requires otherwise, throughout the description and the claims, the words ‘comprise’, ‘comprising’, and the like are to be construed in an inclusive sense as opposed to an exclusive or exhaustive sense; that is to say, in the sense of “including, but not limited to”. Words using the singular or plural number also include the plural and singular number, respectively. Additionally, the words “herein,” “above,” and “below” and words of similar import, when used in this application, shall refer to this application as a whole and not to any particular portions of the application.
(29) The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While the specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize.
(30) In a first aspect, the invention provides isolated polypeptides comprising or consisting of an amino acid sequence according to SEQ ID NO: 1, wherein the amino acid sequence is at least 70% identical to the amino acid sequence of SEQ ID NO: 15, (DIG10.3), and wherein the amino acid sequence is not the amino acid sequence of SEQ ID NO: 24 (PDB ID 1z1s):
(31) TABLE-US-00001 MNAKEILVHSLRLLENGDARGWCDLFHPEGVLEFPYAPPGWKIRFEGRET IWAHMRLFPEHLTVRFTDVQFYETADPDLAIGEFHGDCWATVSGGKLAQD YISVIRTRDGQILLYRDEWNPLRITLEALGGVEAAAKIVQGA)
(32) TABLE-US-00002 TABLE 1 SEQ ID NO: 1 Residue Alignment # AA Specificity Alternative residues 1 M White/unlabeled: Hydrophobic or absent 2 N Green: Any amino acid 3 A White/unlabeled.: Hydrophobic AAs 4 K Green: Any amino acid 5 E Green: Any amino acid 6 I White/unlabeled: Hydrophobic AAs 7 V White/unlabeled: Hydrophobic AAs 8 V Green: Any amino acid 9 H Green: Any amino acid 10 S, A Gray/aqua - Any amino acid 11 L White/unlabeled: Hydrophobic AAs 12 R Green: Any amino acid 13 L White/unlabeled: Any amino acid 14 L White/unlabeled: Hydrophobic AAs 15 E Green: Any amino acid 16 N Green: Any amino acid 17 G White/unlabeled: G, A, or S 18 D Green: Any amino acid 19 A White/unlabeled: Hydrophobic AAs 20 R Green: Any amino acid 21 G Green Any amino acid 22 W White/unlabeled: Aromatic/Polar neutral AAs 23 C, S Gray/aqua - Any amino acid 24 D Green: Any amino acid 25 L White/unlabeled: Hydrophobic AAs 26 F White/unlabeled: Hydrophobic AAs 27 H Green: Any amino acid 28 P White/unlabeled: Hydrophobic AAs 29 E Green: Any amino acid 30 G White/unlabeled: G, A, or S 31 V Green: Any amino acid 32 L White/unlabeled: Hydrophobic or Polar neutral AAs 33 E Green: Any amino acid 34 Y Pink: Aromatic 35 P White/unlabeled: Hydrophobic AAs 36 Y Dark green: Polar neutral 37 A, P Gray/aqua - Any amino acid 38 P White/unlabeled: Hydrophobic 39 P White/unlabeled: Hydrophobic AAs 40 G White/unlabeled: Hydrophobic AAs or G 41 H, Y Gray/aqua - Any amino acid 42 K Green: Any amino acid 43 T White/unlabeled: Polar neutral AAs 44 R Green: Any amino acid 45 F White/unlabeled: Hydrophobic or polar neutral AAs 46 E Green: Any amino acid 47 G White/unlabeled: G, A, or S 48 R Green: Any amino acid 49 E Green: Any amino acid 50 T Green: Any amino acid 51 I White/unlabeled: Hydrophobic AAs 52 W Green: Any amino acid 53 A Green: Any amino acid 54 H White/unlabeled: Basic, hydrophobic, or polar neutral AAs 55 M White/unlabeled: Hydrophobic 56 R Green: Any amino acid 57 L Green: Any amino acid 58 F White/unlabeled: Hydrophobic, basic, or polar neutral AAs 59 P White/unlabeled: Hydrophobic AAs 60 E Green: Any amino acid 61 Y Green: Any amino acid 62 V, M Gray/aqua - Hydrophobic AAs 63 T Green: Any AA 64 V, I Gray/aqua - Any amino acid 65 R Green: Any amino acid 66 F White/unlabeled: Hydrophobic AAs 67 T Green: Any amino acid 68 D Green: Any amino acid 69 V White/unlabeled: Hydrophobic AAs 70 Q Green: Any amino acid 71 F White/unlabeled: Hydrophobic AAs 72 Y Dark green: Aromatic AAs 73 E Green: Any amino acid 74 T White/unlabeled: Polar neutral AAs 75 A Green: Any amino acid 76 D Green: Any amino acid 77 P White/unlabeled: Hydrophobic AAs 78 D Green: Any amino acid 79 L Green: Any amino acid 80 A White/unlabeled: Hydrophobic AAs 81 I Dark green: Aliphatic AAs 82 G White/unlabeled: G, A, or S 83 E Dark Lueen: Acidic AAs 84 F White/unlabeled: Hydrophobic or charged AAs 85 H Green: Any amino acid 86 G White/unlabeled: Hydrophobic or polar neutral AAs 87 D Green: Any amino acid 88 G White/unlabeled: Hydrophobic or polar neutral 89 V Green: Any amino acid 90 H, L Gray/aqua - Any amino acid 91 T Green: Any amino acid 92 V, A Gray/aqua - Any amino acid 93 S Green: Any amino acid 94 G Green: Any amino acid 95 G Green: Any amino acid 96 K Green: Any amino acid 97 L White/unlabeled: Hydrophobic or polar neutral AAs 98 A Green: Any amino acid 99 A, Y Gray/aqua - Any amino acid 100 D Green: Any amino acid 101 Y Pink: Hydrophobic or basic AAs 102 I Dark green: Aliphatic AAs 103 S, A Gray/aqua - Any amino acid 104 V Dark green: Aliphatic AAs 105 L, W Gray/aqua - Any amino acid 106 R Green: Any amino acid 107 T White/unlabeled: Polar neutral AAs or hydrophobic residues 108 R Green: Any amino acid 109 D Green: Any amino acid 110 G White/unlabeled: G, A, or S 111 Q Green: Any amino acid 112 I White/unlabeled: Hydrophobic, polar neutral, or basic AAs 113 L Green: Any amino acid 114 L Green: Any amino acid 115 V Pink: Hydrophobic 116 R Dark green: Basic AAs 117 V, L Gray/aqua - Any amino acid 118 F Dark green: Aromatic AAs 119 F White/unlabeled: Aromatic, polar neutral, or basic 120 N Dark green: Polar neutral AAs 121 P White/unlabeled: Hydrophobic AAs 122 L Dark green: Aliphatic AAs 123 R Green: Any amino acid 124 V White/unlabeled: Hydrophobic, polar neutral, acidic 125 L White/unlabeled: Aliphatic As 126 E Green: Any amino acid 127 A, P Gray/aqua - Any amino acid 128 L Green: Any amino acid 129 G Green: Any amino acid
(33) As described in the examples that follow, the inventors describe a general method for the computational design of small molecule binding sites with pre-organized hydrogen bonding and hydrophobic interfaces and high overall shape complementary to the ligand, and use it to design the polypeptides of the present invention that are high affinity polypeptide ligands of the steroid digoxigenin (DIG) or the related steroids digitoxigenin, progesterone, and β-estradiol, as well as digoxin. The inventors have identified positions of the polypeptides of the invention that provide specificity of the polypeptides for DIG or one or more of the related steroids. As such, the polypeptides of the invention can be used, for example, in steroid biosensors and diagnostics, as well as for therapeutic applications. For example, digoxigenin (DIG), is the aglycone of digoxin, a cardiac glycoside used to treat heart disease. Digoxin has a narrow therapeutic window, and thus the polypeptides of the invention can be used, for example treat digoxin overdoses. The polypeptides can also be used, for example, to detect DIG and/or one or more of the related steroids. The polypeptides of the invention provide a cheaper, more selective alternative to currently used digoxigenin binding antibodies, which are costly to produce and are not selective for digoxigenin over other steroids. The polypeptides of the invention can also be used for in vivo biosensing applications, whereas the antibodies cannot because of their structurally necessary disulfide bonds and difficulty to express robustly.
(34) The polypeptides of the invention are non-naturally occurring polypeptides designed using the computational methods of the invention (described herein). The starting polypeptide was SEQ ID NO: 24 (PDB ID 1z1s), which is a hypothetical protein from Pseudomonas aeruginosa. Thus, the polypeptides of the invention do not comprise or consist of SEQ ID NO: 24. Of the specific polypeptides tested, the polypeptide of SEQ ID NO: 15, (DIG10.3) was the best binder. Thus, the polypeptides of the invention are at least 70% identical with to the amino acid sequence of SEQ ID NO:15, over its full length. In various embodiments, the polypeptides of the invention are at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical with to the amino acid sequence of SEQ ID NO:15, over its full length.
(35) SEQ ID NO:1 is presented in Table 1, which includes the following information:
(36) (a) “Residue number”: Position in the polypeptide amino acid sequence;
(37) (b) “Alignment amino acid”: Residues that are in exemplary polypeptides;
(38) (c) Specificity: Indication of toleration for amino acid substitution at the specific residue based on biochemical analysis; and
(39) (d) Alternative residues: Tolerated residues at the position based on deep mutational scanning analysis.
(40) As used herein, the amino acid residues are abbreviated as follows: alanine (Ala, A), asparagine (Asn; N), aspartic acid (Asp; D), arginine (Arg; R), cysteine (Cys; C), glutamic acid (Glu; E), glutamine (Gin; Q), glycine (Gly; G), histidine (His; H), isoleucine (Ile; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val: V).
(41) Deep mutational scanning of DIG10.1 (SEQ ID NO: 13) was carried out to reveal all point mutations that will preserve or enhance function (ΔE≧0) and those that negatively affect function (ΔE≦0). This data is summarized in the “Specificity” section of Table 1, with the recited colors representing the following information: Gray/aqua—positions that differ between the DIG10 series constructs described and tested in the examples that follow; Pink: Mutation of these residues switches the steroid specificity profile of the polypeptides. Only conservative substitutions permitted; Green: Surface residues not at critical dimer interface; these can be mutated without affecting function; and Dark green: Surface residues at dimer interface; conservative substitutions permitted White/unlabeled: Active site/core residues, conservative substitutions permitted.
(42) Thus, some residues can be substituted with any amino acid, and thus the “alternative residues” noted in the Tables herein are listed as “any amino acid.” Other positions can only tolerate conservative substitutions, and thus the “alternative residues” for these positions will define one or more amino acid grouping, as noted in the Tables herein. These amino acid groupings are defined as follows: Polar neutral AA's: H, N, Q, Y, T, S, and C; Hydrophobic AA's: A, I, L, V, M, F, W, P, and G: Aliphatic AA's (subset of hydrophobic AA's): A, I, L, V, and M; Aromatic AA's (subset of hydrophobic AA's): Y, W, and F; Charged AA's: K, R, D, E, and H: Basic AA's (subset of charged AA's): K and R; and Acidic AA's (subset of charged AA's): D and E.
(43) In one embodiment, the isolated polypeptides comprise or consist of the amino acid sequence of SEQ ID NO: 2 (Table 2). In this embodiment, the specificity defining residues (“pink”) are limited to those residues in the polypeptides that have been made and tested in the examples that follow. As is shown in the examples, modifications at these positions (residues 34, 101, and 115) between Y and F change the steroid specificity profile of the resulting polypeptide.
(44) TABLE-US-00003 TABLE 2 SEQ ID NO: 2 Residue Alignment # AA Specificity Alternative residues 1 M White/unlabeled: Hydrophobic or absent 2 N Green: Any amino acid 3 A White/unlabeled: Hydrophobic AAs 4 K Green: Any amino acid 5 E Green: Any amino acid 6 I White/unlabeled: Hydrophobic AAs 7 V White/unlabeled: Hydrophobic AAs 8 V Green: Any amino acid 9 H Green: Any amino acid 10 S, A Gray/aqua- Any amino acid 11 L White/unlabeled: Hydrophobic AAs 12 R Green: Any amino acid 13 L White/unlabeled: Any amino acid 14 L White/unlabeled: Hydrophobic AAs 15 E Green: Any amino acid 16 N Green: Any amino acid 17 G White/unlabeled: G, A, or S 18 D Green: Any amino acid 19 A White/unlabeled: Hydrophobic AAs 20 R Green: Any amino acid 21 G Green Any amino acid 22 W White/unlabeled: Aromatic/Polar neutral AAs 23 C, S Gray/aqua- Any amino acid 24 D Green: Any amino acid 25 L White/unlabeled.: Hydrophobic AAs 26 F White/unlabeled: Hydrophobic AAs 27 H Green: Any amino acid 28 P White/unlabeled: Hydrophobic AAs 29 E Green: Any amino acid 30 G White/unlabeled: G, A, or S 31 V Green: Any amino acid 32 L White/unlabeled: Hydrophobic or Polar neutral AAs 33 F Green: Any amino acid 34 Y Pink: F or Y 35 P White/unlabeled: Hydrophobic AAs 36 Y Dark green: Polar neutral 37 A, P Gray/aqua- Any amino acid 38 P White/unlabeled: Hydrophobic 39 P White/unlabeled: Hydrophobic AAs 40 G White/unlabeled: Hydrophobic AAs or G 41 H, Y Gray/aqua- Any amino acid 42 K Green: Any amino acid 43 T White/unlabeled: Polar neutral AAs 44 R Green: Any amino acid 45 F White/unlabeled: Hydrophobic or polar neutral AAs 46 E Green: Any amino acid 47 G White/unlabeled: G, A, or S 48 R Green: Any amino acid 49 E Green: Any amino acid 50 T Green: Any amino acid 51 I White/unlabeled: Hydrophobic AAs 52 W Green: Any amino acid 53 A Green: Any amino acid 54 H White/unlabeled: Basic, hydrophobic, or polar neutral AAs 55 M White/unlabeled: Hydrophobic 56 R Green: Any amino acid 57 L Green: Any amino acid 58 F White/unlabeled: Hydrophobic, basic, or polar neutral AAs 59 P White/unlabeled: Hydrophobic AAs 60 E Green: Any amino acid 61 Y Green: Any amino acid 62 V, M Gray/aqua- Hydrophobic AAs 63 T Green: Any AA 64 V, I Gray/aqua- Any amino acid 65 R Green: Any amino acid 66 F White/unlabeled: Hydrophobic AAs 67 T Green: Any amino acid 68 D Green: Any amino acid 69 V White/unlabeled: Hydrophobic AAs 70 Q Green: Any amino acid 71 F White/unlabeled: Hydrophobic AAs 72 Y Dark green: Aromatic AAs 73 E Green: Any amino acid 74 T White/unlabeled: Polar neutral AAs 75 A Green: Any amino acid 76 D Green: Any amino acid 77 P White/unlabeled: Hydrophobic AAs 78 D Green: Any amino acid 79 L Green: Any amino acid 80 A White/unlabeled: Hydrophobic AAs 81 I Dark green: Aliphatic AAs 82 G White/unlabeled: G, A, or S 83 E Dark green: Acidic AAs 84 F White/unlabeled: Hydrophobic or charged AAs 85 H Green: Any amino acid 86 G White/unlabeled: Hydrophobic or polar neutral AAs or G 87 D Green: Any amino acid 88 G White/unlabeled: Hydrophobic or polar neutral 89 V Green: Any amino acid 90 H, L Gray/aqua- Any amino acid 91 T Green: Any amino acid 92 V, A Gray/aqua- Any amino acid 93 S Green: Any amino acid 94 G Green: Any amino acid 95 G Green: Any amino acid 96 K Green: Any amino acid. 97 L White/unlabeled: Hydrophobic or polar neutral AAs 98 A Green: Any amino acid 99 A, Y Gray/aqua- Any amino acid 100 D Green: Any amino acid 101 Y Pink: F or Y 102 I Dark green: Aliphatic AAs 103 S, A Gray/aqua- Any amino acid 104 V Dark green: Aliphatic AAs 105 L, W Gray/aqua- Any amino acid 106 R Green: Any amino acid 107 T White/unlabeled: Polar neutral AAs or hydrophobic residues 108 R Green: Any amino acid 109 D Green: Any amino acid 110 G White/unlabeled: G, A, or S 111 Q Green: Any amino acid 112 I White/unlabeled: Hydrophobic, polar neutral, or basic AAs 113 L Green: Any amino acid 114 L Green: Any amino acid 115 Y Pink: F or Y 116 R Dark green: Basic AAs 117 V, L Gray/aqua- Any amino acid 118 F Dark green: Aromatic AAs 119 F White/unlabeled: Aromatic, polar neutral, or basic 120 N Dark green: Polar neutral AAs 121 P White/unlabeled: Hydrophobic AAs 122 L Dark green: Aliphatic AAs 123 R Green: Any amino acid 124 V White/unlabeled: Hydrophobic, polar neutral, acidic 125 L White/unlabeled: Aliphatic AAs 126 E Green: Any amino acid 127 A, P Gray/aqua- Any amino acid 128 L Green: Any amino acid 129 G Green: Any amino acid
(45) In a further embodiment, the isolated polypeptides comprise or consist of the amino acid sequence of SEQ ID NO: 3 (Table 3). This embodiment differs from SEQ ID NO:2 (Table 2) in that the surface residues at the dimer interface (“dark green”) are limited to those residues in the polypeptides that have been made and tested in the examples that follow.
(46) TABLE-US-00004 TABLE 3 SEQ ID NO: 3 Residue Alignment # AA Specificity Alternative residues 1 M White/unlabeled: Hydrophobic or absent 2 N Green: Any amino acid 3 A White/unlabeled: Hydrophobic AAs 4 K Green: Any amino acid 5 E Green: Any amino acid 6 I White/unlabeled: Hydrophobic AAs 7 V White/unlabeled: Hydrophobic AAs 8 V Green: Any amino acid 9 H Green: Any amino acid 10 S, A Gray/aqua- Any amino acid 11 L White/unlabeled: Hydrophobic AAs 12 R Green: Any amino acid 13 L White/unlabeled: Any amino acid 14 L White/unlabeled: Hydrophobic AAs 15 E Green: Any amino acid 16 N Green: Any amino acid 17 G White/unlabeled: G, A, or S 18 D Green: Any amino acid 19 A White/unlabeled: Hydrophobic AAs 20 R Green: Any amino acid 21 G Green Any amino acid 22 W White/unlabeled: Aromatic/Polar neutral AAs 23 C, S Gray/aqua- Any amino acid 24 D Green: Any amino acid 25 L White/unlabeled: Hydrophobic AAs 26 F White/unlabeled: Hydrophobic AAs 27 H Green: Any amino acid 28 P White/unlabeled: Hydrophobic AAs 29 E Green: Any amino acid 30 G White/unlabeled: G, A, or S 31 V Green: Any amino acid 32 L White/unlabeled: Hydrophobic or Polar neutral AAs 33 E Green: Any amino acid 34 Y Pink: F or Y 35 P White/unlabeled: Hydrophobic AAs 36 Y Dark green: Y 37 A, P Gray/aqua- Any amino acid 38 P White/unlabeled: Hydrophobic 39 P White/unlabeled: Hydrophobic AAs 40 G White/unlabeled: Hydrophobic AAs or G 41 H, Y Gray/aqua- Any amino acid 42 K Green: Any amino acid 43 T White/unlabeled: Polar neutral AAs 44 R Green: Any amino acid 45 F White/unlabeled: Hydrophobic or polar neutral AAs 46 E Green: Any amino acid 47 G White/unlabeled.: G, A, or S 48 R Green: Any amino acid 49 E Green: Any amino acid 50 T Green: Any amino acid 51 I White/unlabeled: Hydrophobic AAs 52 W Green: Any amino acid 53 A Green: Any amino acid 54 H White/unlabeled: Basic, hydrophobic, or polar neutral AAs 55 M White/unlabeled: Hydrophobic 56 R Green: Any amino acid 57 L Green: Any amino acid 58 F White/unlabeled: Hydrophobic, basic, or polar neutral AAs 59 P White/unlabeled.: Hydrophobic AAs 60 E Green: Any amino acid 61 Y Green: Any amino acid 62 V, M Gray/aqua- Hydrophobic AAs 63 T Green: Any AA 64 V, I Gray/aqua- Any amino acid 65 R Green: Any amino acid 66 F White/unlabeled: Hydrophobic As 67 T Green: Any amino acid 68 D Green: Any amino acid 69 V White/unlabeled: Hydrophobic AAs 70 Q Green: Any amino acid 71 F White/unlabeled: Hydrophobic As 72 Y Dark green: Y 73 E Green: Any amino acid 74 T White/unlabeled: Polar neutral AAs 75 A Green: Any amino acid 76 D Green: Any amino acid 77 P White/unlabeled: Hydrophobic AAs 78 D Green: Any amino acid 79 L Green: Any amino acid 80 A White/unlabeled.: Hydrophobic AAs 81 I Dark green: I 82 G White/unlabeled: G, A, or S 83 E Dark green: E 84 F White/unlabeled: Hydrophobic or charged AAs 85 H Green: Any amino acid 86 G White/unlabeled: Hydrophobic or polar neutral AAs or G 87 D Green: Any amino acid 88 G White/unlabeled: Hydrophobic or polar neutral 89 V Green: Any amino acid 90 H, L Gray/aqua- Any amino acid 91 T Green: Any amino acid 92 V, A Gray/aqua- Any amino acid 93 S Green: Any amino acid 94 G Green: Any amino acid 95 G Green: Any amino acid 96 K Green: Any amino acid 97 L White/unlabeled: Hydrophobic or polar neutral AAs 98 A Green: Any amino acid 99 A, Y Gray/aqua- Any amino acid 100 D Green: Any amino acid 101 Y Pink: F or Y 102 I Dark green: I 103 S, A Gray/aqua- Any amino acid 104 V Dark green: V 105 L, W Gray/aqua- Any amino acid 106 R Green: Any amino acid 107 T White/unlabeled: Polar neutral AAs or hydrophobic residues 108 R Green: Any amino acid 109 D Green: Any amino acid 110 G White/unlabeled: G, A, or S 111 Q Green: Any amino acid 112 I White/unlabeled: Hydrophobic, polar neutral, or basic AAs 113 L Green: Any amino acid 114 L Green: Any amino acid 115 V Pink: F or Y 116 R Dark green: R 117 V, L Gray/aqua- Any amino acid 118 F Dark green: F 119 F White/unlabeled: Aromatic, polar neutral, or basic 120 N Dark green: N 121 P White/unlabeled: Hydrophobic AAs 122 L Dark green: L 123 R Green: Any amino acid 124 V White/unlabeled: Hydrophobic, polar neutral, acidic 125 L White/unlabeled: Aliphatic AAs 126 E Green: Any amino acid 127 A, P Gray/aqua- Any amino acid 128 L Green: Any amino acid 129 G Green: Any amino acid
(47) In another embodiment, the isolated polypeptides comprise or consist of the amino acid sequence of SEQ ID NO: 4 (Table 4). In this embodiment, the polypeptides differ from the polypeptides of SEQ ID NO: 3 (Table 3) in that the active/core site residues (“white”) are more narrowly defined.
(48) TABLE-US-00005 TABLE 4 SEQ ID NO: 4 Residue Alignment # AA Specificity Alternative residues 1 M White/unlabeled: Polar neutral AAs or Met 2 N Green: Any amino acid 3 A White/unlabeled: Aliphatic AAs 4 K Green: Any amino acid 5 E Green: Any amino acid 6 I White/unlabeled: Aliphatic AAs 7 V White/unlabeled: Aliphatic AAs 8 V Green: Any amino acid 9 H Green: Any amino acid 10 S, A Gray/aqua- Any amino acid 11 L White/unlabeled: Aliphatic AAs 12 R Green: Any amino acid 13 L White/unlabeled: Aliphatic acid 14 L White/unlabeled: Aliphatic AAs 15 E Green: Any amino acid 16 N Green: Any amino acid 17 G White/unlabeled: G, A, or S 18 D Green: Any amino acid 19 A White/unlabeled: Aliphatic AAs 20 R Green: Any amino acid 21 G Green Any amino acid 22 W White/unlabeled: Aromatic AAs 23 C, S Gray/aqua- Any amino acid 24 D Green: Any amino acid 25 L White/unlabeled: Aliphatic AAs 26 F White/unlabeled: Aromatic AAs 27 H Green: Any amino acid 28 P White/unlabeled: Hydrophobic As 29 E Green: Any amino acid 30 G White/unlabeled: G, A, or S 31 V Green: Any amino acid 32 L White/unlabeled: Aliphatic AAs 33 E Green: Any amino acid 34 Y Pink: F or Y 35 P White/unlabeled: Hydrophobic AAs 36 Y Dark green: Y 37 A, P Gray/aqua- Any amino acid 38 P White/unlabeled: Aliphatic or P 39 P White/unlabeled: Aliphatic AAs or P 40 G White/unlabeled: Aliphatic AAs or G 41 H, Y Gray/aqua- Any amino acid 42 K Green: Any amino acid 43 T White/unlabeled: Polar neutral AAs 44 R Green: Any amino acid 45 F White/unlabeled: Hydrophobic or polar neutral AAs 46 E Green: Any amino acid 47 G White/unlabeled: G, A, or S 48 R Green: Any amino acid 49 E Green: Any amino acid 50 T Green: Any amino acid 51 I White/unlabeled: Aliphatic AAs 52 W Green: Any amino acid 53 A Green: Any amino acid 54 H White/unlabeled: Basic, hydrophobic, or polar neutral AAs 55 M White/unlabeled: Hydrophobic 56 R Green: Any amino acid 57 L Green: Any amino acid 58 F White/unlabeled: Aromatic AAs 59 P White/unlabeled: Hydrophobic AAs 60 E Green: Any amino acid 61 Y Green: Any amino acid 62 V, M Gray/aqua- Hydrophobic AAs 63 T Green: Any AA 64 V, I Gray/aqua- Any amino acid 65 R Green: Any amino acid 66 F White/unlabeled: Aromatic AAs 67 T Green: Any amino acid 68 D Green: Any amino acid 69 V White/unlabeled: Aliphatic AAs 70 Q Green: Any amino acid 71 F White/unlabeled: Aromatic AAs 72 Y Dark green: Y 73 E Green: Any amino acid 74 T White/unlabeled: Polar neutral AAs 75 A Green: Any amino acid 76 D Green: Any amino acid 77 P White/unlabeled: Hydrophobic AAs 78 D Green: Any amino acid 79 L Green: Any amino acid 80 A White/unlabeled: Aliphatic AAs 81 I Dark green: I 82 G White/unlabeled: G, A, or S 83 E Dark green: E 84 F White/unlabeled: Aromatic AAs 85 H Green: Any amino acid 86 G White/unlabeled: Hydrophobic or polar neutral AAs or G 87 D Green: Any amino acid 88 G White/unlabeled: Hydrophobic or polar neutral 89 V Green: Any amino acid 90 H, L Gray/aqua- Any amino acid 91 T Green: Any amino acid 92 V, A Gray/aqua- Any amino acid 93 S Green: Any amino acid 94 G Green: Any amino acid 95 G Green: Any amino acid 96 K Green: Any amino acid 97 L White/unlabeled: Hydrophobic or polar neutral AAs 98 A Green: Any amino acid 99 A, Y Gray/aqua- Any amino acid 100 D Green: Any amino acid 101 Y Pink: F or Y 102 I Dark green: I 103 S, A Gray/aqua- Any amino acid 104 V Dark green: V 105 L, W Gray/aqua- Any amino acid 106 R Green: Any amino acid 107 T White/unlabeled: Polar neutral AAs 108 R Green: Any amino acid 109 D Green: Any amino acid 110 G White/unlabeled: G, A, or S 111 Q Green: Any amino acid 112 I White/unlabeled: Aliphatic AAs 113 L Green: Any amino acid 114 L Green: Any amino acid 115 Y Pink: F or Y 116 R Dark green: R 117 V, L Gray/aqua- Any amino acid 118 F Dark green: F 119 F White/unlabeled: Aromatic, polar neutral, or basic 120 N Dark green: N 121 P White/unlabeled: Hydrophobic AAs 122 L Dark green: L 123 R Green: Any amino acid 124 V White/unlabeled: Hydrophobic, polar neutral, acidic 125 L White/unlabeled: Aliphatic AAs 126 E Green: Any amino acid 127 A, P Gray/aqua- Any amino acid 128 L Green: Any amino acid 129 G Green: Any amino acid
(49) In another embodiment, the isolated polypeptides comprise or consist of the amino acid sequence of SEQ ID NO: 5 (Table 5). In this embodiment, the polypeptides differ from those of SEQ ID NO: 4 (Table 4) in that the active/core site residues (“white”) are limited to specific amino acid residues identified in the mutational analysis as preserving or enhancing function in the deep mutational assay, and/or to residues present in the polypeptides made and tested.
(50) TABLE-US-00006 TABLE 5 SEQ ID NO: 5 Residue Alignment # AA Specificity Alternative residues 1 M White/unlabeled: M or absent 2 N Green: Any amino acid 3 A White/unlabeled: A 4 K Green: Any amino acid 5 E Green: Any amino acid 6 I White/unlabeled: I 7 V White/unlabeled: V or L 8 V Green: Any amino acid 9 H Green: Any amino acid 10 S, A Gray/aqua- Any amino acid 11 L White/unlabeled: L 12 R Green: Any amino acid 13 L White/unlabeled: L 14 L White/unlabeled: L, I 15 E Green: Any amino acid 16 N Green: Any amino acid 17 G White/unlabeled: G 18 D Green: Any amino acid 19 A White/unlabeled: A 20 R Green: Any amino acid 21 G Green Any amino acid 22 W White/unlabeled: W, Y 23 C, S Gray/aqua- Any amino acid 24 D Green: Any amino acid 25 L White/unlabeled: L 26 F White/unlabeled: F, T, Y 27 H Green: Any amino acid 28 P White/unlabeled: P 29 E Green: Any amino acid 30 G White/unlabeled: G 31 V Green: Any amino acid 32 L White/unlabeled: L or S 33 E Green: Any amino acid 34 Y Pink: F or Y 35 P White/unlabeled: P 36 Y Dark green: Y 37 A, P Gray/aqua- Any amino acid 38 P White/unlabeled: P, V 39 P White/unlabeled: P 40 G White/unlabeled: G 41 H, Y Gray/aqua- Any amino acid 42 K Green: Any amino acid 43 T White/unlabeled: T 44 R Green: Any amino acid 45 F White/unlabeled: F, H, T, Y 46 E Green: Any amino acid 47 G White/unlabeled: G 48 R Green: Any amino acid 49 E Green: Any amino acid 50 T Green: Any amino acid 51 I White/unlabeled: I 52 W Green: Any amino acid 53 A Green: Any amino acid 54 H White/unlabeled: H, C, I, T 55 M White/unlabeled: M, F, I 56 R Green: Any amino acid 57 L Green: Any amino acid 58 F White/unlabeled: F, H, A, I, P, V, W 59 P White/unlabeled: P 60 E Green: Any amino acid 61 Y Green: Any amino acid 62 V, M Gray/aqua- Hydrophobic AAs 63 T Green: Any AA 64 V, I Gray/aqua- Any amino acid 65 R Green: Any amino acid 66 F White/unlabeled: F 67 T Green: Any amino acid 68 D Green: Any amino acid 69 V White/unlabeled: V 70 Q Green: Any amino acid 71 F White/unlabeled: F 72 Y Dark green: Y 73 E Green: Any amino acid 74 T White/unlabeled: T 75 A Green: Any amino acid 76 D Green: Any amino acid 77 P White/unlabeled: P 78 D Green: Any amino acid 79 L Green: Any amino acid 80 A White/unlabeled: A 81 I Dark Green: I 82 G White/unlabeled: G 83 E Dark green: E 84 F White/unlabeled: F, A, D, W, Y 85 H Green: Any amino acid 86 G White/unlabeled: F, I, L, T G 87 D Green: Any amino acid 88 G White/unlabeled: G, A, F, I, L, N 89 V Green: Any amino acid 90 H, L Gray/aqua- Any amino acid 91 T Green: Any amino acid 92 V, A Gray/aqua- Any amino acid 93 S Green: Any amino acid 94 G Green: Any amino acid 95 G Green: Any amino acid 96 K Green: Any amino acid 97 L White/unlabeled: I, F, L, M, S, T, W, Y 98 A Green: Any amino acid 99 A, Y Gray/aqua- Any amino acid 100 D Green: Any amino acid 101 Y Pink: F or Y 102 I Dark green: I 103 S, A Gray/aqua- Any amino acid 104 V Dark green: V 105 L, W Gray/aqua- Any amino acid 106 R Green: Any amino acid 107 T White/unlabeled: T 108 R Green: Any amino acid 109 D Green: Any amino acid 110 G White/unlabeled: G 111 Q Green: Any amino acid 112 I White/unlabeled: I 113 L Green: Any amino acid 114 L Green: Any amino acid 115 Y Pink: F or Y 116 R Dark green: R 117 V, L Gray/aqua- Any amino acid 118 F Dark green: F 119 F White/unlabeled: F, G, M, R, W 120 N Dark green: N 121 P White/unlabeled: P 122 L Dark green: L 123 R Green: Any amino acid 124 V White/unlabeled: V, E, F, I, N, P, R, S, W 125 L White/unlabeled: L 126 E Green: Any amino acid 127 A, P Gray/aqua- Any amino acid 128 L Green: Any amino acid 129 G Green: Any amino acid
(51) In another embodiment, the isolated polypeptides comprise or consist of the amino acid sequence of SEQ ID NO: 6 (Table 6). In this embodiment, polypeptides differ from those of SEQ ID NO: 5 (Table 5) in that the active/core site residues (“white”) are limited to substitutions in the polypeptides made and tested in the examples that follow.
(52) TABLE-US-00007 TABLE 6 SEQ ID NO: 6 Residue Alignment # AA Specificity Alternative residues 1 M White/unlabeled: M or absent 2 N Green: Any amino acid 3 A White/unlabeled: A 4 K Green: Any amino acid 5 E Green: Any amino acid 6 I White/unlabeled: I 7 V White/unlabeled: V or L 8 V Green: Any amino acid 9 H Green: Any amino acid 10 S, A Gray/aqua- Any amino acid 11 L White/unlabeled: L 12 R Green: Any amino acid 13 L White/unlabeled: L 14 L White/unlabeled: L 15 F Green: Any amino acid 16 N Green: Any amino acid 17 G White/unlabeled: G 18 D Green: Any amino acid 19 A White/unlabeled: A 20 R Green: Any amino acid 21 G Green Any amino acid 22 W White/unlabeled: W 23 C, S Gray/aqua- Any amino acid 24 D Green: Any amino acid 25 L White/unlabeled: L 26 F White/unlabeled: F 27 H Green: Any amino acid 28 P White/unlabeled: P 29 E Green: Any amino acid 30 G White/unlabeled: G 31 V Green: Any amino acid 32 L White/unlabeled: L 33 E Green: Any amino acid 34 Y Pink: F or Y 35 P White/unlabeled: P 36 Y Dark green: Y 37 A, P Gray/aqua- Any amino acid 38 P White/unlabeled: P 39 P White/unlabeled: P 40 G White/unlabeled: G 41 H, Y Gray/aqua- Any amino acid 42 K Green: Any amino acid 43 T White/unlabeled: T 44 R Green: Any amino acid 45 F White/unlabeled: F 46 E Green: Any amino acid 47 G White/unlabeled: G 48 R Green: Any amino acid 49 E Green: Any amino acid 50 T Green: Any amino acid 51 I White/unlabeled: I 52 W Green: Any amino acid 53 A Green: Any amino acid 54 H White/unlabeled: H 55 M White/unlabeled: M 56 R Green: Any amino acid 57 L Green: Any amino acid 58 F White/unlabeled: F, H 59 P White/unlabeled: P 60 E Green: Any amino acid 61 Y Green: Any amino acid 62 V, M Gray/aqua- Hydrophobic AAs 63 T Green: Any AA 64 V, I Gray/aqua- Any amino acid 65 R Green: Any amino acid 66 F White/unlabeled: F 67 T Green: Any amino acid 68 D Green: Any amino acid 69 V White/unlabeled: V 70 Q Green: Any amino acid 71 F White/unlabeled: F 72 Y Dark green: Y 73 E Green: Any amino acid 74 T White/unlabeled: T 75 A Green: Any amino acid 76 D Green: Any amino acid 77 P White/unlabeled: P 78 D Green: Any amino acid 79 L Green: Any amino acid 80 A White/unlabeled: A 81 I Dark Green: I 82 G White/unlabeled: G 83 E Dark green: E 84 F White/unlabeled: F, Y 85 H Green: Any amino acid 86 G White/unlabeled: G 87 D Green: Any amino acid 88 G White/unlabeled: G 89 V Green: Any amino acid 90 H, L Gray/aqua- Any amino acid 91 T Green: Any amino acid 92 V, A Gray/aqua- Any amino acid 93 S Green: Any amino acid 94 G Green: Any amino acid 95 G Green: Any amino acid 96 K Green: Any amino acid 97 L White/unlabeled: LY 98 A Green: Any amino acid 99 A, Y Gray/aqua- Any amino acid 100 D Green: Any amino acid 101 Y Pink: F or Y 102 I Dark Green: I 103 S, A Gray/aqua- Any amino acid 104 V Dark green: V 105 L, W Gray/aqua- Any amino acid 106 R Green: Any amino acid 107 T White/unlabeled: T 108 R Green: Any amino acid 109 D Green: Any amino acid 110 G White/unlabeled: G 111 Q Green: Any amino acid 112 I White/unlabeled: I 113 L Green: Any amino acid 114 L Green: Any amino acid 115 Y Pink: F or Y 116 R Dark green: R 117 V, L Gray/aqua- Any amino acid 118 F Dark Green: F 119 F White/unlabeled: FW 120 N Dark green: N 121 P White/unlabeled: P 122 L Dark green: L 123 R Green: Any amino acid 124 V White/unlabeled: V, I 125 L White/unlabeled: L 126 E Green: Any amino acid 127 A, P Gray/aqua- Any amino acid 128 L Green: Any amino acid 129 G Green: Any amino acid
(53) In another embodiment, the isolated polypeptides comprise or consist of the polypeptide of SEQ ID NO: 7, which differs from SEQ ID NO: 6 (Table 6) by being limited at the surface residues (“green”) or at highly variable regions in the peptides tested (“gray/aqua”) to the residues shown in Table 7.
(54) TABLE-US-00008 TABLE 7 (SEQ ID NO: 7) Residue Alignment # AA Specificity Alternative residues 2 N Green: N, D, S, T, C 4 K Green: Charged AAs 5 E Green: Charged AAs 8 V Green: Hydrophobic or aliphatic AAs or Charged AAs 9 H Green: Charged or polar neutral AAs 10 S, A Gray/aqua- Aliphatic or polar neutral AAs 12 R Green: Charged AAs 15 E Green: Charged AAs 16 N Green: Polar neutral AAs 18 D Green: Charged AAs 20 R Green: Charged AAs 21 G Green Polar neutral AAs 23 C, S Gray/aqua- Polar neutral AAs or A 24 D Green: Charged AAs 27 H Green: Polar neutral or Charged AAs 29 E Green: Charged AAs 31 V Green: Hydrophobic or aliphatic AAs or Charged AAs 33 E Green: Charged AAs 37 A, P Gray/aqua- Hydrophobic, polar neutral, or Charged AAs 41 H, Y Gray/aqua- Hydrophobic or basic AAs 42 K Green: Charged AAs 44 R Green: Charged AAs 46 E Green: Charged AAs 48 R Green: Charged AAs 49 E Green: Charged AAs 50 T Green: Polar neutral AAs 52 W Green: Aromatic AAs or Charged AAs 53 A Green: Aliphatic AAs or Charged AAs 56 R Green: Charged AAs 57 L Green: Aliphatic AAs or Charged AAs 60 E Green: Charged AAs 61 Y Green: Aromatic AAs 62 V, M Gray/aqua- Hydrophobic or Aliphatic AAs 63 T Green: Polar neutral 64 V, I Gray/aqua- Hydrophobic AAs 65 R Green: Charged AAs 67 T Green: Polar neutral AAs 68 D Green: Charged AAs 70 Q Green: Polar neutral AAs 73 E Green: Charged AAs 75 A Green: Aliphatic AAs 76 D Green: Charged AAs 78 D Green: Charged AAs 79 L Green: Aliphatic AAs 85 H Green: Polar neutral AAs 87 D Green: Charged AAs 89 V Green: Aliphatic AAs or Charged AAs 90 H, L Gray/aqua- H, L, A, C, F, I, Q, R, S, T, V, Y 91 T Green: Polar neutral AAs or Charged AAs 92 V, A Gray/aqua- V, A, D, F, F, G, I, K, L, M, P, Q, R, S, T, W 93 S Green: Polar neutral or basic AAs 94 G Green: G, A, S 95 G Green: Polar neutral, acidic, or aromatic AAs 96 K Green: Charged AAs 98 A Green: Aliphatic AAs 99 A, Y Gray/aqua- Hydrophobic or polar neutral Aas 100 D Green: Charged AAs 103 S, A Gray/aqua- S, A, C, D, L, N, R, T, V, W 105 L, W Gray/aqua- L, W, A, F, I, K, M, S, T, V 106 R Green: Charged AAs 108 R Green: Charged AAs 109 D Green: Charged AAs 111 Q Green: Polar neutral AAs 113 L Green: Aliphatic or Charged AAs 114 L Green: Aliphatic or Charged AAs 117 V, L Gray/aqua- V, L, A, D, G, M, N, S, Y 123 R Green: Charged AAs 126 E Green: Charged AAs 127 A, P Gray/aqua- Aliphatic or polar neutral AAs 128 L Green: L, E, G, H, I, K, P, Q, R, T, V, or A 129 G Green: G, A, S
(55) In another embodiment, the isolated polypeptides comprise or consist of the polypeptide of SEQ ID NO: 8, which differs from SEQ ID NO: 6 (Table 6) by being limited at the surface residues (“green”) or at highly variable regions in the peptides tested (“gray/aqua”) to the residues shown in Table 8. In one embodiment, no more than 4 of the residues of SEQ ID NO: 8 are cysteine. In various embodiments, no more than 1, 2, or 3 of the residues of SEQ ID NO: 8 are cysteine.
(56) TABLE-US-00009 TABLE 8 (SEQ ID NO: 8) 2 N Green: N 4 K Green: K or C 5 E Green: K or C 8 V Green: V or C 9 H Green: H or C 10 S, A Gray/aqua- S, or A 12 R Green: R or C 15 E Green: E or C 16 N Green: N or C 18 D Green: D or C 20 R Green: R or C 21 G Green G or C 23 C, S Gray/aqua- C, S, T, A 24 D Green: D or C 27 H Green: H or C 29 E Green: E or C 31 V Green: V or C 33 E Green: E or C 37 A, P Gray/aqua- A, P, E, K, P, Q, R, T 41 H, Y Gray/aqua- H, Y, F, K, L, T, V, W 42 K Green: K or C 44 R Green: R or C 46 E Green: E or C 48 R Green: R or C 49 E Green: E or C 50 T Green: T or C 52 W Green: W or C 53 A Green: A or C 56 R Green: R or C 57 L Green: L or C 60 E Green: E or C 61 Y Green: Y, H, R, W 62 V, M Gray/aqua- V, M 63 T Green: T or C 64 V, I Gray/aqua- V, I, G, K, P, W 65 R Green: R or C 67 T Green: T or C 68 D Green: D or C 70 Q Green: Q or C 73 E Green: E or C 75 A Green: A or C 76 D Green: D or C 78 D Green: D or C 79 L Green: L or C 85 H Green: H or C 87 D Green: D or C 89 V Green: V or C 90 H, L Gray/aqua- H, L, A, C, F, I, Q, R, S, T, V, Y 91 T Green: T or C 92 V, A Gray/aqua- V, A, D, E, F, G, I, K, L, M, P, Q, R, S, T, W 93 S Green: S, H or C 94 G Green: G or C 95 G Green: L3: G, E, W, Y or C 96 K Green: K or C 98 A Green: A or C 99 A, Y Gray/aqua- A, Y, C, F, G, I, L, N, T, V 100 D Green: D or C 103 S, A Gray/aqua- S, A, C, D, L, N, R, T, V, W 105 L, W Gray/aqua- L, W, A, F, I, K, M, S, T, V 106 R Green: R or C 108 R Green: R or C 109 D Green: D or C 111 Q Green: Q or C 113 L Green: L or C 114 L Green: L or C 117 V, L Gray/aqua- V, L, A, D, G, M, N, S, Y 123 R Green: R or C 126 E Green: E or C 127 A, P Gray/aqua- A, P, H, I, L, S, V 128 L Green: L, E, G, H, I, K, P, Q, R, T, V, C, or A 129 G Green: G or C
(57) In another embodiment, the isolated polypeptides comprise or consist of the polypeptide of SEQ ID NO: 9, which differs from SEQ ID NO: 6 (Table 6) by being limited at the surface residues (“green”) or at highly variable regions in the peptides tested (“gray/aqua”) to the residues shown in Table 9. The residues shown in Table 9 are all present in polypeptides made/tested in the examples that follow.
(58) TABLE-US-00010 TABLE 9 (SEQ ID NO: 9) 2 N Green: N 4 K Green: K 5 E Green: K 8 V Green: V 9 H Green: H 10 S, A Gray/aqua- S 12 R Green: R 15 E Green: E 16 N Green: N 18 D Green: D 20 R Green: R 21 G Green G 23 C, S Gray/aqua- C or S 24 D Green: D 27 H Green: H 29 E Green: E 31 V Green: V 33 E Green: E 37 A, P Gray/aqua- A or P 41 H, Y Gray/aqua- H, Y, or W 42 K Green; K 44 R Green: R 46 E Green: E 48 R Green: R 49 E Green: E 50 T Green: T 52 W Green: W 53 A Green: A 56 R Green: R 57 L Green: L 60 E Green: E 61 Y Green: Y, H 62 V, M Gray/aqua- V, M 63 T Green: T 64 V, I Gray/aqua- V, I, W 65 R Green: R 67 T Green: T 68 D Green: D 70 Q Green: Q 73 E Green: E 75 A Green: A 76 D Green; D 78 D Green: D 79 L Green: L 85 H Green: H 87 D Green: D 89 V Green: V 90 H, L Gray/aqua- H, L, V 91 T Green: T or C 92 V, A Gray/aqua- V, A 93 S Green: S 94 G Green: G 95 G Green: G 96 K Green: K 98 A Green: A 99 A, Y Gray/aqua- A, Y 100 D Green: D 103 S, A Gray/aqua- S, A, T 105 L, W Gray/aqua- L, W 106 R Green: R 108 R Green: R 109 D Green: D 111 Q Green: Q 113 L Green: L 114 L Green: L 117 V, L Gray/aqua- V, L 123 R Green: R 126 E Green: E 127 A, P Gray/aqua- A, P 128 L Green: L or A 129 G Green: G
(59) In one further embodiment of any of the polypeptides of the invention, each of residues 34, 101, and 115 are Y. In this embodiment, the polypeptides of the invention show high specificity for DIG. In another embodiment of any of the polypeptides of the invention, 1, 2, or all 3 of residues 34, 101, and 115 are F. In these various embodiments, the steroid specificity of the polypeptides of the invention is shifted such that certain variants bind better to digoxigenin and others bind better to related steroids digitoxigenin, progesterone, and (β-estradiol, as described in more detail herein.
(60) In another embodiment of any of the polypeptides of the invention, residue 84 is Y. In this embodiment, polypeptides of the invention are exemplified by Dig5.1 (SEQ ID: 11), which differs in its hydrogen bonding pattern compared to the DIG10 series in that the residue that contacts the lactone ring of DIG—in the DIG10 series this is Y115, but in DIG5.1 it is Y84. In a further embodiment of this embodiment, at least one of the following is true:
(61) Residue 7 is L;
(62) Residue 41 is W;
(63) Residue 58 is H;
(64) Residue 61 is H;
(65) Residue 64 is W;
(66) Residue 90 is V;
(67) Residue 97 is Y:
(68) Residue 103 is T;
(69) Residue 115 is L;
(70) Residue 119 is W;
(71) Residue 124 is I; and/or
(72) Residue 128 is A.
(73) In various embodiments, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all 12 of the residues are as defined.
(74) In various further embodiments, the isolated polypeptide of the invention comprises or consists of a polypeptide selected from the group consisting of: (Residues in parentheses are optional)
(75) TABLE-US-00011 DIG5 (SEQ ID NO: 10) MNAKEILVHSLRLLENGDARGWCDLFHPEGVLEFPYAPPGWKTRFEGRET IWAHMRLHPEHVTVRFTDVQFYETADPDLAIGEYHGDGVVTVSGGKYAAD FITVLRTRDGQILLYRVFWNPLRALEAAG(GVEAAAKIVQGA); DIG5.1 (SEQ ID NO: 11) MNAKEILVHSLRLLENGDARGWCDLFHPEGVLEYPYAPPGWKTRFEGRET IWAHMRLHPEHVTWRFTDVQFYETADPDLAIGEYHGDGVVTVSGGKYAAD YITVLRTRDGQILLLRVFWNPLRILEAAG(GVEAAAKIVQGA); DIG10 (SEQ ID NO: 12) MNAKEIVVHSLRLLENGDARGWCDLFHPEGVLEYPYAPPGHKTRFEGRET IWAHMRLFPEYVTVRTFTDVQFYETADPDLAIGEFHGDGVHTVSGGKLAA DYISVLRTRDGQILLYRVFFNPLRVLEALG(GVEAAAKIVQGA); DIG10.1 (SEQ ID NO: 13) MNAKEIVVHALRLLENGDARGWCDLFHPEGVLEYPYAPPGHKTRFEGRET IWAHMRLFPEYMTIRETDVQFYETADPDLAIGEFHGDGVHTVSGGKLAAD YISVLRTRDOQILLYRLFFNPLRVLEPLG(GVEAAAKIVQGA); DIG10.2 (SEQ ID NO: 14) MNAKEIVVHALRLLENGDARGWCDLFHPEGVLEYPYPPPGYKTRFEGRET IWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVHTVSGGKLAAD YISVLRTRDGQILLYRLFFNPLRVLEPLG(GVEAAAKAQGA); DIG10.3 (SEQ ID NO: 15) MNAKEIVVHALRLLENGDARGWSDLFHPEGVLEYPYPPPGYKTRFEGRET IWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVLTASGGKLAYD YIAVWRTRDGQILLYRLFFNPLRVLEPLG(GVEAAAKIVQGA); DIG10.2.sub.t (SEQ ID NO: 16) MNAKEIVVHALRLLENGDARGWCDLFHPEGVLEYPYPPPGYKTRFEGRET IWAHMRLFPEYMTIRFTDCQFYETADPDLAIGEFHGDGVHTVSGGKLAAD YISVLRTRDGQILLYRLFFNPLRVLEPLG DIG10.3.sub.t (SEQ ID NO: 17) MNAKEIVVHALRLLENGDARGWSDLFHPEGVLEYPYPPPGYKTRFEGRET IWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVLTASGGKLAYD YIAVWRTRDGQILLYRLFFNPLRVLEPLG DIG10.3 Y99F (SEQ ID NO: 18) MNAKEIVVHALRLLENGDARGWSDLFHPEGVLEYPYPPPGYKTRFEGRET IWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVLTASGGKLAFD YIAVWRTRDGQILLYRLFFNPLRVLEPLG(GVEAAAKIVQGA); DIG10.3 Y101F (SEQ ID NO: 19) MNAKEIVVHALRLLENGDARGWSDLFHPEGVLEYPYPPPGYKTRFEGRET IWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVLTASGGKLAYD FIAVWRTRDGQILLYRLFFNPLRVLEPLG(GVEAAAKIVQGA); DIG10.3 Y115F (SEQ ID NO: 20) MNAKEIVVHALRLLENGDARGWSDLFHPEGVLEYPYPPPGYKTRFEGRET IWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVLTASGGKLAYD YIAVWRTRDGQILLFRLFFNPLRVLEPLG(GVEAAAKIVQGA); DIG10.3 Y99F/Y101F (SEQ ID NO: 21) MNAKEIVVHALRLLENGDARGWSDLFHPEGVLEYPYPPPGYKTRFEGRET IWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVLTASGGKLAFD FIAVWRTRDGQILLYRLFFNPLRVLEPLG(GVEAAAKIVQGA); DIG10.3 Y34E/Y99F/Y101F (SEQ ID NO: 22) MNAKEIVVHALRLLENGDARGWSDLFHPEGVLEFPYPPPGYKTRFEGRET IWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVLTASGGKLAFD FIAVWRTRDGQILLYRLFFNPLRVLEPLG(GVEAAAKIVQGA); and DIG10.3 Y34F/Y99F/Y101F/Y115F (SEQ. ID NO: 23) MNAKEIVVHALRLLENGDARGWSDLFHPEGVLEFPYPPPGYKTRFEGRET IWAHMRLFPEYMTIRFTDVQFYETADPDLAIGEFHGDGVLTASGGKLAFD FIAVWRTRDGQILLFRLFFNPLRVLEPLG(GVEAAAKIVQGA).
(76) As used throughout the present application, the term “polypeptide” is used in its broadest sense to refer to a sequence of subunit amino acids. The polypeptides of the invention may comprise L-amino acids, D-amino acids (which are resistant to L-amino acid-specific proteases in vivo), or a combination of D- and L-amino acids. The polypeptides described herein may be chemically synthesized or recombinantly expressed. The polypeptides may be linked to other compounds to promote an increased half-life in vivo, such as by PEGylation, HESylation, PASylation, glycosylation, etc. Such linkage can be covalent or non-covalent as is understood by those of skill in the art.
(77) In a further embodiment, the polypeptides of any embodiment of any aspect of the invention may further comprise a tag, such as a detectable moiety. The tag(s) can be linked to the polypeptide through covalent bonding, including, but not limited to, disulfide bonding, hydrogen bonding, electrostatic bonding, nucleophilc (i.e. Cys, Lys) conjugation chemistry, recombinant fusion and conformational bonding. Alternatively, the tag(s) can be linked to the polypeptide by means of one or more linking compounds. Techniques for conjugating tags to polypeptides are well known to the skilled artisan. Polypeptides comprising a detectable tag can be used diagnostically to, for example, identify the presence of digoxin or other steroid in a sample of interest. However, they may also be used for other detection and/or analytical and/or diagnostic purposes. Any suitable detection tag can be used, including but not limited to enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals, and nonradioactive paramagnetic metal ions. The tag used will depend on the specific detection/analysis/diagnosis techniques and/or methods used such as immunohistochemical staining of (tissue) samples, flow cytometric detection, scanning laser cytometric detection, fluorescent immunoassays, enzyme-linked immunosorbent assays (ELISAs), radioimmunoassays (RIAs), bioassays (e.g., neutralization assays), Western blotting applications, etc. For immunohistochemical staining of tissue samples preferred tags are enzymes that catalyze production and local deposition of a detectable product. Enzymes typically conjugated to polypeptides to permit their immunohistochemical visualization are well known and include, but are not limited to, acetylcholinesterase, alkaline phosphatase, beta-galactosidase, glucose oxidase, horseradish peroxidase, and urease. Typical substrates for production and deposition of visually detectable products are also well known to the skilled person in the art. The polypeptides can be labeled using colloidal gold or they can be labeled with radioisotopes, such as .sup.33P, .sup.32p, .sup.35S, .sup.3H, and .sup.125I. Polypeptides of the invention can be attached to radionuclides directly or indirectly via a chelating agent by methods well known in the art.
(78) When the polypeptides of the invention are used for flow cytometric detections, scanning laser cytometric detections, or fluorescent immunoassays, the tag may comprise, for example, a fluorophore. A wide variety of fluorophores useful for fluorescently labeling the polypeptides of the invention are known to the skilled artisan. When the polypeptides are used for in vivo diagnostic use, the tag can comprise, for example, magnetic resonance imaging (MRI) contrast agents, such as gadolinium diethylenetriaminepentaacetic acid, to ultrasound contrast agents or to X-ray contrast agents, or by radioisotopic labeling.
(79) The polypeptides of the invention can also be attached to solid supports, which are particularly useful for in vitro assays or purification of digoxin or other steroids. Such solid supports might be porous or nonporous, planar or nonplanar and include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene supports. The polypeptides can also, for example, usefully be conjugated to filtration media, such as NHS-activated Sepharose or CNBr-activated Sepharose for purposes of affinity chromatography. They can also usefully be attached to paramagnetic microspheres, typically by biotin-streptavidin interaction. As another example, the polypeptides of the invention can usefully be attached to the surface of a microtiter plate for ELISA.
(80) In another aspect, the present invention provides pharmaceutical compositions, comprising one or more polypeptides of the invention and a pharmaceutically acceptable carrier. In this embodiment, the polypeptides of the invention may be used, for example, to treat digoxin overdoses. The pharmaceutical composition may comprise in addition to the polypeptide of the invention (a) a lyoprotectant; (b) a surfactant; (c) a bulking agent; (d) a tonicity adjusting agent; (e) a stabilizer: (f) a preservative and/or (gi a buffer.
(81) In some embodiments, the buffer in the pharmaceutical composition is a Tris buffer, a histidine buffer, a phosphate buffer, a citrate buffer or an acetate buffer. The pharmaceutical composition may also include a lyoprotectant. e.g. sucrose, sorbitol or trehalose. In certain embodiments, the pharmaceutical composition includes a preservative e.g. benzalkonium chloride, benzethonium, chlorohexidine, phenol, m-cresol, benzyl alcohol, methylparaben, propylparaben, chlorobutanol, o-cresol, p-cresol, chlorocresol, phenylmercuric nitrate, thimerosal, benzoic acid, and various mixtures thereof. In other embodiments, the pharmaceutical composition includes a bulking agent, like glycine. In yet other embodiments, the pharmaceutical composition includes a surfactant e.g., polysorbate-20, polysorbate-40, polysorbate-60, polysorbate-65, polysorbate-80 polysorbate-85, poloxamer-188, sorbitan monolaurate, sorbitan monopalmitate, sorbitan monostearate, sorbitan monooleate, sorbitan trilaurate, sorbitan tristearate, sorbitan trioleaste, or a combination thereof. The pharmaceutical composition may also include a tonicity adjusting agent, e.g., a compound that renders the formulation substantially isotonic or isoosmotic with human blood. Exemplary tonicity adjusting agents include sucrose, sorbitol, glycine, methionine, mannitol, dextrose, inositol, sodium chloride, arginine and arginine hydrochloride. In other embodiments, the pharmaceutical composition additionally includes a stabilizer, e.g., a molecule which, when combined with a protein of interest substantially prevents or reduces chemical and/or physical instability of the protein of interest in lyophilized or liquid form. Exemplary stabilizers include sucrose, sorbitol, glycine, inositol, sodium chloride, methionine, arginine, and arginine hydrochloride.
(82) In a further aspect, the present invention provides isolated nucleic acids encoding a polypeptide of the present invention. The isolated nucleic acid sequence may comprise RNA or DNA. As used herein, “isolated nucleic acids” are those that have been removed from their normal surrounding nucleic acid sequences in the genome or in cDNA sequences. Such isolated nucleic acid sequences may comprise additional sequences useful for promoting expression and/or purification of the encoded protein, including but not limited to polyA sequences, modified Kozak sequences, and sequences encoding epitope tags, export signals, and secretory signals, nuclear localization signals, and plasma membrane localization signals. It will be apparent to those of skill in the art, based on the teachings herein, what nucleic acid sequences will encode the polypeptides of the invention.
(83) In another aspect, the present invention provides recombinant expression vectors comprising the isolated nucleic acid of any aspect of the invention operatively linked to a suitable control sequence. “Recombinant expression vector” includes vectors that operatively link a nucleic acid coding region or gene to any control sequences capable of effecting expression of the gene product. “Control sequences” operably linked to the nucleic acid sequences of the invention are nucleic acid sequences capable of effecting the expression of the nucleic acid molecules. The control sequences need not be contiguous with the nucleic acid sequences, so long as they function to direct the expression thereof. Thus, for example, intervening untranslated yet transcribed sequences can be present between a promoter sequence and the nucleic acid sequences and the promoter sequence can still be considered “operably linked” to the coding sequence. Other such control sequences include, but are not limited to, polyadenylation signals, termination signals, and ribosome binding sites. Such expression vectors can be of any type known in the art, including but not limited plasmid and viral-based expression vectors. The control sequence used to drive expression of the disclosed nucleic acid sequences in a mammalian system may be constitutive (driven by any of a variety of promoters, including but not limited to, CMV, SV40, RSV, actin, EF) or inducible (driven by any of a number of inducible promoters including, but not limited to, tetracycline, ecdysone, steroid-responsive). The construction of expression vectors for use in transfecting prokaryotic cells is also well known in the art, and thus can be accomplished via standard techniques. (See, for example, Sambrook, Fritsch, and Maniatis, in: Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1989; Gene Transfer and Expression Protocols, pp. 109-128, ed. E. J. Murray, The Humana Press Inc., Clifton, N.J.), and the Ambion 1998 Catalog (Ambion, Austin, Tex.). The expression vector must be replicable in the host organisms either as an episome or by integration into host chromosomal DNA. In a preferred embodiment, the expression vector comprises a plasmid. However, the invention is intended to include other expression vectors that serve equivalent functions, such as viral vectors.
(84) In a still further aspect, the present invention provides host cells that have been transfected with the recombinant expression vectors disclosed herein, wherein the host cells can be either prokaryotic (such as bacteria) or eukaryotic. The cells can be transiently or stably transfected. Such transfection of expression vectors into prokaryotic and eukaryotic cells can be accomplished via any technique known in the art, including but not limited to standard bacterial transformations, calcium phosphate co-precipitation, electroporation, or liposome mediated-, DEAE dextran mediated-, polycationic mediated-, or viral mediated transfection. (See, for example, Molecular Cloning: A Laboratory Manual (Sambrook, et al., 1989, Cold Spring Harbor Laboratory Press; Culture of Animal Cells: A Manual of Basic Technique, 2.sup.nd Ed. (RI. Freshney. 1987. Liss, Inc. New York, N.Y.). A method of producing a polypeptide according to the invention is an additional part of the invention. The method comprises the steps of (a) culturing a host according to this aspect of the invention under conditions conducive to the expression of the polypeptide, and (b) optionally, recovering the expressed polypeptide.
(85) In another aspect, the invention provides methods for treating digoxin overdose and/or toxicity, comprising administering to a subject in need thereof an amount effective of one or more polypeptides or pharmaceutical compositions of the invention to treat the digoxin toxicity. Digitalis or its constituents, digoxin and digitoxin, are the primary cardiotonic steroids that are used to treat cardiac arrhythmias, cardiac insufficiency and congestive heart failure. Digoxin and digitoxin have narrow therapeutic ranges (1.0-1.9 nmol/L or approximately 0.8-1.5 ng/ml serum digoxin concentration) and overdose is not uncommon. Digoxin overdose and/or life-threatening digoxin toxicity are treated in the methods of the invention through the administration of one or more of the polypeptides of the invention that counteract the effects of digoxin or digitalis by binding to digoxin thereby preventing it from inhibiting or regulating the expression or function of Na.sup.+/K.sup.+ ATPase. In a preferred embodiment, each of residues 34, 101, and 115 of the polypeptide are Y. In this embodiment, the polypeptides of the invention show high specificity for DIG.
(86) The subject may be any subject suffering from or at risk of suffering from digoxin overdose and/or toxicity, including but not limited to subjects being treated with digitalis or digoxin for cardiac arrhythmias, cardiac insufficiency and congestive heart failure. The subject may be a mammal, such as a human. As used herein, “treating” means to provide any clinical benefit in reducing digoxin toxicity or the effects of digoxin overdose.
(87) As used herein, an “amount effective” refers to an amount of the polypeptide that is effective for treating the digoxin overdose and/or toxicity. The pharmaceutical composition, such as those disclosed above, and can be administered via any suitable route, including orally, parentally, by inhalation spray, rectally, or topically in dosage unit formulations containing conventional pharmaceutically acceptable carriers, adjuvants, and vehicles. The term parenteral as used herein includes, subcutaneous, intravenous, intra-arterial, intramuscular, intrasternal, intratendinous, intraspinal, intracranial, intrathoracic, infusion techniques or intraperitoneally. Dosage regimens can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). Dosage regimens can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). A suitable dosage range may, for instance, be 0.1 ug/kg-100 mg/kg body weight; alternatively, it may be 0.5 ug/kg to 50 mg/kg; 1 ug/kg to 25 mg/kg, or 5 ug/kg to 10 mg/kg body weight. The polypeptides can be delivered in a single bolus, or may be administered more than once (e.g., 2, 3, 4, 5, or more times) as determined by an attending physician.
(88) In another aspect, the invention provides methods for detecting digoxin, comprising contacting a sample of interest with a detectable polypeptide of the invention under suitable conditions for binding the detectable polypeptide to digoxin present in the sample to form a polypeptide-digoxin binding complex, and detecting the polypeptide-digoxin binding complex. In one embodiment, the sample is a biological sample, including but not limited to blood, serum, nasal secretions, tissue or other biological material from a subject to be tested. The polypeptides of the invention for use in this aspect may comprise a conjugate as disclosed above, to provide a tag useful for any detection technique suitable for a given assay. The tag used will depend on the specific detection/analysis/diagnosis techniques and/or methods used. The methods may be carried out in solution, or the polypeptide(s) of the invention may be bound or attached to a carrier or substrate, e.g., microtiter plates (ex: for ELISA), membranes and beads, etc. Carriers or substrates may be made of glass, plastic (e.g., polystyrene), polysaccharides, nylon, nitrocellulose, or teflon, etc. The surface of such supports may be solid or porous and of any convenient shape.
(89) In one non-limiting embodiment, polypeptides with an Y residue at positions 34, 99, and 101 (including but not limited to Dig10.3 (SEQ ID NO:15) may be used in assays for detecting DIG and/or digoxin and/or distinguishing them from other steroids. In other non-limiting embodiments, (a) polypeptides with an F residue at position 101, a Y residue at position 34, and a F or Y at position 99 (including but not limited to DIG10.3 Y101F (SEQ ID NO:19)) may be used for detecting digitoxigenin and/or distinguishing it from other steroids (such as from DIG, digoxin, or progesterone); (b) polypeptides with an F residue at each of residues 34 and 101, and either Y or F at position 99 (including but not limited to DIG10.3 Y34F/Y99F/Y101F (SEQ ID NO:23)) may be used to detect digitoxigenin and/or progesterone, and/or to distinguish them from other steroids (such as from DIG or digoxin).
EXAMPLE 1
(90) We developed a computational method for designing ligand binding proteins with three properties characteristic of naturally occurring binding sites: (1) specific energetically favorable hydrogen bonding and van der Waals interactions with the ligand. (2) high overall shape complementarity to the ligand, and (3) structural pre-organization in the unbound protein state, which minimizes entropy loss upon ligand binding.sup.15,16. To program in specific interactions with the small molecule, disembodied binding sites are created by positioning amino acid side chains around the ligand in orientations optimal for hydrogen bonding and other energetically favorable interactions and then placed at geometrically compatible binding sites in a set of scaffold protein structures. The surrounding side chain identities and conformations are then optimized to generate additional protein-ligand interactions and buttressing protein-protein interactions (
(91) We used the method to design proteins that bind the steroid digoxigenin (DIG), the aglycone of digoxin, a cardiac glycoside used to treat heart disease.sup.18, and a commonly used non-radioactive biomolecular labeling reagent.sup.19. Anti-DIG antibodies are routinely administered to treat overdoses of digoxin, which has a narrow therapeutic window.sup.20, and are used widely to detect biomolecules in applications such as fluorescence in situ hybridization.sup.19. We created idealized DIG binding sites with hydrogen bonds from Tyr or His to the lactone carbonyl oxygen and both hydroxyl groups of DIG and hydrophobic packing interactions between Tyr, Phe, or Trp and the steroid ring system (
(92) Binding of the designed proteins to DIG was probed by yeast surface display.sup.21 and flow cytometry using biotinylated DIG-functionalized bovine serum albumin (DIG-BSA) or ribonuclease (DIG-RNase). DIG5 and DIG10 bound to both labels (
(93) To provide feedback for improving the overall design methodology and to evaluate the contribution of each residue in the DIG10.1a binding site, we used next generation sequencing to generate a comprehensive binding fitness map.sup.22-24. A library of variants with ˜1-3 substitutions at 39 designed interface positions in Dig10.1a was generated using doped oligonucleotide mutagenesis, displayed on yeast, and subjected to selections using a monovalent DIG-PEG.sub.3-biotin conjugate (
(94) Combination of the most highly enriched substitutions in a library followed by selections led to DIG10.3 (
(95) The crystal structures of DIG10.2 and DIG10.3 in complex with DIG were solved to 2.05 Å and 3.2 Å resolution, respectively (
(96) We assessed the binding specificity of DIG10.3 by determining binding affinities for a series of related steroids by equilibrium competition fluorescence polarization assays. Experiments with DIG, digitoxigenin, progesterone, and β-estradiol showed a decrease in affinity corresponding to the loss of one, two, and three hydrogen bonds respectively (assuming ˜1.8 kcal/mol per hydrogen bond.sup.25), as expected from the structure if these compounds bind in the same orientation as DIG (
(97) TABLE-US-00012 TABLE 10 Specificity-swapped DIG10.3 Variants: Variant Steroid Inhibition Constant (K.sub.i) DIG10.3 Digoxigenin (DIG) 653 ± 262 pM digitoxigenin 19 ± 7 nM progesterone 243 ± 91 nM β-estradiol 2.1 ± 0.8 μM digoxin 223 ± 105 pM DIG10.3 Y101F Digoxigenin (DIG) 39 ± 8 nM digitoxigenin <3.8 nM progesterone 30 ± 9 nM β-estradiol 1.7 ± 0.4 μM DIG10.3 Y34F Digoxigenin (DIG) 59 ± 6 nM digitoxigenin 714 ± 79 nM progesterone 76 ± 14 nM β-estradiol 15 ± 2 μM DIG10.3 Digoxigenin (DIG) 580 ± 229 nM Y34F/Y99F/Y101F digitoxigenin <16 nM progesterone <17 nM β-estradiol 1.6 ± 0.6 μM
(98) Comparison of the properties of successful and unsuccessful designs provides a test of the hypotheses underlying the design methodology. While all 17 designed proteins by construction had high computed shape complementarity to DIG, the DIG10 design, which had the highest affinity for DIG, had the most favorable computed ligand interaction energy and was predicted to have the most pre-organized binding site (
(99) The binding fitness landscape in combination with the x-ray co-crystal structures highlight the importance of second shell interactions in stabilizing binding competent conformations. The fitness landscape favors substitution of Leu105, adjacent to the key hydrogen-bonding residue Tyr115, to Trp or other large hydrophobic residues (
(100) The DIG binding affinity of DIG0.3 is within a factor of two of that of the widely used anti-DIG antibodies.sup.20, and as it is very stable and can be expressed at high levels in bacteria it could provide more cost-effective alternative. With continued improvement in the methodology from feedback from experimental results, computational protein design should provide an increasingly powerful approach to creating a new generation of small molecule receptors for synthetic biology, therapeutic scavengers for toxic compounds, and robust binding domains for diagnostic devices.
(101) Methods Summary
(102) Design calculations were performed using RosettaMatch.sup.28 to incorporate five pre-selected interactions to DIG into a set of 401 scaffolds. RosettaDesign.sup.29 was then used to optimize each binding site sequence for maximal ligand binding affinity. Designs having high interface energy, shape complementarity, and binding site pre-organization were selected for experimental characterization.
(103) Designs were displayed on the surface of yeast strain EBY100 and examined for binding to a mixture of 2.7 μM biotinylated DIG-conjuated BSA or DIG-conjugated RNase and streptavidin-phycoerythrin on an Accuri C6 flow cytometer. Binding clones from yeast-surface displayed libraries based on DIG10 were selected using highly avid DIG-BSA or DIG-RNase or monovalent DIG-conjugated biotin on a Cytopeia inFlux cell sorter. DIG10.1a-derived library DNA was sequenced in paired-end mode on an Illumina MiSeq.
(104) Proteins were expressed in E. coli Rosetta 2 (DE3) cells with a C-terminal TEV protease cleavable His.sub.6 tag for biochemical assays. For crystallographic analysis of DIG10 variants, a 12-amino acid structurally disordered C-terminus deriving from the scaffold protein 1z1s was replaced directly with a His.sub.6 tag. Binding affinities were determined by equilibrium fluorescence polarization.sup.30 on a SpectraMax M5e microplate reader by monitoring the anisotropy of DIG-conjugated Alexa488 as a function of protein concentration. Equilibrium fluorescence polarization competition assays were performed by examining the effect of increasing concentrations of unlabeled DIG, digitoxigenin, progesterone, and β-estradiol on the anisotropy of designed protein-DIG-conjugated Alexa488 complex.
(105) Methods
(106) Computational methods. Full details for all computational methods are given in Supplementary Methods. Example command lines and RosettaScripts.sup.31 design protocols are provided in Supplementary Data. Source code is freely available to academic users through the Rosetta Commons agreement. Design models, the scaffold library, and scripts for running design calculation are provided on the Baker lab website.
(107) Matching. A set of 401 scaffolds was searched for backbones that can accommodate five pre-defined side chain interactions with DIG using RosettaMatch.sup.2. This set contained scaffolds previously used for design projects within our lab.sup.33-35 as well as structural homologs of a subset of these scaffolds that are known to tolerate mutations. Rosetta sequence design. Two successive rounds of sequence design were employed. The purpose of the first was to maximize binding affinity for the ligand.sup.36. The goal of the second was to minimize protein destabilization due to aggressive scaffold mutagenesis while maintaining the binding interface designed during the first round. During the latter round, ligand-protein interactions were up-weighted by a factor of 1.5 relative to intra-protein interactions to ensure that binding energy was preserved. Two different criteria were used to minimize protein destabilization: (1) native scaffold residues identities were favored by 1.5 Rosetta energy units (Reu), and (2) no more than five residues were allowed to change from residue types observed in a multiple sequence alignment (MSA) of the scaffold if (a) these residues were present in the MSA with a frequency greater than 0.6 and, (b) if the calculated ΔΔG for mutation of the scaffold residue to alanine.sup.37 was greater than 1.5 Reu in the context of the scaffold sequence. In some design calculations, identities of the matched hydrogen bonding residues were allowed to vary subject to the MSA and ΔΔG criteria described above. Designs having fewer than three hydrogen bonds between the protein and the ligand were rejected.
(108) Design evaluation. Designs were evaluated on interface energy, shape complementarity, and apo-protein binding site pre-organization. The latter was enforced by two metrics: (1) explicitly introducing second-shell amino acids that hold the pre-selected residues in place using Foldit.sup.38, and (2) eliminating designs having rotamer Boltzmann probabilities.sup.39<0.1 for more than one of the hydrogen bonding residues (Supplementary Table 5). All designs were evaluated for local sequence secondary structure compatibility, and those predicted to have backbone conformations that varied by >0.8 Å from their native scaffold were rejected (see Supplementary Methods).
(109) General experimental methods. Detailed procedures for the syntheses of DIG-BSA-biotin, DIG-RNase-biotin, DIG-PEG.sub.3-biotin, and DIG-PEG.sub.3-Alexa488, as well as protein expression, purification, and crystallization, cloning, and mutagenesis methods are given in Supplementary Methods. Details about fluorescence polarization binding assays, gel filtration analysis, and protein stability measurements are also provided in Supplementary Methods. Yeast surface display. Designed proteins were tested for binding using yeast-surface display.sup.40. Yeast surface protein expression was monitored by binding of anti-cmyc FITC to the C-terminal myc epitope tag of the displayed protein. DIG binding was assessed by quantifying the phycoerythrin (PE) fluorescence of the displaying yeast population following incubation with DIG-BSA-biotin, DIG-RNase-biotin, or DIG-PEG.sub.3-biotin, and streptavidin-phycoerythrin (SAPE). In a typical experiment using DIG-BSA-biotin or DIG-RNase-biotin, cells were resuspended in a premixed solution of PBSF (PBS+1 g/L of BSA) containing a 1:100 dilution of anti-cmyc FITC, 2.66 M DIG-BSA-biotin or DIG-RNase biotin, and 664 nM SAPE for 2-4 hr incubation at 4° C. Cellular fluorescence was monitored on an Accuri C6 flow cytometer using a 488 nm laser for excitation and a 575 nm band pass filter for emission. Phycoerythrin fluorescence was compensated to minimize bleed-over contributions from the FITC channel. Competition assays with free digoxigenin were performed as above except that between 750 μM and 1.5 mM of digoxigenin was added to each labeling reaction mixture. Full details are given in Supplementary Methods.
(110) Affinity maturation. Detailed procedures for constructing and selecting all libraries, including those for deep sequencing, are provided in Supplementary Methods. Yeast surface display library selections were conducted on a Cytopeia inFlux cell sorter using increasingly stringent fluorescence gates. In all labeling reactions for selections, care was taken to maintain at least a 10-fold molar excess of label to cell surface protein. Cell surface protein molarity was estimated by assuming that an O.D..sub.600 of 1.0=1e7 cells/mL and each cell displays 50,000 copies of protein.sup.40. For each round of sorting, we sorted at least 10 times the theoretical library size. FlowJo software v. 7.6 was used to analyze all data.
(111) Next-generation sequencing. Two sequencing libraries based on DIG10.1a were assembled by recursive PCR: an N-terminal library (fragment 1 library) and a C-terminal library (fragment 2 library). To introduce mutations, we used degenerate PAGE-purified oligos in which 39 selected positions within the binding site were doped with a small amount of each non-native base at a level expected to yield 1-2 mutations per gene (TriLink BioTechnologies). Yeast cells were transformed with DNA insert and restriction-digested pETCON.sup.41. Surface protein expression was induced.sup.40 and cells were labeled with anti-cymc-FITC and sorted for protein expression. Expressing cells were recovered, induced, labeled with 100 nM of DIG-PEG.sub.3-biotin for >3 hrs at 4° C. and then SAPE and anti-cymc-FITC for 8 min at 4° C., and then sorted. For each library, clones having binding signals higher than that of DIG10.1a were collected (
(112) Library DNA was prepared as described.sup.42. Illumina adapter sequences and unique library barcodes were appended to each library pool by PCR amplification using population-specific primers. DNA was sequenced in paired-end mode on an Illumina MiSeq using a 300-cycle reagent kit and custom primers (see Supplementary Methods). Of a total 5,630,105 paired-end reads, 2,531,653 reads were mapped to library barcodes. For each library, paired end reads were fused and filtered for quality (Phred≧30). The resulting full-length reads were aligned against DIG10.1a using Enrich.sup.43. For single mutations having ≧7 counts in the original input library, a relative enrichment ratio between the input library and each selected library was calculated.sup.42,44,45. The effect of each amino acid substitution at 39 binding site residues on binding (ΔE.sub.i.sup.x) is given as the log base 2 frequency of observing mutation x at position i in the selected versus the unselected population, relative to that of the DIG10.1a residue (orig) at position i:
(113)
(114) Fluorescence polarization binding assays. Fluorescence polarization-based affinity measurements of designs and their evolved variants were performed as described.sup.46 using Alexa488-conjugated DIG (DIG-PEG.sub.3-Alexa488). Fluorescence anisotropy (r) was measured in 96-well plate format on a SpectraMax M5e microplate reader (Molecular Devices) with λ.sub.ex=485 nM and λ.sub.em=538 nM using a 515 nm emission cutoff filter. Fluorescence polarization equilibrium competition binding assays were used to determine the binding affinities of DIG10.3 and its variants for unlabeled digoxigenin, digitoxigenin, progesterone, β-estradiol, and digoxin. The inhibition constant for each protein-ligand interaction, K.sub.i, was calculated from the measured total unlabeled ligand producing 50% binding signal inhibition (I.sub.50) and the K.sub.d of the protein-label interaction according to a model accounting for receptor-depletion conditions.sup.46.
(115) Supplementary Methods
(116) Computational Methods. Digoxigenin binders were designed using an updated version.sup.1 of RosettaMatch.sup.2 to search for PDB scaffold backbones that can accommodate pre-defined interactions to the ligand followed by RosettaDesign.sup.3 to optimize the binding site amino acid sequences of the matches for ligand binding affinity.
(117) Generation of ligand and ligand conformer library. The 3-dimensional structure of digoxigenin (DIG) was obtained from PDB ID 1LKE.sup.4. Because our experimental validation and selection methods rely on the presence of a linker that connects the O5 hydroxyl of the DIG molecule to either biotin or carrier protein, we included this linker in our ligand model. Linker atoms were added to DIG using the Build functionality of MacPyMOL (Schrödinger, LLC).
(118) A ligand conformer library was generated by sampling conformations around the C3-O5 and N1-C26 bonds at −60°±30°, 60°±30°, and 180°±30°. Conformers were rejected if there were significant clashes within the molecule by using an intra_fa_rep cutoff value of 0.25 Rosetta energy units (Reu). Although the lactone-cardenoline bond (C17-C20) of the steroid is freely rotatable in solution, we restricted this torsion angle to that found in PDB ID 1LKE and PDB ID 1IGJ for simplicity.
(119) Scaffold selection. A set of 401 scaffolds was generated for use as input structures for matching. This set contained scaffold proteins previously used for enzyme design projects within our lab.sup.5-7 as well as structural homologs.sup.8 of a subset of these scaffolds (PDB codes 1m4w, 1oho, 1a53, 1dl3, 1e1a and 1thf) having a DALI Z-score cutoff value of 8 from the input search model. These five scaffolds were chosen because of previous enzyme-design successes in these fold classes.sup.5-7 and/or because of their thermostability. Directed evolution experiments have shown that more stable scaffolds can acquire new functions more easily than their less stable counterparts.sup.9,10. All scaffolds are <350 amino acids, have been expressed previously in E. coli, and were stripped of their cognate bound small molecules and water molecules before use. To identify residue positions to be used for matching in the homolog scaffolds, each homolog crystal structure was superimposed on that of its parent scaffold using the CEAlign plug-in of the PyMOL molecular visualization program, and then homolog residue positions within 5.0 Å of any ligand heavy atom present in the parent scaffold were identified. For PDBs 1a53, 1d13 and 1oho, ligands present in the crystal structures were used in this search. For 1m4w, 1e1a and 1thf, ligand positions from the computational design models of a retroaldolase (RA60).sup.5, a Diels-Alderase (DA_20).sup.7, and a Kemp Eliminase (KE_007).sup.6 were used, respectively.
(120) Geometric placement of ligand using a set of pre-selected interactions (matching). Geometric criteria for enforcing binding site interactions were determined by inspecting structures of digoxin bound to the anti-digoxigenin antibody 26-10, PDB ID 1IGJ.sup.11, and of digoxigenin bound to the engineered lipocalin DigA16, PDB ID 1LKE.sup.4. From these structures we defined five interface criteria: (1) hydrogen bond between the lactone carbonyl oxygen O1 and a Tyr side chain, (2) hydrogen bond between the O2 hydroxyl and a histidine or Tyr side chain, (3) hydrogen bond between the O3 hydroxyl and a His or Tyr side chain, (4) hydrophobic packing interaction on the top face of the ligand, and (5) hydrophobic packing interaction on the bottom face of the ligand. Two active site configurations were specified: one having Tyr, Tyr, His, Phe/Tyr, and Phe/Tyr/Trp satisfying design criteria 1-5 (DIG_yyhff), and one having Tyr, His, His, Phe/Tyr/Trp, and Tyr/Trp satisfying design criteria 1-5 (DIG_yhhff).
(121) Geometric criteria were defined using six degrees of freedom between the ligand and the desired interacting side chain using a matching constraints file.sup.1. Extra rotamer sampling (two half step standard deviations) was performed around all side chain torsion angles. To enforce burial of the lactone head group within a binding pocket, we considered only those residue positions in the binding site that had a minimum of 14 neighboring residues during matching for constraint 1 (hydrogen bond to the lactone carbonyl oxygen). A neighbor was defined as a residue having Cα within 10 Å of the Cα of the binding site position under consideration. Secondary matching.sup.1 was used for constraints 3, 4, and 5. To eliminate high-energy rotamer conformations, a maximum Dunbrack energy (fa_dun) cutoff of 4.5 Reu (unweighted) was used while building rotamers for all constraints. Using these matching criteria, 29,274 and 30,861 matches were found for DIG_yyhff and DIG_yhhff, respectively.
(122) Rosetta sequence design. Active site amino acid sequences of each match were designed to maximize binding affinity to the ligand according to the Rosetta energy function using the enzdes weights set for the energy terms.sup.1,12. Explicit electrostatics were not used. Design moves were followed by steepest descent gradient minimization in which side chain degrees of freedom and the relative orientation of the ligand with respect to the protein were allowed to minimize freely.sup.13 but backbone minimization was restricted such that Cα atoms were only allowed to move ≦0.05 Å from their pre-minimization positions. Internal torsions of the ligand were allowed to minimize but were constrained to be within 5 degrees of their initial values
(123) Two successive rounds of sequence design were used to generate designs. The purpose of the first round was to maximize binding affinity for the ligand.sup.1. To prevent destabilization of the apo-protein that can result from mutating potentially stabilizing residues having side chains important for core packing, aromatic residues in the scaffold were only allowed to mutate to other aromatics during this round of design.
(124) After the first round, a second round of binding site sequence design was performed on the output files of the first round. The goal of this round was to optimize protein stability while maintaining the binding interface designed during the first round as much as possible. Ligand-protein interactions were up-weighted by a factor of 1.5 relative to intra-protein interactions during sequence optimization in attempt to ensure that the interface binding affinity was maintained, and two different criteria were used to optimize protein stability: (1) native scaffold residues identities were favored by 1.5 Rosetta energy units (Reu), and (2) no more than five residues were allowed to change from identities observed in a multiple sequence alignment (MSA) if (a) these residues were present in the MSA with a frequency greater than 0.6 as specified by a position-specific sequence matrix (PSSM) and, (b) if the calculated ΔΔG for mutation of the scaffold residue to alanine was greater than 1.5 Reu in the context of the scaffold sequence. The ΔΔG for mutation to alanine was estimated as described.sup.14 and PSSM files were generated using NCBI PSI-BLAST. For both the DIG_yhhff and the DIG_yyhff designs, a first method restricted the amino acid identities of the hydrogen bonding (Tyr/His) residues to their pre-selected (matched) identities during the design. For the DIG_yhhff designs, we used an alternative second method in which the matched residues were allowed to mutate to any amino acid subject to the MSA and ΔΔG criteria described above. Designs generated using this latter protocol were filtered to ensure the presence of at least three hydrogen bonds between the protein and the ligand.
(125) Evaluation of designs. Designs passing the filters encoded in the XML files were subjected to several additional filtering criteria. High shape complementary was enforced using by rejecting designs having S.sub.c<0.6. Shape complimentary was computed using the CCP4 package v.6.0.2.sup.15 using the S.sub.c program.sup.16 and the Rosetta radii library. A common feature of the engineered DIG-binding lipocalin DigA16 (PDB IDs 1LKE and 1KXO).sup.4 and the anti-DIG26-10 antibody (PDB IDs 1IGJ and 1IGI).sup.11 is that the binding site is largely pre-organized; there are very few structural changes between the bound and unbound forms of the proteins. We therefore attempted to enforce pre-organization of the binding-competent conformation of the apo-protein by two metrics: (1) introducing second-shell amino acids that hold the pre-selected residues in place via hydrogen bonding or sterics using Foldit.sup.7, and (2) eliminating designs having Boltzmann-weighted side chain probabilities.sup.18<0.1 for more than one of the hydrogen bonding residues.
(126) Compatibility of designed sequence with local backbone structure. We reasoned that binding site pre-organization would be compromised if substitution of amino acid side chains during (fixed backbone) design leads to a change in the backbone conformational preference in regions sequence-local to the sites of substitution. Therefore, we developed a metric to estimate the impact of design on local backbone structure and used this metric to discard designs that were predicted to lead to backbone structure changes. Using the structure prediction modules of Rosetta.sup.19, we generated a set of 9-mer fragment structures for each designed and wild type scaffold sequence and compared the average RMSD of these fragments to those of the scaffold backbone structures. If the average RMSD of conformations predicted in these fragments (200 9-mers) near any designed position was greater (>0.8 Å) for the designed sequence than the wild type scaffold sequence, we flagged that region of the designed protein as unlikely to adopt the local backbone conformation of the scaffold protein and rejected that designed protein.
(127) Design Scoring. Following automated filtering, all designs were inspected manually using Foldit.sup.17 and some ligand-proximal residues were manually reverted back to their native scaffold identity to increase the likelihood of design stability. Finally, 17 designs in 14 unique scaffolds were chosen for experimental testing (Supplementary Table 2). For scoring, all design models were relaxed with backbone and side chain heavy atom constraints.sup.20 using Rosetta relax.sup.21.
(128) Modeling directed evolution mutations. Mutations arising from directed evolution studies were modeled using RosettaScripts.sup.12. Mutations were introduced in the parent model, then residues having Cα within 10 Å of any ligand heavy atom and having Cα within 12 Å of any ligand heavy atom and Cβ closer to any heavy atom in the ligand than Cα were repacked using the soft_rep score function.sup.22. All side chains, the rigid body orientation of the ligand with respect to the protein, and internal ligand torsions were minimized using the Rosetta energy function with the enzdes weights set. Backbone minimization was restricted such that Cα atoms were only allowed to move ≦0.05 Å from their pre-minimization positions. Ten trajectories were run and the one having the lowest interface energy was selected.
(129) Materials. Digoxigenin, digoxin, digitoxigenin, progesterone, and β-estradiol were purchased from Sigma Aldrich (St. Louis, Mo.) and were used as received. DIG-BSA was purchased from CalBioreagents (San Mateo, Calif., ˜10 DIG molecules per BSA). EZ-link-sulfo-NHS-biotin was purchased from Thermo Fisher Scientific (Waltham, Mass.). Ribonuclease A (RNase A) and DIG-NHS were from Sigma Aldrich (St. Louis, Mo.). Reagents and solvents used for the synthesis of the digoxigenin derivatives were purchased from Sigma Aldrich and used without any further purification. Dimethylsulfoxide was stored over activated molecular sieves (Sigma-Aldrich, 4A, beads 8-12 mesh) for at least 24 hours before use. High-resolution mass spectra (HRMS) were collected with a LCQ Fleet Ion Trap Mass Spectrometer (Thermo Scientific). Reverse-phase analytical high-pressure liquid chromatography (RP-HPLC) was run on a Dionex system equipped with a P680 pump, an ASI 100 automatic sample injector and an UltiMate 3000 diode array detector for product visualization using a Waters symmetry C18 column (5 μm, 3.9×150 mm). Reverse-phase preparative high-pressure liquid chromatography was performed on a Dionex system equipped with an UltiMate 3000 pump and an UVD 170U UV-Vis detector for product visualization on a Waters SunFire™ Prep C18 OBD™ 5 μm 19×150 mm Column. Proton and carbon nuclear magnetic resonance (NMR) spectra were recorded at room temperature on a Bruker Avance-III 400 or on a Bruker DRX-600 equipped with a cryoprobe. Chemical shifts (δ) are reported in ppm relative to the solvent residual signals. Synthetic schemes are given in
(130) Biotinylation of DIG-BSA. DIG-BSA was prepared by reacting 50 μL of a 58 μM solution of DIG-BSA (2.9 nmol) with 8 μL of a 1.8125 mM solution of EZ-link-sulfo-NHS-biotin (14.5 nmol, 5 eq) in PBS for 1 hr at RT. A 10 μL portion of 14.5 mM glycine was added to quench the reaction. After 30 min, the reaction mixture was centrifuged and soluble protein was purified from excess small molecules by repeated rounds of centrifugal concentration and dilution into PBS until the absorbance of the flow-through remained constant.
(131) Synthesis of DIG-RNase-biotin. A 460 μL portion of a 365 μM solution of Ribonuclease A (168 nmol; RNase A) prepared in PBS was reacted with 30 μL of a 9.73 mM solution of EZ-link-sulfo-NHS-biotin (292 nmol, 1.7 eq) prepared in PBS and 10 μL of a 106.3 mM solution of DIG-NHS (1 μmol, 6 eq) prepared in DMSO for 1 hour at RT. A 20 μL portion of 385 mM glycine was added to quench the reaction. After 20 min, the reaction mixture was centrifuged and soluble protein was purified from excess small molecules by repeated rounds of centrifugal concentration and dilution into PBS until the absorbance of the flow-through remained constant.
(132) Synthesis of Biotin-PEG.sub.3-NH.sub.2 (2) Biotin (1, 13.5 mg, 55.3 μmol, 1 eq) was dissolved in 100 μL of dimethylsulfoxide (DMSO) and diisopropylethylamine (DIEA) was added (19.3 μL, 2 eq). O-(N-succinimidyl)-N,N,N′,N′-tetramethyl-uronium (TSTU, 15.0 mg, 0.9 eq) was added and the clear solution was stirred for 10 minutes at room temperature to form the biotin-NHS ester. 4,7,10-Trioxa-1,13-tridecanediamine (18 mg, 1.5 eq) was dissolved in 200 μL of dry DMSO and the biotin-NHS was added drop wise under vigorous stirring over 5 minutes. The mixture was stirred for a further 10 minutes at room temperature. 1.5 mL of diethyl ether was added to the clear solution and the resulting suspension was centrifuged. The supernatant ether phase was discarded and the remaining oil was purified by preparative RP-HPLC (5 mL/min, 10-100% acetonitrile in 0.1% TFA in H.sub.2O). The fractions containing the product were lyophilized to afford 2 as a yellowish liquid (15 mg, 67%). [HRMS (ESI): 447.42 m/z (447.7 m/z expected). .sup.1H NMR (400 MHz, DMSO) δ 7.78 (t, 1 H, J=5.6 Hz), 7.70 (m, 2 H), 6.42 (d, 1 H, J=0.2 Hz), 6.37 (m, 1 H), 4.31 (m, 1 H), 4.13 (dd, 1 H, J=7.6, 4.5 Hz), 3.50 (m, 11 H), 3.39 (t, 2 H, J=6.3 Hz), 3.08 (m, 3 H), 2.85 (m, 3 H), 2.05 (t, 2 H, J =7.4 Hz), 1.78 (m, 2 H), 1.61 (m, 4 H), 1.49 (m, 3 H), 1.30 (m, 2 H). .sup.13C NMR (101 MHz, DMSO) δ 172.4, 163.2, 70.2, 70.1, 70.0, 70.0, 68.6, 67.8, 61.5, 59.7, 55.9, 40.3, 37.3, 36.2, 35.7, 29.9, 28.7, 28.5, 27.7, 25.8.]
(133) Synthesis of Digoxigenin-PEG.sub.3-biotin (3) Digoxigenin-NHS ester (1 mg, 1.5 μmol) was dissolved in 100 μL of DMSO and DIEA (0.4 mg, 3.0 μmol) was added, followed by 2 (1.3 mg, 3.0 μmol). The reaction was stirred for 10 minutes at room temperature and then purified by preparative HPLC (5 mL/min, 10-100% acetonitrile in 0.1% TFA in H.sub.2O). The fractions containing the product were lyophilized to afford 3 as a yellowish liquid (0.4 mg, 27%). [HRMS (ESI): 990.4 m/z (990.6 m/z expected) .sup.1H NMR (400 MHz, DMSO) δ 7.74 (m, 2 H), 7.52 (m, 1 H), 6.44 (s, 1 H), 6.34 (s, 1 H), 5.83 (s, 1 H), 4.88 (m, 3 H), 4.32 (m, 2 H), 4.15 (m, 2 H), 3.77 (m, 1 H), 3.60 (m, 1 H), 3.52 (m, 2 H), 3.47 (m, 2 H), 3.44-3.2 (30 H), 3.08 (m, 2 H), 2.84 (m, 1 H), 2.81 (m, 1 H), 2.60 (m, 1 H), 2.57 (m, 2 H), 2.45 (m, 1 H), 2.05 (m, 2H), 1.74 (m, 2 H), 1.61 (m, 4 H), 1.44 (m, 3 H), 1.25 (m, 2 H), 0.87 (s, 2 H), 0.66 (s, 2 H)]
(134) Synthesis of Alexa488-PEG.sub.3-NH.sub.2 (5) Alexa Fluor 488 (4, 4.74 mg, 8.9 μmol) was dissolved in 100 μL of DMSO and treated with DIEA (3.1 μL, 17.8 μmol), followed by TSTU (3.22 mg, 10.7 μmol). The reaction was stirred at room temperature for 10 minutes. 4,7,10-Trioxa-1,13-tridecanediamine (3.92 mg, 17.8 μmol) was dissolved in 100 μL of dry DMSO and the Alexa 488 reaction mixture was added drop wise under vigorous stirring over 5 minutes. The clear orange solution was stirred for 10 minutes at room temperature and then purified by preparative HPLC (5 mL/min, 10-100% acetonitrile in 0.1% TFA in H.sub.2O). The fractions containing the product were lyophilized to afford 5 as a deep red liquid (2.8 mg, 43%). [HRMS (ESI): 738.3 m/z (738.7 m/z expected). 1H NMR (400 MHz, DMSO) δ 8.74 (m, 1 H), 8.62 (m, 1 H), 8.26 (m, 1 H), 7.62 (m, 2 H), 7.26 (m, 1 H), 6.86 (m, 3 H), 3.54 (m, 4 H), 3.48 (m, 2 H), 3.3-3.4 (6H), 2.83 (m, 2 H), 2.08 (d, 1 H, J=0.7 Hz), 1.84 (m, 2 H), 1.73 (m, 2 H), 1.25 (m, 1 H), 1.10 (t, 4 H, J=7.0 Hz)]
(135) Synthesis of Digoxigenin-PEG.sub.3-Alexa488 (6) 5 (0.56 mg, 0.76 μmol) was dissolved in 200 μL of DMSO and treated with DIEA (0.20 mg, 1.52 μmol). Digoxigenin-NHS ester (0.5 mg, 0.8 μmol) was added at once and the reaction stirred for 10 minutes at room temperature and then purified by preparative HPLC (5 mL/min, 10-100% acetonitrile in 0.1% TFA in H.sub.2O). The fractions containing the product were lyophilized to afford 6 as a deep red liquid (0.59 μmol, 78%). [.sup.1H NMR (400 MHz, DMSO) δ 8.87 (s, 1 H), 8.69 (s, 3 H), 8.27 (dd, 1 H, J=7.9, 1.3 Hz), 7.74 (m, 1 H), 7.54 (m, 2 H), 7.00 (dd, 4 H, J=3.2, 1.6 Hz), 5.81 (s, 1 H), 4.86 (m, 3 H), 3.8-3.5 (31 H), 3.37 (m, 3 H), 3.22 (m, 2 H), 3.16 (s, 2 H), 3.06 (m, 2 H), 2.08 (s, 4 H), 2.02 (t, 2 H, J=7.3 Hz), 1.81 (d, 2 H, J=6.5 Hz), 1.73 (m, 2 H), 1.59 (m, 4 H), 1.43 (m, 7 H), 1.19 (d, 3 H, J=6.2 Hz), 1.07 (m, 2 H), 0.86 (s, 2 H), 0.64 (s, 2 H).]
(136) Gene synthesis. Designs DIG1-17. DigA16, and 3hk4 were ordered from Genscript (Piscataway, N.J.) between the NdeI and XhoI restriction sites of a custom pET29-based vector having an N-terminal FLAG tag and a C-terminal His.sub.6 tag (pET29FLAG). Codon usage was optimized for both E. coli and yeast with preference given to E. coli. DNA sequences are given in Supplementary Table 1.
(137) Yeast surface display assays. Designed proteins were tested for binding using yeast-surface display.sup.23. Designs DIG1-17/pET29FLAG, DigA16/pET29FLAG, and 3hk4/pET29FLAG were subcloned into the NdeI/XhoI cloning sites of pETCON.sup.24. Designs and control proteins in pETCON were transformed into EBY100 cells using lithium acetate and polyethylene glycol.sup.25 with dH.sub.2O instead of single stranded carrier DNA and were plated on selective media (C -ura -trp). Freshly transformed cells were inoculated into 1 mL of SDCAA media.sup.23 and grown at 30° C., 200 rpm. After ˜12 hrs, 1e7 cells were collected by centrifugation at 1,700×g for 3 min and resuspended in 1 mL of SGCAA media to induce protein expression. Following induction for 24-48 hrs at 18° C., 4e6 cells were collected by centrifugation, and washed twice by incubation with PBSF (PBS supplemented with 1 μL of BSA) for 10 min at room temperature
(138) Yeast surface protein expression was monitored by binding of anti-cmyc FITC (Miltenyi Biotec GmbH, Germany) to the C-terminal myc epitope tag of the displayed protein. DIG binding was assessed by quantifying the phycoerythrin (PE) fluorescence of the displaying yeast population following incubation with DIG-BSA-biotin, DIG-RNase-biotin, or DIG-PEG.sub.3-biotin, and streptavidin-phycoerythrin (SAPE; Invitrogen, Carlsbad, Calif.). In a typical experiment using DIG-BSA-biotin or DIG-RNase-biotin. 4e6 cells were resuspended in 50 μL of a premixed solution of PBSF containing a 1:100 dilution of anti-cmyc FITC, 2.66 μM DIG-BSA-biotin or DIG-RNase biotin, and 664 nM SAPE. Following a 2-4 hr incubation at 4° C. in the dark on a rotator, cells were collected by centrifugation at 1,700×g for 3 min and washed with 200 μL of PBSF at 4° C. Cell pellets were resuspended in 200 μL of ice-cold PBSF immediately before use. Cellular fluorescence was monitored on an Accuri C6 flow cytometer using a 488 nm laser for excitation and a 575 nm band pass filter for emission. Phycoerythrin fluorescence was compensated to minimize bleed-over contributions from the FITC fluorescence channel.
(139) Two positive controls having different affinities for digoxigenin were used to assess the binding assay: DigA16.sup.26, and a commercially available anti-DIG monoclonal antibody 9H27L19 (Life Technologies). Experiments using DigA16 were conducted in an identical fashion to designs DIG1-17. For those employing the DIG antibody, two tandem Z domains of protein A (ZZ domain).sup.27,28, were displayed on the yeast cell surface. Washed cells were resuspended in 20 μL of PBSF with 2 μL of rabbit anti-DIG mAB 9H27L19 (Invitrogen, Carlsbad, Calif.). Following a 30-min incubation at 4° C. on a rotator, excess antibody was removed by washing the cells with 200 μL of PBSF. Labeling reactions were then performed as above. Negative controls for binding were the ZZ domain without mAB and an orthogonal gp120-based library available in the Baker lab (S2). FlowJo software version 7.6 was used to analyze all flow cytometry data presented here.
(140) Competition assays with free digoxigenin were performed as above except that between 750 μM and 1.5 mM of digoxigenin (Sigma Aldrich, St. Louis, Mo.) prepared as a stock solution in MeOH was added to each labeling reaction mixture. Control experiments performed in a similar manner showed that the small amount of MeOH added does not affect the fluorescence or binding properties of SAPE (data not shown).
(141) Knockout mutations. Knockout mutations were introduced into the appropriate DIG design in pETCON or pET29b(+) by the method of Kunkel.sup.29. These variants included the single point mutants VI 17R, Y101F, Y115F, and Y34F and the triple mutant Y101F/Y115F/Y34F for DIG10, the single point mutants W119R, H58A, Y84F, and Y97F and the double mutant Y115F/Y84F for DIG5, the single point mutants V86R, H011A and the triple mutant Y10F/H101A/Y103F for DIG8, and single point mutants Y34F, Y101F, Y115F, the double mutant Y99F/Y101F, the triple mutant Y34F/Y99F/Y101F, and the quadruple mutant Y34F/Y99F/Y101FYI 15F for DIG10.3. Oligos were ordered from Integrated DNA Technologies, Inc. (Coralville, Iowa) and are listed in Supplementary Table 12 with the mutagenized region(s) highlighted in red.
(142) Recursive PCR assembly of 1z1s. The gene for 1z1s having additional pETCON overlap fragments at either end for yeast homologous recombination was assembled via recursive PCR. Oligo sequences were designed using DNAWorks.sup.30 and are given in Supplementary Table 13. Oligos were ordered from Integrated DNA Technologies, Inc. (Coralville, Iowa). A 2 μL portion of a 2.5 μM stock solution of each oligo was combined and the mixture was added to 8 μL of 1.25 mM dNTPs, 20 μL of 5× Phusion buffer HF, 3 μL of DMSO, and 1 μL of Phusion high-fidelity polymerase (NEB, Waltham, Mass.) in 100 μL. Full-length gene product was assembled by 30 cycles of PCR (98° C. 10 s, 61° C. 30 s. 72° C. 15 s)
(143) Correctly assembled PCR product was amplified by a second round of PCR. Reaction product (5 μL) was combined with 2 μL of 10 μM pCTCON2f (Supplementary Table 14), 2 μL of 10 μM pCTCON2r (Supplementary Table 14), 8 μL of 1.25 mM dNTPs, 20 μL of 5× Phusion buffer HF, 3 μL of DMSO, and 1 μL of Phusion high-fidelity polymerase (NEB, Waltham, Mass.) in 100 μL. Product was obtained by 30 cycles of PCR (98° C. 10 s, 60° C. 30 s, 72° C. 15 s). Following confirmation of a single band at the correct molecular weight by 1% agarose gel electrophoresis, the PCR product was purified using a Qiagen PCR cleanup kit (Qiagen) and eluted in dH.sub.2O
(144) Yeast EBY100 cells were transformed with 240 ng of 1z1s gene DNA and 400 ng of gel-purified pETCON digested with NdeI and Xhol using lithium acetate and polyethylene glycol.sup.25 with dH.sub.2O instead of single-stranded carrier DNA. The correct sequence was confirmed by colony PCR and gene sequencing, and plasmids from these colonies were harvested using a Zymoprep Yeast Miniprep II kit (Zymo Research Corporation, Irvine, Calif.).
(145) DIG10 site-saturation mutagenesis library (directed evolution round 1a). A DIG10 single site-saturation mutagenesis (SSM) library was constructed by Kunkel mutagenesis.sup.29 using degenerate NNK primers targeting the following 34 amino acids positions: S10, L11, L14, W22, L32, Y34, A37, P38, G40, H41, H54, M55, L57, F58, Y61, V62, V64, F66, F84, G86, G88, H90, V92, S93, L97, A99, Y101, S103, Y115, V117, F119, V124, A127, and L128. These positions were chosen from the model based on the following requirements: (1) they have Cα within 7 Å of any ligand heavy atom, and/or (2) they have Cα within 9 Å of any ligand heavy atom and Cβ closer to any heavy atom in the ligand than Cα. The theoretical library size was 1088 clones. Primers were ordered from Integrated DNA Technologies (Coralville, Iowa).
(146) Kunkel mutagenesis of each position was carried out independently. DNA from each reaction was dialyzed into dH.sub.2O using a 0.025 μm membrane filter (Millipore, Billerica, Mass.), and then the dialyzed reaction mixtures were pooled, concentrated to a volume of <10 μL using a Savant SpeedVac centrifugal vacuum concentrator, and transformed into yeast strain EBY100 using the method of Benatuil.sup.31, yielding 2.5e5 transformants. After transformation, cells were grown in 250 mL of SDCAA media for 36 hrs at 30° C. Cells (5e8) were collected by centrifugation at 1,700×g for 4 min, resuspended in 50 mL of SGCAA media, and induced at 18° C. for 24 hrs
(147) Cells were subjected to three rounds of permissive cell sorting (Supplementary Table 8). For each round of sorting, cells were washed and then labeled with a pre-incubated mixture of 2.66 μM DIG-BSA-biotin, 644 nM SAPE, and anti-cmyc-FITC as noted above for single clones. After each sort, cells were grown in SDCAA for 24 hrs and then induced in SGCAA for 24 hrs before the next sort. After the final sort, the mean compensated PE fluorescence of the expressing population of the sorted cells was considerably higher than that of DIG10, indicating the presence of a point mutant(s) with increased binding affinity
(148) After each sort, a portion of cells were plated and grown at 30° C. Plasmids from individual colonies were harvested using a Zymoprep Yeast Miniprep II kit (Zymo Research Corporation, Irvine, Calif.) and the gene was amplified by 30 cycles of PCR (98° C. 10 s, 61° C. 30 s, 72° C. 15 s) using Phusion high-fidelity polymerase (NEB, Waltham, Mass.) with the pCTCON2r and pCTCON2f primers. Sanger sequencing (Genewiz, Inc., South Plainfield, N.J.) was used to sequence at least 10 colonies from each population.
(149) DIG10 combinatorial mutagenesis library (directed evolution round 1b). Beneficial mutations identified in the DIG10 SSM library were combined by Kunkel mutagenesis.sup.29 using degenerate primers. At each mutagenized position, the original DIG10 amino acid and chemically similar amino acids to those identified were also allowed, resulting in a combinatorial library. Amino acid substitutions included S, A, or M at position S10, L, H, or Q at position L11, A or P at position A37, I, L, V, F, or M at position V62, I, L, V, F, or M at position V64, H, T, or N at position H90, I, L, V, F, or M at position V17, and A or P at position A127. The theoretical library size was 1.35e4 clones. Primers were ordered from Integrated DNA Technologies, Inc. (Coralville, Iowa).
(150) Four independent Kunkel reactions using different oligo concentrations ranging from 36 nM to 291 nM during polymerization were performed to minimize sequence-dependent priming bias. For the same reason, oligos encoding native substitutions contained at least one codon base change. Library DNA was pooled, prepared as above, and transformed into electrocompetent E. coli strain BL2 I(DE3) cells (1800 V, 200 Ω, 25 μF), yielding 8e4 transformants. Library plasmid DNA was isolated from expanded cultures using a Qiagen miniprep kit. Gene insert was amplified from 10 ng of library DNA by 30 cycles of PCR (98° C. 10 s, 61° C. 30 s, 72° C. 15 s) using Phusion high-fidelity polymerase (NEB, Waltham, Mass.) with the pCTCON2r and pCTCON2f primers.
(151) Yeast EBY100 cells were transformed with 4.0 μg of PCR-purified DNA insert and 1.0 μg of gel-purified pETCON digested with NdeI and XhoI using the method of Benatuil.sup.31, yielding 8e5 transformants. After transformation, cells were grown in 150 mL of low pH SDCAA media supplemented with Pen/Strep for 48 hrs at 30° C. Cells (5e8) were collected by centrifugation at 1,700×g for 4 min, resuspended in 50 mL of SGCAA media, and induced at 18° C. for 24 hrs
(152) Cells were subjected to seven rounds of cell sorting. For the first four rounds, cells were washed and then labeled with a pre-incubated mixture of DIG-BSA-biotin, SAPE, and anti-cmyc-FITC as noted above for single clones. Label concentrations for rounds one through four were: (1) 1 μM DIG-BSA-biotin and 250 nM SAPE, (2) 750 nM DIG-BSA-biotin and 187.5 nM SAPE. (3) 50 nM DIG-BSA-biotin and 12.5 nM SAPE, and (4) 5 nM DIG-BSA-biotin and 1.25 nM SAPE. For rounds five through seven, DIG-RNase-biotin was used in a multistep labeling procedure to minimize selection for carrier protein (BSA) binding and because this procedure showed a larger dynamic range in several control experiments. In these experiments, cells were washed as before, labeled with DIG-RNase-biotin for 3-4 hrs at 4° C., and then treated with a solution of PBSF containing a 1:100 dilution of SAPE and a 1:100 dilution of anti-cmyc-FITC (secondary label) for <15 min at 4° C. before washing and sorting. DIG-RNase-biotin label concentrations were 10 pM, 5 pM, and 5 pM for rounds five through seven, respectively.
(153) At least 10 clones from each round were sequenced as noted for the DIG10 SSM library. After seven rounds, the library converged to two sequences differing by a single point substitution: DIG10.1a, harboring the S10A substitution, and DIG10. b, containing S10M (Supplementary
(154) DIG10.1L library (directed evolution round 2). Library DNA was a mixture of DNA from DIG10.IL_f1, DIG10.IL_f2, and a third library (DIG10.IL_3) combining mutations from the two fragment libraries (see section on Next-Gen Library Construction). For DIG10.1L_3, the library was constructed using the oligos DIG10.1L_hr1, DIG10.1L_f1a_rc_variable, DIG10.1L_f1b_variable, DIG10.1L_f2 rc_variable, and DIG10.1 L_hr2 and the procedures detailed below
(155) Yeast EBY100 cells were transformed with a mixture of DNA insert from DIG10.IL_f1 (3.0 μg), DIG10.1L_f2 (3.0 μg), and DIG10.IL_3 (24.0 μg) and 10.0 μg of gel-purified pETCON digested with NdeI and XhoI using the method of Benatuil.sup.31, yielding 1.5e7 transformants. After transformation, cells were grown for 24 hrs in 250 mL of low-pH SDCAA media supplemented with Pen/Strep at 30° C., passaged once, and grown for an additional 24 hrs under the same conditions. Cells (5e8) were collected by centrifugation, resuspended in 50 mL of SGCAA, and induced overnight at 18° C.
(156) Cells were subjected to five rounds of cell sorting using monovalent DIG-PEG.sub.3-biotin and the multistep labeling procedure detailed for directed evolution round 1b sorts five through seven to increase stringency by avoiding avidity effects. DIG-PEG.sub.3-biotin label concentrations were 80 nM, 80 nM, 50 nM, 1 nM, and 1 nM for the five rounds. After the final sort, the mean compensated PE fluorescence of the expressing population of the sorted cells was considerably higher than that of DIG10.2, indicating the presence of a mutant(s) with increased binding affinity.
(157) At least 10 clones from each round were sequenced as noted for the DIG10 SSM library. After four rounds, the library converged to one sequence (DIG10.2) having the two loop mutations A37P and H41Y, which were two of the most enriched single point mutations identified in the next-generation sequencing experiment.
(158) DIG10.2 combinatorial library based on deep sequencing data (directed evolution round 3). Mutations having normalized next-generation sequencing enrichment values (ΔE.sub.i.sup.x)>˜3.5 were combined by Kunkel mutagenesis.sup.29 using degenerate primers. DIG10.2 was used as the library template. At each mutagenized position, the original DIG10.2 amino acid and chemically similar amino acids to those identified were also allowed, resulting in a combinatorial library. Amino acid substitutions included C or S at position C23, F, H, or Y at position F45, M or F at position M62. H, I, L, F, or Y at position H90. V or A at position V92, A, V, I, T, F, or Y at position A99, S, A, or V at position S103, L, V, or W at position L105, I or F at position I112, V or F at position V124, and P, I, L, or V at position P127. The theoretical library size was 1.04e5 clones. Primers were ordered from Integrated DNA Technologies (Coralville, Iowa).
(159) Four Kunkel reactions using different oligo concentrations ranging from 36 nM to 291 nM during polymerization and two Kunkel reactions using reduced oligo concentrations for the M62M substitution relative to the concentrations of the M62F substitution were performed to minimize sequence-dependent priming bias. For the same reason, oligos encoding native substitutions contained at least one codon base change. Library DNA was pooled, prepared as above, and transformed into E. coli strain ElectroMAX DH10B (Invitrogen, Carlsbad, Calif.) cells (2500 V, 200 Ω, 25 μF), yielding 1.6e7 transformants. Library plasmid DNA was isolated from expanded cultures using a Qiagen miniprep kit. Gene insert was amplified from 10 ng of library DNA by 30 cycles of PCR (98° C. 10 s, 61° C. 30 s, 72° C. 15 s) using Phusion high-fidelity polymerase (NEB, Waltham, Mass.) with the pCTCON2r and pCTCON2f primers.
(160) Yeast EBY100 cells were transformed with 6.0 μg of PCR-purified DNA insert and 2.0 μg of gel-purified pETCON digested with NdeI and XhoI using the method of Benatuil.sup.31, yielding 5e6 transformants. After transformation, cells were grown in 150 mL of low pH SDCAA media supplemented with Pen/Strep for 48 hrs at 30° C. Cells (5e8) were collected by centrifugation at 1.700×g for 4 min and resuspended in 50 mL of SGCAA media. Cells were induced at 18° C. for 24 hrs.
(161) Cells were subjected to four rounds of cell sorting (
(162) At least 10 clones from each round were sequenced as noted for the DIG10 SSM library. After four rounds, the library converged to one sequence (DIG10.3) having the mutations C23S, H90L, V92A, A99Y, S103A, and L105W.
(163) Next-generation DIG10.1 library construction and selections. Paired-end 151 Illumina sequencing was used to simultaneously assess the effects of mutation on binding of DIG10.1 to digoxigenin at 39 amino acid positions within the binding site pocket. Two libraries were constructed: an N-terminal library with mutations between residues S10 and F66 (fragment 1 library—DIG10.IL_f1) and a C-terminal library with mutations between residues F84 and L128 (fragment 2 library—DIG10.IL_f2). For each library, the full-length DIG10.1 gene having additional pETCON overlap fragments at either end for yeast homologous recombination was assembled via recursive PCR. To introduce mutations, we used degenerate PAGE-purified oligos in which selected positions within the binding site were doped with a small amount of each non-native base at a level expected to yield 1-2 mutations per gene (TriLink BioTechnologies, San Diego, Calif.). All other wild-type oligos were also PAGE-purified (Integrated DNA Technologies). For DIG10.IL_f1, bases coding for the following 20 amino acid positions were allowed to vary: A10, L11, L14, W22, C23, F26, L32, Y34, A37, P38, G40, H41, F45, H54, M55, F58, Y61, M62, I164, and F66. For DIG10. L_f2, bases coding for the following 19 amino acid positions were allowed to vary: F84, G86, G88, H90, V92, S93, G95, L97, A99, Y101, S103, L105, 1112, Y115, L117, F119, V124, P127, and L128.
(164) For assembly of DIG10.1L_f1, 2 μL of 2.5 μM DIG10.1L_hr1, 2 μL of 2.5 μM DIG10.1L_f1a_rc_variable, 2 gμL of 2.5 μM DIG10.1L_f1b_variable, 2 μL of 2.5 μM DIG10.IL_f2_rc_WT, and 2 μL of 2.5 μM DIG10.1L_hr2 were combined with 8 μL of 1.25 mM dNTPs, 20 μL of 5× Phusion buffer HF, 3 μL of DMSO, and 1 μL of Phusion high-fidelity polymerase (NEB, Waltham, Mass.) in 100 μL. Reaction mixtures for assembly of DIG10.1l_f2 were the same, except that DIG10.1L_f1a_rc_variable, DIG10.1L_f1b_variable, and DIG10.1L_f2_rc_WT were substituted with DIG10.1L_fla_rc_WT, DIG10.1L_f1b_WT, and DIG10. IL_f2_rc_variable, respectively. Full-length products were assembled by 30 cycles of PCR (98° C. 10 s, 61° C. 30 s, 72° C. 15 s).
(165) Correctly assembled PCR products were amplified by a second round of PCR. Reaction products (5 μL) were combined with 2 μL of 10 μM DIG10.IL_assembly_fwd, 2 μL of 10 μM DIG10.IL_assembly_rev, 8 μL of 1.25 mM dNTPs, 20 μL of 5× Phusion buffer HF, 3 μL of DMSO, and I μL of Phusion high-fidelity polymerase (NEB, Waltham, Mass.) in 100 μL. Products were amplified by 30 cycles of PCR (98° C. 10 s, 60° C. 30 s, 72° C. 15 s). Following confirmation of a single band at the correct molecular weight by 1% agarose gel electrophoresis. PCR products were purified using a Qiagen PCR cleanup kit (Qiagen) and eluted in ddH.sub.2O.
(166) Yeast EBY100 cells were transformed with 5.4 μg of library DNA insert and 1.8 μg of gel-purified pETCON digested with NdeI and XhoI using the method of Benatuil.sup.31, yielding 4e6 and 3e6 transformants for the DIG10.1 L_f1 and DIG10.1 L_f2 libraries, respectively. After transformation, cells were grown for 24 hrs in 100 mL of low-pH SDCAA media supplemented with Pen/Strep at 30° C., passaged once, and grown for an additional 24 hrs under the same conditions. Cells (5e8) were collected by centrifugation, resuspended in 50 mL of SGCAA, and induced overnight at 18° C.
(167) Induced cells (3e7) were labeled with 4 μL of anti-cymc-FITC (Miltenyi Biotec GmbH, Germany) in 200 μL of PBSF for 20 min (DIG10.1L_f1) or 60 min (DIG10.1L_f2) at 4° C. Then, labeled cells were washed with PBSF and sorted. In this first round of sorting, all cells showing a positive signal for protein expression were collected (
(168) Induced cells from expression-sorted DIG10.1L_f1 (2e7 cells), expression-sorted DIG10.1 L_f2 (2e7 cells), and two DIG10.1a reference samples (5e6 cells per sample) were washed with 600 μL of PBSF and then labeled with 100 nM of DIG-PEG.sub.3-biotin in 400 μL of PBSF for the libraries or 200 μL of PBSF for the reference samples for >3 hrs at 4° C. Labeled cells were washed with 200 μL of PBSF, then incubated with a secondary label solution of 0.8 μL of SAPE (Invitrogen) and 4 μL of anti-cymc-FITC (Miltenyi Biotec GmbH, Germany) in 400 μL of PBSF for 8 min at 4° C. Cells were washed with 200 μL PBSF, resuspended in either 800 μL μL of PBSF for the libraries or 400 μL of PBSF for the reference samples, and sorted (
(169) To reduce noise from the first round of cell sorting, the sorted libraries were labeled and subjected to a second round of cell sorting using the same conditions and gates as in the first round (
(170) One hundred million cells from the expression-sorted DIG10.1L_f2 and DIG10.1L_f2 libraries and at least 2e7 cells from doubly-sorted DIG10.1_f1_better and DIG10.1_f2_better were pelleted by centrifugation at 1,700×g for 4 min, resuspended in 1 mL of freezing solution (50% YPD, 2.5% glycerol), transferred to cryogenic vials, slow-frozen in an isopropanol bath, and stored at −80° C. until further use.
(171) Next-generation library sequencing. Library DNA was prepared as detailed previously.sup.32. Illumina adapter sequences and unique library barcodes were appended to each library pool through PCR amplification using population-specific HPLC-purified primers (Integrated DNA Technologies. Coralville, Iowa). The library amplicons were verified on a 2% agarose gel stained with SYBR Gold (Invitrogen) and then purified using an Agencourt AMPure XP bead-based purification kit. (Beckman Coulter, Inc.) Each library amplicon was denatured using NaOH and then diluted to 6 pM. A sample of PhiX control DNA (Illumina, Inc., San Diego, Calif.) was prepared in the same manner as the library samples and added to the library DNA to create high enough sample diversity for the Illumina base-calling algorithm. The final DNA sample was prepared by pooling 300 μL of 6 pM PhiXcontrol DNA (50%). 102 μL of 6 pM expression-sorted DIG10_1L_f1 (17.0%), 102 μL of 6 pM expression-sorted DIG10_1L_f2 (17.0%), 33 μL of 6 pM DIG10_1L_f1_neutral (5.5%), 33 μL of 6 pM DIG10_L_f2_neutral (5.5%), 15 μL of 6 pM DIG10_1L_f1_better (2.5%), and 15 μL of 6 pM DIG10_L_f2_better (2.5%). DNA was sequenced in paired-end mode on an Illumina MiSeq using a 300-cycle reagent kit and custom HPLC-purified primers (Integrated DNA Technologies, Inc., Coralville, Iowa).
(172) Processing of sequencing results. Data from each next-generation sequencing library was demultiplexed using the unique library barcodes added during the amplification steps. Of a total 5,630,105 paired-end reads, 2,531,653 reads were mapped to library barcodes. For each library, paired end reads were fused and filtered for quality (Phred≧30). The resulting full-length reads were aligned against the relevant segments of the DIG10.1a sequence using scripts from the software package Enrich.sup.33. For single mutations having 7 counts in the original input library, a relative enrichment ratio between the input library and each selected library was calculated.sup.32,34,35. A pseudocount value of 0.3 was added to the total reads for each selected library mutation, to allow calculation of enrichment values for mutations that disappeared completely during selection.
(173) Protein expression and purification. Selected DIG designs and variants were expressed in E. coli in pET29FLAG or with a TEV protease-cleavable His.sub.6 purification tag (pET29-TEV-His.sub.6). For the latter, DIG genes were amplified from the appropriate pETCON-based plasmid using a forward primer and a reverse primer harboring a TEV-protease recognition insertion sequence. The PCR products were digested with NdeI and XhoI and ligated into similarly digested pET29b(+). Ligation products were transformed into Rosetta 2 (DE3) cells for expression. Rosetta 2 (DE3)/pET29b(+) cells were grown in 1L of LB or TB medium at 37° C. to an O.D..sub.600 of ˜0.7, and then protein expression was induced by the addition of 0.5 mM IPTG (isopropyl-f3-D-thiogalactopyransoide). Cultures were incubated at 37° C. for 3-4 hrs or at 18° C. for 18 hrs and then harvested by centrifugation at 1,912×g for 20 min. Cell pellets were stored at −20° C. until further use.
(174) Proteins were purified by gravity flow chromatography over Ni-NTA resin (Qiagen, Hilden, Germany) columns. Frozen cell pellets were resuspended in 15 mL of wash buffer (PBS pH 7.4, 30 mM imidazole) supplemented with 300 μL of 100 mM phenylmethanesulfonyl fluoride (PBSF; Sigma Aldrich, St. Louis, Mo.) prepared in neat ethanol, 2 mg/mL of lysozyme, and 0.2 mg/mL of DNAse I. Cells were lysed by sonication for a total of 4 min (30 s on, 20 s off) using a Branson sonifier at 75% power. Insoluble material was removed by centrifugation at 38,724×g for 30 min, and particulate matter was further removed from the supernatant by filtration through a 0.45 μm syringe filter. Supernatant was then passed through gravity columns containing 3 mL of Ni-NTA resin (Qiagen, Hilden, Germany) equilibrated in wash buffer. Bound proteins were washed with 45 mL of wash buffer and then eluted in 20 mL of elution buffer (PBS pH 7.4, 200 mM imidazole). Proteins were concentrated to ˜5-40 mg/mL using Vivaspin 5 kD MWCO centrifugal concentration devices (Sartorium Stedim Biotech GmbH, Goettingen. Germany) and imidazole was removed by dialysis (3×2 L) into PBS pH 7.4 at 4° C.
(175) Yields for the DIG designs expressed in pET29FLAG are given in Supplementary Table 2. Typical yields for DIG10-TEV-his.sub.6, DIG10.1a-TEV-his.sub.6, DIG10.2-TEV-hiss, DIG10.3-TEV-his.sub.6, DIG10.3-TEV-his.sub.6 variants, and 1z1s-TEV-his range from 10 to 60 mg/L. For all solution experiments, protein concentrations were determined from absorbance at 280 nm measured on a NanoDrop spectrophotometer (Thermo Scientific) using extinction coefficients calculated from primary amino acid sequences.
(176) Size-exclusion chromatography. Protein oligomerization states were assessed by size exclusion chromatography on an ÄKTA FPLC (GE Healthcare) using a Superdex 75 10/300 GL column equilibrated in running buffer (25 mM Tris-HCl pH 7.4, 250 mM NaCl). Proteins were run over the column at a flow rate of 0.5 mL/min. Horse heart cytochrome c (29 kDa), bovine erythrocytes carbonic anhydrase (12.4 kDa), and bovine aprotinin (6.5 kDa) molecular weight standards (Sigma Aldrich, St. Louis, Mo.) were analyzed in the same manner as the protein samples. Under these conditions, cytochrome c, carbonic anhydrase, DIG10-TEV-his.sub.6 (expected MW of monomer: 17.9 kDa). DIG10.1b-TEV-his.sub.6 (expected MW of monomer: 17.9 kDa), DIG10.2.sub.t-his.sub.6 (see below; expected MW of monomer: 15.9 kDa), DIG10.3-TEV (the his.sub.6 tag was cleaved with TEV protease; expected MW of monomer: 16.9 kDa), and DIG5-TEV-his.sub.6 (expected MW of monomer: 17.8 kDa) eluted at 12.05 mL, 13.65 mL, 11.88 mL, 11.81 mL, 11.40 mL, 11.35 mL, and 11.78 mL, respectively (Supplementary
(177) Preparation of samples for crystallography. Crystallographic trials with the DIG10-based C-terminal TEV-his.sub.6 constructs (cleaved with TEV protease or un-cleaved) failed to yield diffraction-quality crystals. All 1z1s-based designs contained a 12 residue C-terminal tail that was disordered in the structure of 1z1s but was maintained when we ordered the designs in case it was necessary for protein stability or folding. To reduce entropic effects from this disordered tail that might prevent crystal formation, we cloned the DIG10 designs into new pET29b(+)-based constructs in which all 12 residues of this tail were eliminated and a non-cleavable his.sub.6 tag was placed immediately after the last ordered residue (DIG10.sub.t-his.sub.6, DIG10.1a.sub.t-his.sub.6, DIG10.2.sub.t-his.sub.6, and DIG10.3.sub.t-his.sub.6).
(178) Truncated samples were expressed and purified by gravity flow over Ni-NTA resin using the above procedure. Typical expression yields were comparable to their un-truncated, TEV-cleavable His.sub.6-tagged counterparts (see above). Preparative size exclusion chromatography was used to further purify all proteins for crystallization attempts using the above procedure.
(179) Crystallization. Purified DIG10 and its evolved variants were incubated at 4° C. with 1 mM digoxigenin for 16-20 hours. The protein-ligand complex was then screened using several commercially available sparse matrix crystallization screens using a nanoliter drop volume crystallization robot (TTP LabTech ‘Mosquito’). Potential hits were scaled up into vapor diffusion plates with reservoir solution to protein-ligand complex at a ratio of 1:1. Several diffraction quality crystals were obtained for DIG10.2-his.sub.6 and DIG10.3.sub.t-his.sub.6. Crystals of DIG10.2.sub.t-his.sub.6 were grown at a concentration of 15 mg mL.sup.−1 in 0.1 M Acetate pH 5.5, 1.5% MPD, 2.5 M Sodium chloride and 12% PEG1500. Crystals of DIG10.3.sub.t-his.sub.6 were grown at a concentration of 13.5 mg ml.sup.−1 in 0.2 M Ammonium acetate, 0.1 M Bis-Tris pH 5.5 and 20% PEG3350. DIG10.2.sub.t-his.sub.6 and DIG10.3.sub.t-his.sub.6 crystals were transferred to artificial mother liquor containing 20% Sucrose or Glycerol, respectively, then individually removed in fiber loops and flash frozen in liquid nitrogen.
(180) Crystallographic data collection and processing. Datasets from crystals of DIG10.2.sub.t-his.sub.6 and DIG10.3.sub.t-his.sub.6 were collected at the Advanced Light Source (ALS) synchrotron facility (Berkeley, Calif.) on beamline 5.0.2 using a CCD area detector. Data for DIG10.2.sub.t-his.sub.6 corresponded to 360° of 1° diffraction exposures collected at a distance of 180 mm and exposure times of 1 second per 1° oscillation. Data for DIG10.3.sub.t-his.sub.6 corresponded to full 360° of 1° diffraction exposures collected at a distance of 230 mm and exposure times of 1 second per 1° oscillation.
(181) Data was processed using the HKL2000 software package.sup.36. Molecular replacement was performed using program PHASER.sup.37 in the CCP4 software suite.sup.38,39 using Pseudomonas aeruginosa hypothetical protein PA3332 (PDB 1Z1 S) as the model.sup.40. Refinement and model building were carried out using Refmac5.sup.41 and COOT (Crystallography Object-Oriented Toolkit).sup.42, respectively. The geometric quality of the final model was validated using ProCheck.sup.43, SFCheck.sup.44 and MolProbity.sup.45, as well as the validation tools provided by the RCSB Protein Data Base.sup.46.
(182) The diffraction dataset collected from the DIG10.3.sub.t-his.sub.6, crystal collected could only be processed to 3.2 Å resolution in space group C2. Significant disorder was displayed in several of the independent copies of protein-ligand complex in the asymmetric unit, which resulted in very high average B-factors.
(183) Fluorescence polarization equilibrium binding assays. Fluorescence polarization-based affinity measurements of designs and their evolved variants were performed as noted previously.sup.47 using Alexa488-conjugated DIG (DIG-PEG.sub.3-Alexa488). In a typical experiment, the concentration of DIG-PEG.sub.3-Alexa488 was fixed below the K.sub.d of the interaction being monitored and the effect of increasing concentrations of protein on the fluorescence anisotropy of Alexa488 was determined. Fluorescence anisotropy (r) was measured in 96-well plate format on a SpectraMax M5e microplate reader (Molecular Devices) with λ.sub.ex=485 nM and λ.sub.em=538 nM using a 515 nm emission cutoff filter. In all experiments, PBS (pH 7.4) was used as the buffer system and the temperature was 25° C. DIG-PEG.sub.3-Alexa488 solutions were prepared from a 1 mM stock in DMSO. Equilibrium dissociation constants (K.sub.d) were determined by fitting plots of the anisotropy averaged over a period of 20 to 40 min after reaction initiation versus protein concentration as described previously.sup.47. Reported K.sub.d values represent the average of at least three independent measurements with at least two separate batches of purified protein Design-TEV-his.sub.6 constructs were used for all measurements. The [DIG-PEG3-Alexa488] used for sets of experiments on each protein are as follows: DIG5: 2 pM, DIG10: 2 pM, 1z1s: 2 μM, BSA: 2 pM, DIG10.1a: 10 nM, DIG10.2: 1 nM, DIG10.3: 0.5 nM, DIG10.3 Y34F: 2 nM, DIG10.3 Y99F: 2 nM, DIG10.3 Y101F: 2 nM, DIG10.3 Y115: 2 nM, DIG10.3 Y99F/Y01F: 2 nM, DIG10.3 Y34F/Y99F/Y101F: 10 nM, and DIG10.3 Y34F/Y99F/Y101F/Y11S5F: 10 nM.
(184) Fluorescence polarization equilibrium competition binding assays. Fluorescence polarization equilibrium competition binding assays were used to determine the binding affinities of DIG10.3 and its variants for unlabeled digoxigenin, digitoxigenin, progesterone, β-estradiol, and digoxin. In a typical experiment, the concentration of DIG-PEG.sub.3-Alexa488 was kept near or below the K.sub.d of the interaction being monitored, the concentration of protein was fixed at a saturating value such that >95% the DIG-PEG.sub.3-Alexa488 in the system was bound to protein, and the effects of increasing concentrations of unlabeled ligand on the fluorescence anisotropy of Alexa488 were determined as noted above. Unlabeled stock solutions of digoxigenin, digitoxigenin, progesterone, and β-estradiol were prepared in methanol. Unlabeled stock solutions of digoxin were prepared in DMSO. Ligand stock solutions were 10 mM for DIG, digitoxigenin, and digoxin, and 1 mM for progesterone and β-estradiol. For each ligand concentration, a negative control sample containing only DIG-PEG.sub.3-Alexa488 and the appropriate dilution of a corresponding methanol-only control solution in PBS was measured. At all concentrations employed, methanol did not affect fluorescence anisotropy (data not shown). Similarly, the highest concentration of DMSO employed also did not affect fluorescence anisotropy (data not shown).
(185) Fluorescence anisotropy (r) was measured as noted above. In all experiments, PBS (pH 7.4) was used as the buffer system and the temperature was 25° C. The concentration of total unlabeled ligand producing 50% binding signal inhibition (I.sub.50) was determined by fitting a plot of the anisotropy averaged over a period of 30 min to 3 hr after reaction initiation versus unlabeled ligand concentration as described previously.sup.47. For some experiments, limiting steroid concentrations made it impossible to collect data in the regime of complete inhibition. In these cases, data were fit by fixing the anisotropy at infinite steroid concentration to a value measured for other steroids for which this value could be determined experimentally. For cases in which K.sub.d for steroid <<K.sub.d for DIG-PEG.sub.3-Alexa488, the data could not be fit to the model and only qualitative conclusions could be reached (
(186) The inhibition constant for each protein-ligand interaction, K.sub.i, was calculated from the measured IC.sub.50 and the K.sub.d of the protein-label interaction according to a model accounting for receptor-depletion conditions.sup.47. IC.sub.50 values, the concentrations of free unlabeled ligand producing 50% binding signal inhibition, were calculated from the measured I.sub.50 values.sup.47. Reported I.sub.50 and subsequent K.sub.i values represent the average of at least three independent measurements from at least two batches of purified protein and a fresh unlabeled inhibitor stock prepared for each. For DIG10.3, [DIG-PEG.sub.3-Alexa488]=1 nM and [DIG0.3-TEV-his.sub.6]=20 nM. For DIG0.3 Y34F, [DIG-PEG.sub.3-Alexa488]=10 nM and [DIG10.3 Y34F-TEV-his.sub.6]=200 nM. For DIG10.3 Y101F, [DIG-PEG.sub.3-Alexa488]=10 nM and [DIG10.3 Y101F-TEV-his.sub.6]=200 nM. For DIG10.3 Y34F/Y99F/Y101F, [DIG-PEG.sub.3-Alexa488]=500 nM and [DIG10.3 Y34F/Y99F/Y101F-TEV-his.sub.6]=5 μM.
(187) Circular dichroism spectroscopy. Circular dichroism spectra were collected on an Aviv 62A DS spectrometer. Samples were prepared in PBS. Fixed-temperature scans were conducted at 25° C. All proteins were stable <°60 C.
REFERENCES
(188) 1. Schreier, B., Stumpp, C., Wiesner, S., & Höcker, B. Computational design of ligand binding is not a solved problem. Proc. Natl. Acad. Sci. USA 106, 18491-18496 (2009). 2. de Wolf, F. A. & Brett, G. M. Ligand-binding proteins: their potential for application in systems for controlled delivery and uptake of ligands. Pharmacol. Rev. 52, 207-236 (2000). 3. Hunter, M. M., Margolies, M. N., Ju, A., & Haber, E. High-affinity monoclonal antibodies to the cardiac glycoside, digoxin. J. Immunol. 129, 1165-1172 (1982). 4. Shen. X. Y. Orson, F. M., & Kosten, T. R. Vaccines against drug abuse. Clin. Pharmacol. Ther. 91, 60-70 (2012). 5. Bradbury, A. R. M., Sidhu, S., Dübel, S., & McCafferty, J. Beyond natural antibodies: the power of in vitro display technologies. Nat. Biotechnol. 29, 245-254 (2011). 6. Brustad, E. M. & Arnold, F. H. Optimizing non-natural protein function with directed evolution. Curr. Opin. Chem. Biol. 15, 201-210 (2011). 7. Chen, G. et al. Isolation of high-affinity ligand-binding proteins by periplasmic expression with cytometric screening (PECS). Nat. Biotechnol. 19, 537-542 (2001). 8. Telmer, P. G. & Shilton, B. H. Structural studies of an engineered zinc biosensor reveal an unanticipated mode of zinc binding. J. Mol. Biol. 354, 829-840 (2005). 9. Baker, D. An exciting but challenging road ahead for computational enzyme design. Protein Sci. 19, 1817-1819 (2010). 10. Jiang, L. et al. De novo computational design of retro-Aldol enzymes. Science 319, 1387-1391 (2008). 11. Khare, S. D. & Fleishman, S. J. Emerging themes in the computational design of novel enzymes and protein-protein interfaces. FEBS Lett. In Press. (2013). 12. Khersonsky, O. et al. Bridging the gaps in design methodologies by evolutionary optimization of the stability and proficiency of designed Kemp eliminase KE59. Proc. Natl. Acad. Sci. USA 109, 10358-10363 (2012). 13. Röthlisberger, D. et al. Kemp elimination catalysts by computational enzyme design. Nature 453, 190-195 (2008). 14. Wang, L. et al. Structural analyses of covalent enzyme-substrate analog complexes reveal strengths and limitations of de novo enzyme design. J. Mol. Biol. 415, 615-625 (2012). 15. Boehr, D. D., Nussinov, R., & Wright, P. E. The role of dynamic conformational ensembles in biomolecular recognition. Nat. Chem. Biol. 5, 789-796 (2009). 16. Fleishman, S. J. Khare, S. D., Koga, N., & Baker. D. Restricted sidechain plasticity in the structures of native proteins and complexes. Protein Sci. 20, 753-757 (2011). 17. Lawrence, M. C. & Colman, P. M. Shape complementarity at protein/protein interfaces. J. Mol. Biol. 234, 946-950 (1993). 18. The Digitalis Investigation Group. The effect of digoxin on mortality and morbidity in patients with heart failure. N. Engl. J. Med. 336, 525-533 (1997). 19. Eisel, D., Seth, O., Grünewald-Janho, & Kruchen, B. DIG application manual for nonradioactive in situ hybridization. 4th ed. (Roche Diagnostics, Penzberg. 2008). 20. Flanagan, R. J. & Jones, A. L. Fab antibody fragments: some applications in clinical toxicology. Drug Safety 27, 1115-1133 (2004). 21. Chao, G. et al. Isolating and engineering human antibodies using yeast surface display. Nat. Protoc. 1, 755-768 (2006). 22. Fowler, D. M. et al. High-resolution mapping of protein sequence-function relationships. Nat. Methods 7, 741-746 (2010). 23. McLaughlin Jr. R. N., Poelwijk, F. J., Raman, A., Gosal, W. S., & Ranganathan, R. The spatial architecture of protein function and adaptation. Nature 491, 138-142 (2012). 24. Whitehead, T. A. et al. Optimization of affinity, specificity and function of designed influenza inhibitors using deep sequencing. Nat. Biotechnol. 30, 543-548 (2012). 25. Fersht, A. R. et al. Hydrogen bonding and biological specificity analysed by protein engineering. Nature 314, 235-238 (1985). 26. Frederick, K. K., Marlow, M. S., Valentine, K. G., & Wand, A. J. Conformational entropy in molecular recognition by proteins. Nature 448, 325-329 (2007). 27. Fleishman, S. J. & Baker, D. Role of the biomolecular energy gap in protein design, structure, and evolution. Cell 149, 262-273 (2012). 28. Zanghellini, A. et al. New algorithms and an in silico benchmark for computational enzyme design. Protein Sci. 15, 2785-2794 (2006). 29. Kuhlman, B. & Baker, D. Native protein sequences are close to optimal for their structures. Proc. Natl. Acad. Sci. USA 97, 10383-10388 (2000). 30. Rossi, A. M. & Taylor, C. W. Analysis of protein-ligand interactions by fluorescence polarization. Nat. Protoc. 6, 365-387 (2011). 31. Fleishman, S. J. et al. RosettaScripts: a scripting language interface to the Rosetta macromolecular modeling suite. PLOS ONE 6, e20161 (2011). 32. Zanghellini, A. et al. New algorithms and an in silico benchmark for computational enzyme design. Protein Sci. 15, 2785-2794 (2006). 33. Jiang. L. et al. De novo computational design of retro-aldol enzymes. Science 319, 1387-1391 (2008). 34. Röthlisberger, D. et al. Kemp elimination catalysts by computational enzyme design. Nature 453, 190-195 (2008). 35. Siegel, J. B. et al. Computational design of an enzyme catalyst for a stereoselective bimolecular Diels-Alder reaction. Science 329, 309-313 (2010). 36. Richter, F., Leaver-Fay, A., Khare, S. D., Bjelic, S., & Baker, D. De novo enzyme design using Rosetta3. PLOS ONE 6, e19230 (2011). 37. Kellogg, E. H., Leaver-Fay, A., & Baker, D. Role of conformational sampling in computing mutation-induced changes in protein structure and stability. Proteins 79, 830-838 (2010). 38. Cooper, S. et al. Predicting protein structures with a multiplayer online game. Nature 466, 756-760 (2010). 39. Fleishman, S. J., Khare, S. D., Koga, N., & Baker, D. Restricted sidechain plasticity in the structures of native proteins and complexes. Protein Sci. 20, 753-757 (2011). 40. Chao, G. et al. Isolating and engineering human antibodies using yeast surface display. Nat. Protoc. 1, 755-768 (2006). 41. Benatuil, L., Perez, J. M., Belk. J., & Hsieh, C.-M. An improved yeast transformation method for the generation of very large human antibody libraries. Protein Eng. Des. Sel. 23, 155-159 (2010). 42. Whitehead, T. A. et al. Optimization of affinity, specificity and function of designed influenza inhibitors using deep sequencing. Nat. Biotechnol. 30, 543-548 (2012). 43. Fowler, D. M., Araya, C. L., Gerard, W., & Fields, S. Enrich: software for analysis of protein function by enrichment and depletion of variants. Bioinformatics 27, 3430-3431 (2011). 44. Fowler, D. M. et al. High-resolution mapping of protein sequence-function relationships. Nat. Methods 7, 741-746 (2010). 45. McLaughlin Jr, R. N., Poelwijk, F. J., Raman, A., Gosal, W. S., & Ranganathan, R. The spatial architecture of protein function and adaptation. Nature 491, 138-142 (2012). 46. Rossi, A. M. & Taylor, C. W. Analysis of protein-ligand interactions by fluorescence polarization. Nat. Protoc. 6, 365-387 (2011).